F483334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 390 | 744 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0006264|Ga0395905_0006264_7641_8651 |
| Length | 324 |
| Sequence | MKNTAKRLAALGLAGLLAFGAGAARAEGQIRIADQFGIVYLLLDVAKDQKLIEKHGKAQGLDIAVTQVTLSGGSAMNDALLSGSLDIAAAGVGPLLTLWDRTHGRQNVRGVASLGNFPYYLVSNNPAVKTIADFGDKDRIALPAVGVSVQSRILQMAAAKTWGDAQHARLDKISVALPHPEAAAAIVKGGTEITAHFGNPPFQEQELAGNPAARVVLKSYDTTDKFRSENPKTYRAFTAALAEAAQWISANPEAATDLFLRVNKSKVDRKLVLDIVKSPEVQFKLTPQNTFALAEFMHRVGAIKNKPASARDYFFDDPHNAGAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 6 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 12 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 15 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 16 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 17 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 18 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 19 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 20 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 23 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 24 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 25 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 26 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 27 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 28 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 29 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 30 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 31 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 32 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 33 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 34 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 35 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 36 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 37 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 38 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 39 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 40 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 41 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 42 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 43 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 44 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 45 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 46 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 47 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 48 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 49 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 50 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 51 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 52 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 53 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 54 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 55 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 56 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 57 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 58 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 59 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 60 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 61 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 62 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 63 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 64 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 65 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 66 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 67 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 68 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 69 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 70 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 71 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 72 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 73 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 74 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 75 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 76 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 77 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 78 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 79 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 80 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 81 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 82 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 83 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 84 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 85 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 86 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 87 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 88 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 89 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 90 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 91 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 92 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 93 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 94 | 2941479691 | |||
| 95 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 96 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 97 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 98 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 99 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 100 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 101 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 102 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 103 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 104 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 105 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 106 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 107 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 108 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 109 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 110 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 111 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 112 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 113 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 114 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 115 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 117 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 118 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 120 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 122 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 123 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 125 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 126 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 127 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 128 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 129 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 130 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 142 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 143 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 144 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 145 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 146 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 147 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 148 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 149 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 150 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 151 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 252 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 253 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 254 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 255 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 376 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 378 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 385 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 386 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 387 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 388 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 389 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 390 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.84 |
| Metatranscriptomes | 0 |
| Isolates | 12.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.95 |
| Nodule | 2.6 |
| Rhizoplane | 3.9 |
| Rhizosphere | 59.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10021376 | 3300001979 | Bacteria | 2244 |
| 2 | JGI24735J21928_10001861 | 3300002067 | Bacteria | 7399 |
| 3 | JGI25155J39150_1000278 | 3300002704 | Bacteria | 18670 |
| 4 | JGI25155J39150_1000435 | 3300002704 | Bacteria | 11038 |
| 5 | JGI25156J39149_1000603 | 3300002705 | Bacteria | 19976 |
| 6 | JGI25162J39368_1004886 | 3300002737 | Bacteria | 2874 |
| 7 | JGI25154J39366_1000296 | 3300002738 | Bacteria | 29599 |
| 8 | JGI25154J39366_1000546 | 3300002738 | Bacteria | 18670 |
| 9 | JGI25157J39369_1000507 | 3300002741 | Bacteria | 23998 |
| 10 | JGI25152J39213_1009578 | 3300002773 | Bacteria | 2289 |
| 11 | JGI25150J39212_1007157 | 3300002774 | Bacteria | 2259 |
| 12 | JGI25159J45721_1023305 | 3300002987 | Bacteria | 1125 |
| 13 | JGI25151J46595_10000065 | 3300003187 | Bacteria | 145136 |
| 14 | JGI25151J46595_10000356 | 3300003187 | Bacteria | 48719 |
| 15 | JGI25151J46595_10002865 | 3300003187 | Bacteria | 9916 |
| 16 | JGI25151J46595_10004463 | 3300003187 | Bacteria | 7398 |
| 17 | JGI25151J46595_10022671 | 3300003187 | Bacteria | 2602 |
| 18 | JGI25151J46595_10030097 | 3300003187 | Bacteria | 2140 |
| 19 | JGI25153J46596_10021175 | 3300003215 | Bacteria | 2430 |
| 20 | rootH2_10144172 | 3300003320 | Bacteria | 1733 |
| 21 | rootL2_10056250 | 3300003322 | Bacteria | 6100 |
| 22 | rootL2_10097683 | 3300003322 | Bacteria | 6819 |
| 23 | Ga0055538_1000053 | 3300003751 | Bacteria | 127408 |
| 24 | Ga0055539_1000078 | 3300003752 | Bacteria | 127408 |
| 25 | Ga0055533_1000084 | 3300003756 | Bacteria | 127408 |
| 26 | Ga0055532_1000089 | 3300003758 | Bacteria | 105631 |
| 27 | Ga0055525_1000112 | 3300003759 | Bacteria | 127408 |
| 28 | Ga0055535_1004789 | 3300003761 | Bacteria | 3165 |
| 29 | Ga0055535_1007254 | 3300003761 | Bacteria | 2139 |
| 30 | Ga0055542_1000084 | 3300003762 | Bacteria | 125518 |
| 31 | Ga0055526_1000289 | 3300003771 | Bacteria | 42000 |
| 32 | Ga0055526_1002292 | 3300003771 | Bacteria | 13062 |
| 33 | Ga0055526_1005476 | 3300003771 | Bacteria | 7286 |
| 34 | Ga0055537_1000409 | 3300003773 | Bacteria | 28111 |
| 35 | Ga0055524_1000203 | 3300003775 | Bacteria | 64635 |
| 36 | Ga0055524_1001775 | 3300003775 | Bacteria | 11868 |
| 37 | Ga0055524_1006315 | 3300003775 | Bacteria | 5154 |
| 38 | Ga0055536_1000026 | 3300003781 | Bacteria | 166220 |
| 39 | Ga0055536_1001919 | 3300003781 | Bacteria | 12045 |
| 40 | Ga0055536_1035560 | 3300003781 | Bacteria | 1244 |
| 41 | Ga0055534_1000189 | 3300003784 | Bacteria | 45268 |
| 42 | Ga0055534_1000873 | 3300003784 | Bacteria | 13789 |
| 43 | Ga0055534_1001063 | 3300003784 | Bacteria | 11875 |
| 44 | Ga0055530_10001195 | 3300003791 | Bacteria | 20077 |
| 45 | Ga0055530_10002316 | 3300003791 | Bacteria | 12445 |
| 46 | Ga0055540_1000119 | 3300003792 | Bacteria | 82568 |
| 47 | Ga0055540_1004031 | 3300003792 | Bacteria | 6834 |
| 48 | Ga0055540_1009042 | 3300003792 | Bacteria | 3502 |
| 49 | Ga0055540_1012930 | 3300003792 | Bacteria | 2584 |
| 50 | Ga0055531_10003661 | 3300003794 | Bacteria | 9688 |
| 51 | Ga0055531_10023250 | 3300003794 | Bacteria | 2331 |
| 52 | Ga0055541_1000055 | 3300003841 | Bacteria | 127408 |
| 53 | Ga0065165_1001419 | 3300005262 | Bacteria | 26069 |
| 54 | Ga0065714_10075233 | 3300005288 | Bacteria | 2931 |
| 55 | Ga0065715_10000585 | 3300005293 | Bacteria | 14517 |
| 56 | Ga0070658_10146196 | 3300005327 | Bacteria | 1977 |
| 57 | Ga0070670_100019932 | 3300005331 | Bacteria | 5757 |
| 58 | Ga0070666_10234942 | 3300005335 | Bacteria | 1295 |
| 59 | Ga0070682_100231570 | 3300005337 | Bacteria | 1321 |
| 60 | Ga0070660_100035788 | 3300005339 | Bacteria | 3759 |
| 61 | Ga0070673_100188926 | 3300005364 | Bacteria | 1768 |
| 62 | Ga0070659_100014815 | 3300005366 | Bacteria | 5830 |
| 63 | Ga0070662_100097260 | 3300005457 | Bacteria | 2222 |
| 64 | Ga0070662_100108379 | 3300005457 | Bacteria | 2112 |
| 65 | Ga0070662_100130378 | 3300005457 | Bacteria | 1938 |
| 66 | Ga0068855_100036130 | 3300005563 | Bacteria | 5882 |
| 67 | Ga0068855_100083619 | 3300005563 | Bacteria | 3697 |
| 68 | Ga0070664_100023285 | 3300005564 | Bacteria | 5115 |
| 69 | Ga0068857_100029509 | 3300005577 | Bacteria | 4840 |
| 70 | Ga0068857_100120080 | 3300005577 | Bacteria | 2366 |
| 71 | Ga0068854_100037948 | 3300005578 | Bacteria | 3385 |
| 72 | Ga0068856_100005665 | 3300005614 | Bacteria | 12296 |
| 73 | Ga0068852_100025954 | 3300005616 | Bacteria | 4755 |
| 74 | Ga0068852_100402317 | 3300005616 | Bacteria | 1347 |
| 75 | Ga0068851_10006805 | 3300005834 | Bacteria | 5231 |
| 76 | Ga0068862_100192029 | 3300005844 | Bacteria | 1838 |
| 77 | Ga0075364_10024414 | 3300006051 | Bacteria | 3839 |
| 78 | Ga0075364_10167379 | 3300006051 | Bacteria | 1485 |
| 79 | Ga0075370_10002922 | 3300006353 | Bacteria | 8028 |
| 80 | Ga0075370_10005862 | 3300006353 | Bacteria | 6140 |
| 81 | Ga0079104_1000019 | 3300006946 | Bacteria | 269313 |
| 82 | Ga0079104_1004008 | 3300006946 | Bacteria | 6536 |
| 83 | Ga0099826_10000074 | 3300006948 | Bacteria | 52710 |
| 84 | Ga0105251_10000335 | 3300009011 | Bacteria | 47275 |
| 85 | Ga0105244_10005858 | 3300009036 | Bacteria | 8071 |
| 86 | Ga0105240_10017286 | 3300009093 | Bacteria | 9725 |
| 87 | Ga0105240_10558615 | 3300009093 | Bacteria | 1265 |
| 88 | Ga0105243_10003150 | 3300009148 | Bacteria | 13542 |
| 89 | Ga0105243_10006289 | 3300009148 | Bacteria | 9175 |
| 90 | Ga0105243_10021336 | 3300009148 | Bacteria | 4916 |
| 91 | Ga0105241_10081750 | 3300009174 | Bacteria | 2531 |
| 92 | Ga0105242_10017049 | 3300009176 | Bacteria | 5655 |
| 93 | Ga0105248_10117010 | 3300009177 | Bacteria | 3006 |
| 94 | Ga0105248_10182322 | 3300009177 | Bacteria | 2366 |
| 95 | Ga0105237_10010237 | 3300009545 | Bacteria | 9992 |
| 96 | Ga0105237_10139121 | 3300009545 | Bacteria | 2422 |
| 97 | Ga0105237_10389383 | 3300009545 | Bacteria | 1399 |
| 98 | Ga0105238_10000125 | 3300009551 | Bacteria | 84436 |
| 99 | Ga0105238_10250395 | 3300009551 | Bacteria | 1750 |
| 100 | Ga0105238_10351303 | 3300009551 | Bacteria | 1463 |
| 101 | Ga0105238_10380894 | 3300009551 | Bacteria | 1402 |
| 102 | Ga0105239_10003165 | 3300010375 | Bacteria | 20393 |
| 103 | Ga0105239_10432678 | 3300010375 | Bacteria | 1491 |
| 104 | Ga0105246_10041696 | 3300011119 | Bacteria | 3104 |
| 105 | Ga0157371_10032343 | 3300013102 | Bacteria | 3765 |
| 106 | Ga0157371_10254747 | 3300013102 | Bacteria | 1264 |
| 107 | Ga0157370_10249487 | 3300013104 | Bacteria | 1642 |
| 108 | Ga0157369_10031722 | 3300013105 | Bacteria | 5815 |
| 109 | Ga0163162_10007880 | 3300013306 | Bacteria | 10377 |
| 110 | Ga0163162_10012287 | 3300013306 | Bacteria | 8360 |
| 111 | Ga0163162_10190964 | 3300013306 | Bacteria | 2176 |
| 112 | Ga0157372_10064239 | 3300013307 | Bacteria | 4118 |
| 113 | Ga0157375_10018197 | 3300013308 | Bacteria | 6368 |
| 114 | Ga0182008_10000579 | 3300014497 | Bacteria | 27013 |
| 115 | Ga0182008_10003531 | 3300014497 | Bacteria | 9398 |
| 116 | Ga0182006_1000912 | 3300015261 | Bacteria | 19708 |
| 117 | Ga0182006_1017245 | 3300015261 | Bacteria | 3070 |
| 118 | Ga0182007_10003417 | 3300015262 | Bacteria | 7481 |
| 119 | Ga0183361_10008 | 3300016635 | Bacteria | 259171 |
| 120 | Ga0163161_10001053 | 3300017792 | Bacteria | 20949 |
| 121 | Ga0163161_10066144 | 3300017792 | Bacteria | 2639 |
| 122 | Ga0163161_10223794 | 3300017792 | Bacteria | 1458 |
| 123 | Ga0213872_10000043 | 3300021361 | Bacteria | 117678 |
| 124 | Ga0213872_10000086 | 3300021361 | Bacteria | 84955 |
| 125 | Ga0213872_10005011 | 3300021361 | Bacteria | 6876 |
| 126 | Ga0213872_10026701 | 3300021361 | Bacteria | 2652 |
| 127 | Ga0209435_100088 | 3300025206 | Bacteria | 43747 |
| 128 | Ga0209435_100155 | 3300025206 | Bacteria | 22381 |
| 129 | Ga0209436_105353 | 3300025208 | Bacteria | 2970 |
| 130 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 131 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 132 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 133 | Ga0209672_100776 | 3300025228 | Bacteria | 15278 |
| 134 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 135 | Ga0209147_101867 | 3300025229 | Bacteria | 6422 |
| 136 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 137 | Ga0209437_100442 | 3300025233 | Bacteria | 34637 |
| 138 | Ga0209437_109925 | 3300025233 | Bacteria | 1469 |
| 139 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 140 | Ga0209258_100790 | 3300025242 | Bacteria | 18961 |
| 141 | Ga0207425_1000552 | 3300025245 | Bacteria | 22339 |
| 142 | Ga0209646_1000101 | 3300025246 | Bacteria | 164503 |
| 143 | Ga0209646_1000176 | 3300025246 | Bacteria | 81901 |
| 144 | Ga0209026_1000264 | 3300025250 | Bacteria | 64186 |
| 145 | Ga0209026_1001144 | 3300025250 | Bacteria | 12465 |
| 146 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 147 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 148 | Ga0209759_1000264 | 3300025256 | Bacteria | 75893 |
| 149 | Ga0209759_1000296 | 3300025256 | Bacteria | 68965 |
| 150 | Ga0209129_1000147 | 3300025258 | Bacteria | 115120 |
| 151 | Ga0209129_1002420 | 3300025258 | Bacteria | 9170 |
| 152 | Ga0209129_1010367 | 3300025258 | Bacteria | 2332 |
| 153 | Ga0209565_1000109 | 3300025263 | Bacteria | 120345 |
| 154 | Ga0209565_1000282 | 3300025263 | Bacteria | 50138 |
| 155 | Ga0209565_1003395 | 3300025263 | Bacteria | 5180 |
| 156 | Ga0209565_1004483 | 3300025263 | Bacteria | 4225 |
| 157 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 158 | Ga0209673_1001256 | 3300025273 | Bacteria | 26191 |
| 159 | Ga0209673_1001287 | 3300025273 | Bacteria | 25651 |
| 160 | Ga0209130_1001468 | 3300025284 | Bacteria | 15478 |
| 161 | Ga0209130_1001869 | 3300025284 | Bacteria | 12044 |
| 162 | Ga0209130_1021883 | 3300025284 | Bacteria | 1435 |
| 163 | Ga0209675_1000026 | 3300025291 | Bacteria | 284716 |
| 164 | Ga0209675_1000118 | 3300025291 | Bacteria | 110507 |
| 165 | Ga0209675_1000745 | 3300025291 | Bacteria | 21972 |
| 166 | Ga0209675_1001335 | 3300025291 | Bacteria | 14600 |
| 167 | Ga0209675_1003453 | 3300025291 | Bacteria | 7508 |
| 168 | Ga0209675_1004919 | 3300025291 | Bacteria | 5768 |
| 169 | Ga0209675_1011912 | 3300025291 | Bacteria | 2844 |
| 170 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 171 | Ga0209676_1000059 | 3300025292 | Bacteria | 344882 |
| 172 | Ga0209676_1000216 | 3300025292 | Bacteria | 125759 |
| 173 | Ga0209676_1000486 | 3300025292 | Bacteria | 64563 |
| 174 | Ga0209676_1006414 | 3300025292 | Bacteria | 5815 |
| 175 | Ga0209676_1008584 | 3300025292 | Bacteria | 4531 |
| 176 | Ga0209025_1000066 | 3300025294 | Bacteria | 298742 |
| 177 | Ga0209025_1000159 | 3300025294 | Bacteria | 167081 |
| 178 | Ga0209025_1000198 | 3300025294 | Bacteria | 146276 |
| 179 | Ga0209025_1000375 | 3300025294 | Bacteria | 93043 |
| 180 | Ga0209025_1000503 | 3300025294 | Bacteria | 75048 |
| 181 | Ga0209025_1001127 | 3300025294 | Bacteria | 38261 |
| 182 | Ga0209025_1002020 | 3300025294 | Bacteria | 23152 |
| 183 | Ga0209025_1004317 | 3300025294 | Bacteria | 12442 |
| 184 | Ga0209025_1030131 | 3300025294 | Bacteria | 2605 |
| 185 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 186 | Ga0209564_1000084 | 3300025295 | Bacteria | 252729 |
| 187 | Ga0209564_1000161 | 3300025295 | Bacteria | 162489 |
| 188 | Ga0209564_1000220 | 3300025295 | Bacteria | 129579 |
| 189 | Ga0209564_1000327 | 3300025295 | Bacteria | 92740 |
| 190 | Ga0209564_1001556 | 3300025295 | Bacteria | 22580 |
| 191 | Ga0209758_1000199 | 3300025297 | Bacteria | 133164 |
| 192 | Ga0209758_1008905 | 3300025297 | Bacteria | 6369 |
| 193 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 194 | Ga0209050_1000133 | 3300025298 | Bacteria | 184688 |
| 195 | Ga0209050_1000478 | 3300025298 | Bacteria | 70631 |
| 196 | Ga0209050_1003977 | 3300025298 | Bacteria | 10426 |
| 197 | Ga0209050_1013309 | 3300025298 | Bacteria | 3666 |
| 198 | Ga0209050_1025015 | 3300025298 | Bacteria | 2044 |
| 199 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 200 | Ga0209256_1000117 | 3300025299 | Bacteria | 169435 |
| 201 | Ga0209256_1000206 | 3300025299 | Bacteria | 111425 |
| 202 | Ga0209256_1000602 | 3300025299 | Bacteria | 49884 |
| 203 | Ga0209256_1001890 | 3300025299 | Bacteria | 19210 |
| 204 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 205 | Ga0207426_1000166 | 3300025302 | Bacteria | 169435 |
| 206 | Ga0207426_1005743 | 3300025302 | Bacteria | 5588 |
| 207 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 208 | Ga0209051_1000063 | 3300025303 | Bacteria | 249739 |
| 209 | Ga0209051_1000255 | 3300025303 | Bacteria | 89418 |
| 210 | Ga0209051_1000440 | 3300025303 | Bacteria | 56410 |
| 211 | Ga0209051_1006243 | 3300025303 | Bacteria | 6757 |
| 212 | Ga0209051_1010689 | 3300025303 | Bacteria | 4603 |
| 213 | Ga0209051_1016101 | 3300025303 | Bacteria | 3408 |
| 214 | Ga0209051_1018820 | 3300025303 | Bacteria | 3041 |
| 215 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 216 | Ga0209257_1000118 | 3300025304 | Bacteria | 225963 |
| 217 | Ga0209257_1003603 | 3300025304 | Bacteria | 13054 |
| 218 | Ga0209257_1006169 | 3300025304 | Bacteria | 7903 |
| 219 | Ga0207656_10047471 | 3300025321 | Bacteria | 1846 |
| 220 | Ga0207655_1000689 | 3300025728 | Bacteria | 39302 |
| 221 | Ga0207713_1003535 | 3300025735 | Bacteria | 10585 |
| 222 | Ga0207713_1036865 | 3300025735 | Bacteria | 2092 |
| 223 | Ga0207647_10052444 | 3300025904 | Bacteria | 2518 |
| 224 | Ga0207705_10000223 | 3300025909 | Bacteria | 56633 |
| 225 | Ga0207654_10035446 | 3300025911 | Bacteria | 2780 |
| 226 | Ga0207695_10002329 | 3300025913 | Bacteria | 28298 |
| 227 | Ga0207695_10003770 | 3300025913 | Bacteria | 21033 |
| 228 | Ga0207695_10063866 | 3300025913 | Bacteria | 3793 |
| 229 | Ga0207695_10083955 | 3300025913 | Bacteria | 3216 |
| 230 | Ga0207671_10002331 | 3300025914 | Bacteria | 20489 |
| 231 | Ga0207671_10156929 | 3300025914 | Bacteria | 1760 |
| 232 | Ga0207657_10026304 | 3300025919 | Bacteria | 5349 |
| 233 | Ga0207657_10200028 | 3300025919 | Bacteria | 1608 |
| 234 | Ga0207694_10001397 | 3300025924 | Bacteria | 20729 |
| 235 | Ga0207694_10045712 | 3300025924 | Bacteria | 3382 |
| 236 | Ga0207650_10004198 | 3300025925 | Bacteria | 9841 |
| 237 | Ga0207690_10352918 | 3300025932 | Bacteria | 1163 |
| 238 | Ga0207706_10063890 | 3300025933 | Bacteria | 3241 |
| 239 | Ga0207706_10093265 | 3300025933 | Bacteria | 2648 |
| 240 | Ga0207706_10163822 | 3300025933 | Bacteria | 1954 |
| 241 | Ga0207686_10000746 | 3300025934 | Bacteria | 20059 |
| 242 | Ga0207709_10001078 | 3300025935 | Bacteria | 20070 |
| 243 | Ga0207709_10003894 | 3300025935 | Bacteria | 8725 |
| 244 | Ga0207709_10008677 | 3300025935 | Bacteria | 5608 |
| 245 | Ga0207704_10214941 | 3300025938 | Bacteria | 1418 |
| 246 | Ga0207711_10329710 | 3300025941 | Bacteria | 1411 |
| 247 | Ga0207679_10008799 | 3300025945 | Bacteria | 6437 |
| 248 | Ga0207679_10084716 | 3300025945 | Bacteria | 2433 |
| 249 | Ga0207667_10013354 | 3300025949 | Bacteria | 9401 |
| 250 | Ga0207667_10032546 | 3300025949 | Bacteria | 5617 |
| 251 | Ga0207651_10162383 | 3300025960 | Bacteria | 1753 |
| 252 | Ga0207640_10044059 | 3300025981 | Bacteria | 2856 |
| 253 | Ga0207639_10401445 | 3300026041 | Bacteria | 1235 |
| 254 | Ga0207678_10064508 | 3300026067 | Bacteria | 3147 |
| 255 | Ga0207702_10048467 | 3300026078 | Bacteria | 3583 |
| 256 | Ga0207674_10034062 | 3300026116 | Bacteria | 5327 |
| 257 | Ga0207674_10101251 | 3300026116 | Bacteria | 2862 |
| 258 | Ga0207683_10302047 | 3300026121 | Bacteria | 1464 |
| 259 | Ga0207683_10431174 | 3300026121 | Bacteria | 1215 |
| 260 | Ga0207698_10113843 | 3300026142 | Bacteria | 2274 |
| 261 | Ga0207698_10287080 | 3300026142 | Bacteria | 1525 |
| 262 | Ga0209281_1000160 | 3300027111 | Bacteria | 161071 |
| 263 | Ga0209282_1000113 | 3300027666 | Bacteria | 52714 |
| 264 | Ga0268265_10089327 | 3300028380 | Bacteria | 2457 |
| 265 | Ga0307515_10000215 | 3300028794 | Bacteria | 142594 |
| 266 | Ga0307515_10000267 | 3300028794 | Bacteria | 128554 |
| 267 | Ga0265338_10000045 | 3300028800 | Bacteria | 223264 |
| 268 | Ga0265338_10001261 | 3300028800 | Bacteria | 41728 |
| 269 | Ga0265331_10000850 | 3300031250 | Bacteria | 24826 |
| 270 | Ga0265327_10001272 | 3300031251 | Bacteria | 33201 |
| 271 | Ga0265327_10007497 | 3300031251 | Bacteria | 8411 |
| 272 | Ga0307513_10014657 | 3300031456 | Bacteria | 9544 |
| 273 | Ga0307514_10000806 | 3300031649 | Bacteria | 51095 |
| 274 | Ga0307405_10058007 | 3300031731 | Bacteria | 2434 |
| 275 | Ga0307405_10058723 | 3300031731 | Bacteria | 2422 |
| 276 | Ga0307412_10000120 | 3300031911 | Bacteria | 59537 |
| 277 | Ga0307412_10081052 | 3300031911 | Bacteria | 2243 |
| 278 | Ga0307416_100207257 | 3300032002 | Bacteria | 1866 |
| 279 | Ga0307416_100298625 | 3300032002 | Bacteria | 1599 |
| 280 | Ga0307416_100315814 | 3300032002 | Bacteria | 1562 |
| 281 | Ga0307510_10000462 | 3300033180 | Bacteria | 39513 |
| 282 | Ga0395899_0001188 | 3300037312 | Bacteria | 22947 |
| 283 | Ga0395899_0075159 | 3300037312 | Bacteria | 2467 |
| 284 | Ga0395900_0000497 | 3300037418 | Bacteria | 55302 |
| 285 | Ga0395900_0027237 | 3300037418 | Bacteria | 5853 |
| 286 | Ga0395900_0098421 | 3300037418 | Bacteria | 3005 |
| 287 | Ga0395900_0203525 | 3300037418 | Bacteria | 2002 |
| 288 | Ga0395900_0521185 | 3300037418 | Bacteria | 1136 |
| 289 | Ga0395898_0005084 | 3300037466 | Bacteria | 14256 |
| 290 | Ga0395898_0116731 | 3300037466 | Bacteria | 2557 |
| 291 | Ga0395898_0120157 | 3300037466 | Bacteria | 2517 |
| 292 | Ga0395898_0230158 | 3300037466 | Bacteria | 1768 |
| 293 | Ga0395905_0006264 | 3300037471 | Bacteria | 12008 |
| 294 | Ga0395905_0016771 | 3300037471 | Bacteria | 6961 |
| 295 | Ga0395905_0054981 | 3300037471 | Bacteria | 3725 |
| 296 | Ga0395905_0087515 | 3300037471 | Bacteria | 2920 |
| 297 | Ga0395901_0016576 | 3300038443 | Bacteria | 7508 |
| 298 | Ga0436361_0082685 | 3300039447 | Bacteria | 7552 |
| 299 | Ga0436361_0442878 | 3300039447 | Bacteria | 7602 |
| 300 | Ga0436361_0493011 | 3300039447 | Bacteria | 8828 |
| 301 | Ga0436361_0943694 | 3300039447 | Bacteria | 119574 |
| 302 | Ga0436361_1133215 | 3300039447 | Bacteria | 77136 |
| 303 | Ga0436361_1136892 | 3300039447 | Bacteria | 5983 |
| 304 | Ga0451841_1002159 | 3300041498 | Bacteria | 1227 |
| 305 | Ga0450911_000086 | 3300042115 | Bacteria | 37180 |
| 306 | Ga0450923_021396 | 3300042125 | Bacteria | 1261 |
| 307 | Ga0450898_009738 | 3300042134 | Bacteria | 1542 |
| 308 | Ga0450918_000093 | 3300042531 | Bacteria | 18997 |
| 309 | Ga0466969_0040944 | 3300044656 | Bacteria | 2320 |
| 310 | Ga0466972_0057401 | 3300044658 | Bacteria | 1870 |
| 311 | Ga0466965_0011432 | 3300044683 | Bacteria | 4160 |
| 312 | Ga0466965_0020839 | 3300044683 | Bacteria | 3154 |
| 313 | Ga0466965_0034922 | 3300044683 | Bacteria | 2462 |
| 314 | Ga0466966_0160128 | 3300044684 | Bacteria | 1370 |
| 315 | Ga0466961_0035934 | 3300044693 | Bacteria | 3181 |
| 316 | Ga0466968_0020072 | 3300044735 | Bacteria | 2694 |
| 317 | Ga0466970_0060533 | 3300044765 | Bacteria | 2028 |
| 318 | Ga0466957_0000005 | 3300044842 | Bacteria | 102026 |
| 319 | Ga0466958_0017206 | 3300045836 | Bacteria | 4175 |
| 320 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 321 | Ga0495617_000061 | 3300046452 | Bacteria | 96850 |
| 322 | Ga0495617_002891 | 3300046452 | Bacteria | 6608 |
| 323 | Ga0495627_000026 | 3300046453 | Bacteria | 238494 |
| 324 | Ga0495627_000065 | 3300046453 | Bacteria | 132414 |
| 325 | Ga0495603_0001852 | 3300046455 | Bacteria | 12474 |
| 326 | Ga0495590_0000023 | 3300046457 | Bacteria | 196939 |
| 327 | Ga0495590_0000083 | 3300046457 | Bacteria | 62385 |
| 328 | Ga0495590_0001408 | 3300046457 | Bacteria | 10437 |
| 329 | Ga0495590_0003678 | 3300046457 | Bacteria | 6243 |
| 330 | Ga0495590_0034983 | 3300046457 | Bacteria | 1754 |
| 331 | Ga0495591_000038 | 3300046458 | Bacteria | 157347 |
| 332 | Ga0495629_0000088 | 3300046459 | Bacteria | 80848 |
| 333 | Ga0495629_0037348 | 3300046459 | Bacteria | 3424 |
| 334 | Ga0495638_0000067 | 3300046460 | Bacteria | 167869 |
| 335 | Ga0495638_0062390 | 3300046460 | Bacteria | 2301 |
| 336 | Ga0495651_0113752 | 3300046462 | Bacteria | 1997 |
| 337 | Ga0495653_0000018 | 3300046463 | Bacteria | 185787 |
| 338 | Ga0495653_0001244 | 3300046463 | Bacteria | 19708 |
| 339 | Ga0495650_0001305 | 3300046471 | Bacteria | 25286 |
| 340 | Ga0495650_0002073 | 3300046471 | Bacteria | 17371 |
| 341 | Ga0495650_0002855 | 3300046471 | Bacteria | 13213 |
| 342 | Ga0495650_0008218 | 3300046471 | Bacteria | 6129 |
| 343 | Ga0495650_0011102 | 3300046471 | Bacteria | 4965 |
| 344 | Ga0495580_0000056 | 3300046472 | Bacteria | 64894 |
| 345 | Ga0495580_0010163 | 3300046472 | Bacteria | 7350 |
| 346 | Ga0495582_0066393 | 3300046473 | Bacteria | 1993 |
| 347 | Ga0495605_0000004 | 3300046474 | Bacteria | 395282 |
| 348 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 349 | Ga0495605_0000262 | 3300046474 | Bacteria | 61506 |
| 350 | Ga0495605_0007936 | 3300046474 | Bacteria | 6011 |
| 351 | Ga0495605_0016154 | 3300046474 | Bacteria | 4044 |
| 352 | Ga0495605_0018303 | 3300046474 | Bacteria | 3757 |
| 353 | Ga0495605_0061276 | 3300046474 | Bacteria | 1801 |
| 354 | Ga0495605_0077002 | 3300046474 | Bacteria | 1565 |
| 355 | Ga0495639_0027630 | 3300046475 | Bacteria | 2512 |
| 356 | Ga0495584_0000075 | 3300046491 | Bacteria | 70256 |
| 357 | Ga0495584_0000234 | 3300046491 | Bacteria | 39911 |
| 358 | Ga0495584_0012819 | 3300046491 | Bacteria | 4277 |
| 359 | Ga0495584_0020139 | 3300046491 | Bacteria | 3390 |
| 360 | Ga0495584_0053300 | 3300046491 | Bacteria | 2036 |
| 361 | Ga0495584_0073824 | 3300046491 | Bacteria | 1714 |
| 362 | Ga0495584_0092552 | 3300046491 | Bacteria | 1525 |
| 363 | Ga0495585_0000521 | 3300046492 | Bacteria | 36396 |
| 364 | Ga0495585_0002143 | 3300046492 | Bacteria | 14401 |
| 365 | Ga0495585_0063822 | 3300046492 | Bacteria | 2020 |
| 366 | Ga0495585_0102178 | 3300046492 | Bacteria | 1532 |
| 367 | Ga0495596_0000353 | 3300046500 | Bacteria | 29811 |
| 368 | Ga0495596_0001540 | 3300046500 | Bacteria | 13166 |
| 369 | Ga0495596_0001910 | 3300046500 | Bacteria | 11567 |
| 370 | Ga0495596_0006189 | 3300046500 | Bacteria | 5542 |
| 371 | Ga0495596_0006673 | 3300046500 | Bacteria | 5285 |
| 372 | Ga0495596_0008428 | 3300046500 | Bacteria | 4588 |
| 373 | Ga0495596_0018767 | 3300046500 | Bacteria | 2849 |
| 374 | Ga0495607_0000272 | 3300046501 | Bacteria | 55661 |
| 375 | Ga0495607_0001693 | 3300046501 | Bacteria | 18970 |
| 376 | Ga0495607_0001836 | 3300046501 | Bacteria | 18090 |
| 377 | Ga0495607_0002147 | 3300046501 | Bacteria | 16454 |
| 378 | Ga0495607_0002797 | 3300046501 | Bacteria | 13878 |
| 379 | Ga0495607_0009775 | 3300046501 | Bacteria | 6474 |
| 380 | Ga0495607_0016406 | 3300046501 | Bacteria | 4779 |
| 381 | Ga0495583_0000134 | 3300046506 | Bacteria | 124077 |
| 382 | Ga0495583_0000162 | 3300046506 | Bacteria | 112598 |
| 383 | Ga0495583_0000345 | 3300046506 | Bacteria | 73236 |
| 384 | Ga0495583_0001117 | 3300046506 | Bacteria | 29592 |
| 385 | Ga0495583_0004563 | 3300046506 | Bacteria | 9848 |
| 386 | Ga0495583_0008005 | 3300046506 | Bacteria | 6532 |
| 387 | Ga0495583_0012287 | 3300046506 | Bacteria | 4858 |
| 388 | Ga0495583_0028120 | 3300046506 | Bacteria | 2768 |
| 389 | Ga0495583_0074465 | 3300046506 | Bacteria | 1486 |
| 390 | Ga0495583_0114397 | 3300046506 | Bacteria | 1141 |
| 391 | Ga0495606_0000755 | 3300046507 | Bacteria | 49730 |
| 392 | Ga0495606_0004822 | 3300046507 | Bacteria | 13249 |
| 393 | Ga0495606_0010046 | 3300046507 | Bacteria | 7910 |
| 394 | Ga0495606_0030185 | 3300046507 | Bacteria | 3790 |
| 395 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 396 | Ga0495610_0004953 | 3300046512 | Bacteria | 9651 |
| 397 | Ga0495610_0006834 | 3300046512 | Bacteria | 7735 |
| 398 | Ga0495610_0010610 | 3300046512 | Bacteria | 5710 |
| 399 | Ga0495610_0018789 | 3300046512 | Bacteria | 3888 |
| 400 | Ga0495610_0059988 | 3300046512 | Bacteria | 1813 |
| 401 | Ga0495616_0000796 | 3300046513 | Bacteria | 23096 |
| 402 | Ga0495616_0001609 | 3300046513 | Bacteria | 15477 |
| 403 | Ga0495616_0002314 | 3300046513 | Bacteria | 12736 |
| 404 | Ga0495616_0009081 | 3300046513 | Bacteria | 5832 |
| 405 | Ga0495616_0012282 | 3300046513 | Bacteria | 4867 |
| 406 | Ga0495616_0020294 | 3300046513 | Bacteria | 3618 |
| 407 | Ga0495616_0045258 | 3300046513 | Bacteria | 2228 |
| 408 | Ga0495620_0071760 | 3300046515 | Bacteria | 1415 |
| 409 | Ga0495628_0020955 | 3300046516 | Bacteria | 5384 |
| 410 | Ga0495628_0032728 | 3300046516 | Bacteria | 4195 |
| 411 | Ga0495630_0014034 | 3300046517 | Bacteria | 5829 |
| 412 | Ga0495631_0000007 | 3300046518 | Bacteria | 130158 |
| 413 | Ga0495631_0000438 | 3300046518 | Bacteria | 28481 |
| 414 | Ga0495631_0000980 | 3300046518 | Bacteria | 17729 |
| 415 | Ga0495631_0001103 | 3300046518 | Bacteria | 16750 |
| 416 | Ga0495631_0009591 | 3300046518 | Bacteria | 4829 |
| 417 | Ga0495631_0010803 | 3300046518 | Bacteria | 4511 |
| 418 | Ga0495631_0026006 | 3300046518 | Bacteria | 2691 |
| 419 | Ga0495631_0033643 | 3300046518 | Bacteria | 2301 |
| 420 | Ga0495631_0066757 | 3300046518 | Bacteria | 1556 |
| 421 | Ga0495632_0000024 | 3300046519 | Bacteria | 179517 |
| 422 | Ga0495632_0000028 | 3300046519 | Bacteria | 171089 |
| 423 | Ga0495632_0000043 | 3300046519 | Bacteria | 143694 |
| 424 | Ga0495632_0001594 | 3300046519 | Bacteria | 18701 |
| 425 | Ga0495632_0002005 | 3300046519 | Bacteria | 16078 |
| 426 | Ga0495632_0012261 | 3300046519 | Bacteria | 4948 |
| 427 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 428 | Ga0495637_0000456 | 3300046520 | Bacteria | 29812 |
| 429 | Ga0495637_0001478 | 3300046520 | Bacteria | 13799 |
| 430 | Ga0495637_0003770 | 3300046520 | Bacteria | 7989 |
| 431 | Ga0495637_0038480 | 3300046520 | Bacteria | 2071 |
| 432 | Ga0495637_0048937 | 3300046520 | Bacteria | 1778 |
| 433 | Ga0495643_0000138 | 3300046522 | Bacteria | 117580 |
| 434 | Ga0495643_0000829 | 3300046522 | Bacteria | 33683 |
| 435 | Ga0495643_0001229 | 3300046522 | Bacteria | 24725 |
| 436 | Ga0495643_0002875 | 3300046522 | Bacteria | 13073 |
| 437 | Ga0495643_0008722 | 3300046522 | Bacteria | 6392 |
| 438 | Ga0495643_0009176 | 3300046522 | Bacteria | 6173 |
| 439 | Ga0495643_0021681 | 3300046522 | Bacteria | 3680 |
| 440 | Ga0495643_0089697 | 3300046522 | Bacteria | 1587 |
| 441 | Ga0495644_0002155 | 3300046523 | Bacteria | 7899 |
| 442 | Ga0495644_0005637 | 3300046523 | Bacteria | 4882 |
| 443 | Ga0495644_0012939 | 3300046523 | Bacteria | 3208 |
| 444 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 445 | Ga0495648_0000022 | 3300046524 | Bacteria | 242791 |
| 446 | Ga0495648_0010741 | 3300046524 | Bacteria | 6952 |
| 447 | Ga0495648_0012248 | 3300046524 | Bacteria | 6407 |
| 448 | Ga0495648_0041114 | 3300046524 | Bacteria | 2923 |
| 449 | Ga0495666_0003483 | 3300046526 | Bacteria | 7942 |
| 450 | Ga0495642_0000001 | 3300046528 | Bacteria | 389656 |
| 451 | Ga0495642_0000041 | 3300046528 | Bacteria | 76279 |
| 452 | Ga0495642_0000124 | 3300046528 | Bacteria | 44239 |
| 453 | Ga0495642_0003464 | 3300046528 | Bacteria | 6214 |
| 454 | Ga0495642_0007249 | 3300046528 | Bacteria | 4257 |
| 455 | Ga0495642_0008755 | 3300046528 | Bacteria | 3866 |
| 456 | Ga0495642_0019716 | 3300046528 | Bacteria | 2644 |
| 457 | Ga0495652_0019824 | 3300046529 | Bacteria | 5984 |
| 458 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 459 | Ga0495654_0004648 | 3300046530 | Bacteria | 8099 |
| 460 | Ga0495654_0009589 | 3300046530 | Bacteria | 5303 |
| 461 | Ga0495654_0009711 | 3300046530 | Bacteria | 5267 |
| 462 | Ga0495654_0013403 | 3300046530 | Bacteria | 4388 |
| 463 | Ga0495654_0029866 | 3300046530 | Bacteria | 2778 |
| 464 | Ga0495586_0079556 | 3300046535 | Bacteria | 1800 |
| 465 | Ga0495586_0187961 | 3300046535 | Bacteria | 1170 |
| 466 | Ga0495587_0030350 | 3300046536 | Bacteria | 3279 |
| 467 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 468 | Ga0495609_0000883 | 3300046538 | Bacteria | 21964 |
| 469 | Ga0495609_0004066 | 3300046538 | Bacteria | 8149 |
| 470 | Ga0495609_0005357 | 3300046538 | Bacteria | 6768 |
| 471 | Ga0495609_0005788 | 3300046538 | Bacteria | 6422 |
| 472 | Ga0495609_0018521 | 3300046538 | Bacteria | 3226 |
| 473 | Ga0495609_0032516 | 3300046538 | Bacteria | 2369 |
| 474 | Ga0495597_0000070 | 3300046542 | Bacteria | 89649 |
| 475 | Ga0495597_0000189 | 3300046542 | Bacteria | 55865 |
| 476 | Ga0495597_0002006 | 3300046542 | Bacteria | 13648 |
| 477 | Ga0495597_0002593 | 3300046542 | Bacteria | 11296 |
| 478 | Ga0495597_0003217 | 3300046542 | Bacteria | 9714 |
| 479 | Ga0495597_0004354 | 3300046542 | Bacteria | 7805 |
| 480 | Ga0495645_0000452 | 3300046543 | Bacteria | 28201 |
| 481 | Ga0495622_0000407 | 3300046557 | Bacteria | 28827 |
| 482 | Ga0495622_0039060 | 3300046557 | Bacteria | 2210 |
| 483 | Ga0495633_0000075 | 3300046558 | Bacteria | 130139 |
| 484 | Ga0495633_0001372 | 3300046558 | Bacteria | 19021 |
| 485 | Ga0495633_0001858 | 3300046558 | Bacteria | 15505 |
| 486 | Ga0495633_0005278 | 3300046558 | Bacteria | 7951 |
| 487 | Ga0495656_0000306 | 3300046615 | Bacteria | 16984 |
| 488 | Ga0495656_0007265 | 3300046615 | Bacteria | 3909 |
| 489 | Ga0495656_0010496 | 3300046615 | Bacteria | 3370 |
| 490 | Ga0495656_0098344 | 3300046615 | Bacteria | 1349 |
| 491 | Ga0495668_0000036 | 3300046616 | Bacteria | 235057 |
| 492 | Ga0495668_0000280 | 3300046616 | Bacteria | 70339 |
| 493 | Ga0495668_0000304 | 3300046616 | Bacteria | 67905 |
| 494 | Ga0495668_0004592 | 3300046616 | Bacteria | 9712 |
| 495 | Ga0495668_0005909 | 3300046616 | Bacteria | 8143 |
| 496 | Ga0495668_0010138 | 3300046616 | Bacteria | 5730 |
| 497 | Ga0495668_0014693 | 3300046616 | Bacteria | 4585 |
| 498 | Ga0495668_0070733 | 3300046616 | Bacteria | 1918 |
| 499 | Ga0495668_0173282 | 3300046616 | Bacteria | 1182 |
| 500 | Ga0495611_0000191 | 3300046648 | Bacteria | 43883 |
| 501 | Ga0495611_0003995 | 3300046648 | Bacteria | 6420 |
| 502 | Ga0495611_0016700 | 3300046648 | Bacteria | 3137 |
| 503 | Ga0495611_0038144 | 3300046648 | Bacteria | 2136 |
| 504 | Ga0495625_0008242 | 3300046660 | Bacteria | 8913 |
| 505 | Ga0495625_0009663 | 3300046660 | Bacteria | 8040 |
| 506 | Ga0495625_0010510 | 3300046660 | Bacteria | 7648 |
| 507 | Ga0495625_0013764 | 3300046660 | Bacteria | 6485 |
| 508 | Ga0495625_0022425 | 3300046660 | Bacteria | 4842 |
| 509 | Ga0495625_0132954 | 3300046660 | Bacteria | 1684 |
| 510 | Ga0495661_0000040 | 3300046665 | Bacteria | 151437 |
| 511 | Ga0495661_0000063 | 3300046665 | Bacteria | 129706 |
| 512 | Ga0495661_0000728 | 3300046665 | Bacteria | 32238 |
| 513 | Ga0495661_0001045 | 3300046665 | Bacteria | 24545 |
| 514 | Ga0495661_0001664 | 3300046665 | Bacteria | 18107 |
| 515 | Ga0495661_0002785 | 3300046665 | Bacteria | 13245 |
| 516 | Ga0495661_0009113 | 3300046665 | Bacteria | 6824 |
| 517 | Ga0495661_0017937 | 3300046665 | Bacteria | 4665 |
| 518 | Ga0495661_0027647 | 3300046665 | Bacteria | 3638 |
| 519 | Ga0495661_0029380 | 3300046665 | Bacteria | 3509 |
| 520 | Ga0495661_0040087 | 3300046665 | Bacteria | 2907 |
| 521 | Ga0495661_0049022 | 3300046665 | Bacteria | 2563 |
| 522 | Ga0495661_0124766 | 3300046665 | Bacteria | 1418 |
| 523 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 524 | Ga0495588_0058293 | 3300046674 | Bacteria | 1996 |
| 525 | Ga0495588_0164185 | 3300046674 | Bacteria | 1174 |
| 526 | Ga0495599_0013941 | 3300046678 | Bacteria | 4975 |
| 527 | Ga0495646_0072232 | 3300046680 | Bacteria | 2029 |
| 528 | Ga0495669_0000013 | 3300046684 | Bacteria | 151423 |
| 529 | Ga0495669_0000818 | 3300046684 | Bacteria | 13241 |
| 530 | Ga0495669_0000834 | 3300046684 | Bacteria | 13127 |
| 531 | Ga0495669_0018538 | 3300046684 | Bacteria | 2993 |
| 532 | Ga0495669_0056936 | 3300046684 | Bacteria | 1763 |
| 533 | Ga0495613_0014673 | 3300046689 | Bacteria | 5813 |
| 534 | Ga0495624_0001726 | 3300046690 | Bacteria | 16713 |
| 535 | Ga0495670_0000052 | 3300046691 | Bacteria | 63490 |
| 536 | Ga0495670_0060542 | 3300046691 | Bacteria | 1902 |
| 537 | Ga0495671_0000024 | 3300046692 | Bacteria | 246812 |
| 538 | Ga0495671_0000313 | 3300046692 | Bacteria | 41127 |
| 539 | Ga0495671_0009433 | 3300046692 | Bacteria | 5449 |
| 540 | Ga0495671_0026510 | 3300046692 | Bacteria | 3004 |
| 541 | Ga0495649_0000085 | 3300046694 | Bacteria | 80698 |
| 542 | Ga0495649_0000880 | 3300046694 | Bacteria | 24063 |
| 543 | Ga0495649_0084399 | 3300046694 | Bacteria | 1696 |
| 544 | Ga0495589_0000015 | 3300046794 | Bacteria | 224112 |
| 545 | Ga0495589_0000116 | 3300046794 | Bacteria | 75640 |
| 546 | Ga0495589_0000227 | 3300046794 | Bacteria | 47488 |
| 547 | Ga0495589_0005507 | 3300046794 | Bacteria | 6676 |
| 548 | Ga0495589_0019142 | 3300046794 | Bacteria | 3512 |
| 549 | Ga0495589_0045557 | 3300046794 | Bacteria | 2179 |
| 550 | Ga0495589_0103993 | 3300046794 | Bacteria | 1372 |
| 551 | Ga0495600_0046096 | 3300046809 | Bacteria | 2845 |
| 552 | Ga0495600_0063140 | 3300046809 | Bacteria | 2420 |
| 553 | Ga0495660_0000145 | 3300046810 | Bacteria | 76912 |
| 554 | Ga0495660_0004796 | 3300046810 | Bacteria | 8159 |
| 555 | Ga0495660_0008371 | 3300046810 | Bacteria | 6048 |
| 556 | Ga0495660_0011186 | 3300046810 | Bacteria | 5209 |
| 557 | Ga0495660_0011577 | 3300046810 | Bacteria | 5116 |
| 558 | Ga0495660_0091016 | 3300046810 | Bacteria | 1585 |
| 559 | Ga0495604_0001690 | 3300047317 | Bacteria | 18145 |
| 560 | Ga0495604_0021007 | 3300047317 | Bacteria | 5209 |
| 561 | Ga0495636_0001565 | 3300047318 | Bacteria | 8705 |
| 562 | Ga0495636_0016350 | 3300047318 | Bacteria | 2963 |
| 563 | Ga0495672_0000065 | 3300047320 | Bacteria | 193941 |
| 564 | Ga0495672_0002150 | 3300047320 | Bacteria | 18425 |
| 565 | Ga0495672_0015756 | 3300047320 | Bacteria | 5119 |
| 566 | Ga0495672_0036059 | 3300047320 | Bacteria | 3040 |
| 567 | Ga0495672_0037417 | 3300047320 | Bacteria | 2969 |
| 568 | Ga0495672_0040205 | 3300047320 | Bacteria | 2838 |
| 569 | Ga0495672_0040711 | 3300047320 | Bacteria | 2815 |
| 570 | Ga0495672_0043617 | 3300047320 | Bacteria | 2696 |
| 571 | Ga0495672_0117484 | 3300047320 | Bacteria | 1419 |
| 572 | Ga0495676_0000029 | 3300047321 | Bacteria | 140281 |
| 573 | Ga0495680_0043744 | 3300047322 | Bacteria | 3544 |
| 574 | Ga0495683_0000012 | 3300047323 | Bacteria | 205754 |
| 575 | Ga0495683_0005453 | 3300047323 | Bacteria | 7057 |
| 576 | Ga0495683_0005694 | 3300047323 | Bacteria | 6883 |
| 577 | Ga0495683_0006362 | 3300047323 | Bacteria | 6453 |
| 578 | Ga0495683_0020718 | 3300047323 | Bacteria | 3390 |
| 579 | Ga0495683_0071817 | 3300047323 | Bacteria | 1698 |
| 580 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 581 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 582 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 583 | Ga0495687_000073 | 3300047443 | Bacteria | 155429 |
| 584 | Ga0495687_000445 | 3300047443 | Bacteria | 51086 |
| 585 | Ga0495687_000635 | 3300047443 | Bacteria | 40213 |
| 586 | Ga0495687_000827 | 3300047443 | Bacteria | 33123 |
| 587 | Ga0495687_003439 | 3300047443 | Bacteria | 11479 |
| 588 | Ga0495675_0018177 | 3300047444 | Bacteria | 4460 |
| 589 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 590 | Ga0495677_0000847 | 3300047445 | Bacteria | 12366 |
| 591 | Ga0495677_0001330 | 3300047445 | Bacteria | 9898 |
| 592 | Ga0495677_0003291 | 3300047445 | Bacteria | 6298 |
| 593 | Ga0495677_0006184 | 3300047445 | Bacteria | 4523 |
| 594 | Ga0495677_0008510 | 3300047445 | Bacteria | 3808 |
| 595 | Ga0495677_0054801 | 3300047445 | Bacteria | 1471 |
| 596 | Ga0495679_004825 | 3300047446 | Bacteria | 6095 |
| 597 | Ga0495679_016919 | 3300047446 | Bacteria | 2623 |
| 598 | Ga0495685_002660 | 3300047447 | Bacteria | 5631 |
| 599 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 600 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 601 | Ga0495673_0000120 | 3300047469 | Bacteria | 144972 |
| 602 | Ga0495673_0013175 | 3300047469 | Bacteria | 4353 |
| 603 | Ga0495673_0019688 | 3300047469 | Bacteria | 3378 |
| 604 | Ga0495681_0000005 | 3300047470 | Bacteria | 225279 |
| 605 | Ga0495681_0001808 | 3300047470 | Bacteria | 15724 |
| 606 | Ga0495681_0024100 | 3300047470 | Bacteria | 3216 |
| 607 | Ga0495681_0050794 | 3300047470 | Bacteria | 1952 |
| 608 | Ga0495686_0000021 | 3300047472 | Bacteria | 426560 |
| 609 | Ga0495686_0000051 | 3300047472 | Bacteria | 263489 |
| 610 | Ga0495686_0022171 | 3300047472 | Bacteria | 4204 |
| 611 | Ga0495593_0002192 | 3300047673 | Bacteria | 11687 |
| 612 | Ga0495593_0019591 | 3300047673 | Bacteria | 3793 |
| 613 | Ga0495602_0002837 | 3300048088 | Bacteria | 17751 |
| 614 | Ga0495614_0059770 | 3300048089 | Bacteria | 1637 |
| 615 | Ga0495626_0000020 | 3300048091 | Bacteria | 222537 |
| 616 | Ga0495626_0000128 | 3300048091 | Bacteria | 96772 |
| 617 | Ga0495626_0000171 | 3300048091 | Bacteria | 80200 |
| 618 | Ga0495626_0002911 | 3300048091 | Bacteria | 11403 |
| 619 | Ga0495626_0003919 | 3300048091 | Bacteria | 9322 |
| 620 | Ga0495626_0006950 | 3300048091 | Bacteria | 6370 |
| 621 | Ga0495626_0012053 | 3300048091 | Bacteria | 4548 |
| 622 | Ga0495626_0027661 | 3300048091 | Bacteria | 2755 |
| 623 | Ga0495626_0032073 | 3300048091 | Bacteria | 2525 |
| 624 | Ga0495626_0053463 | 3300048091 | Bacteria | 1858 |
| 625 | Ga0495626_0090632 | 3300048091 | Bacteria | 1344 |
| 626 | Ga0496100_0072005 | 3300048903 | Bacteria | 2309 |
| 627 | Ga0496101_0003169 | 3300048904 | Bacteria | 10187 |
| 628 | Ga0496101_0061325 | 3300048904 | Bacteria | 2731 |
| 629 | Ga0496101_0109160 | 3300048904 | Bacteria | 2081 |
| 630 | Ga0496101_0174772 | 3300048904 | Bacteria | 1651 |
| 631 | Ga0496102_0000033 | 3300048905 | Bacteria | 213952 |
| 632 | Ga0496102_0111792 | 3300048905 | Bacteria | 2547 |
| 633 | Ga0496102_0136988 | 3300048905 | Bacteria | 2294 |
| 634 | Ga0496102_0262564 | 3300048905 | Bacteria | 1628 |
| 635 | Ga0496103_0001739 | 3300048906 | Bacteria | 14221 |
| 636 | Ga0496103_0004666 | 3300048906 | Bacteria | 8299 |
| 637 | Ga0496103_0111529 | 3300048906 | Bacteria | 1738 |
| 638 | Ga0496104_0015936 | 3300048907 | Bacteria | 6821 |
| 639 | Ga0496104_0158567 | 3300048907 | Bacteria | 2171 |
| 640 | Ga0496105_0000920 | 3300048908 | Bacteria | 20080 |
| 641 | Ga0496105_0031194 | 3300048908 | Bacteria | 4369 |
| 642 | Ga0496105_0119419 | 3300048908 | Bacteria | 2174 |
| 643 | Ga0496106_0000032 | 3300048909 | Bacteria | 134707 |
| 644 | Ga0496106_0036283 | 3300048909 | Bacteria | 3688 |
| 645 | Ga0496109_0008922 | 3300048912 | Bacteria | 8542 |
| 646 | Ga0496110_0000007 | 3300048913 | Bacteria | 114271 |
| 647 | Ga0496110_0008599 | 3300048913 | Bacteria | 8221 |
| 648 | Ga0496110_0021223 | 3300048913 | Bacteria | 5494 |
| 649 | Ga0496110_0039713 | 3300048913 | Bacteria | 4098 |
| 650 | Ga0496111_0001836 | 3300048914 | Bacteria | 12505 |
| 651 | Ga0496111_0042384 | 3300048914 | Bacteria | 3268 |
| 652 | Ga0496111_0092460 | 3300048914 | Bacteria | 2217 |
| 653 | Ga0496112_0016434 | 3300048915 | Bacteria | 6933 |
| 654 | Ga0496113_0007095 | 3300048916 | Bacteria | 7173 |
| 655 | Ga0496114_0003502 | 3300048917 | Bacteria | 12046 |
| 656 | Ga0496116_0003171 | 3300048919 | Bacteria | 16474 |
| 657 | Ga0496116_0030930 | 3300048919 | Bacteria | 3840 |
| 658 | Ga0496116_0053964 | 3300048919 | Bacteria | 2651 |
| 659 | Ga0496116_0056363 | 3300048919 | Bacteria | 2576 |
| 660 | Ga0496116_0147132 | 3300048919 | Bacteria | 1315 |
| 661 | Ga0496116_0147324 | 3300048919 | Bacteria | 1314 |
| 662 | Ga0496116_0153613 | 3300048919 | Bacteria | 1274 |
| 663 | Ga0496117_0000392 | 3300048920 | Bacteria | 74904 |
| 664 | Ga0496117_0051388 | 3300048920 | Bacteria | 2914 |
| 665 | Ga0496117_0062360 | 3300048920 | Bacteria | 2555 |
| 666 | Ga0496117_0143230 | 3300048920 | Bacteria | 1428 |
| 667 | Ga0496118_0003657 | 3300048921 | Bacteria | 19098 |
| 668 | Ga0496118_0007943 | 3300048921 | Bacteria | 11101 |
| 669 | Ga0496118_0054990 | 3300048921 | Bacteria | 3009 |
| 670 | Ga0496118_0068631 | 3300048921 | Bacteria | 2573 |
| 671 | Ga0496121_0000672 | 3300048924 | Bacteria | 63750 |
| 672 | Ga0496121_0001111 | 3300048924 | Bacteria | 47443 |
| 673 | Ga0496121_0011238 | 3300048924 | Bacteria | 9977 |
| 674 | Ga0496121_0076246 | 3300048924 | Bacteria | 2674 |
| 675 | Ga0496121_0076744 | 3300048924 | Bacteria | 2663 |
| 676 | Ga0496121_0086377 | 3300048924 | Bacteria | 2465 |
| 677 | Ga0496122_0000146 | 3300048925 | Bacteria | 165614 |
| 678 | Ga0496122_0000279 | 3300048925 | Bacteria | 114185 |
| 679 | Ga0496122_0000878 | 3300048925 | Bacteria | 56301 |
| 680 | Ga0496122_0001985 | 3300048925 | Bacteria | 30535 |
| 681 | Ga0496122_0018858 | 3300048925 | Bacteria | 6341 |
| 682 | Ga0496122_0044505 | 3300048925 | Bacteria | 3462 |
| 683 | Ga0496122_0054311 | 3300048925 | Bacteria | 3010 |
| 684 | Ga0496122_0093168 | 3300048925 | Bacteria | 2044 |
| 685 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 686 | Ga0496123_0000146 | 3300048926 | Bacteria | 143990 |
| 687 | Ga0496123_0000894 | 3300048926 | Bacteria | 47171 |
| 688 | Ga0496123_0003057 | 3300048926 | Bacteria | 19234 |
| 689 | Ga0496123_0010920 | 3300048926 | Bacteria | 7948 |
| 690 | Ga0496123_0020872 | 3300048926 | Bacteria | 5108 |
| 691 | Ga0496123_0028479 | 3300048926 | Bacteria | 4134 |
| 692 | Ga0496124_0000435 | 3300048927 | Bacteria | 74150 |
| 693 | Ga0496124_0039254 | 3300048927 | Bacteria | 4105 |
| 694 | Ga0496124_0063624 | 3300048927 | Bacteria | 3081 |
| 695 | Ga0496124_0100630 | 3300048927 | Bacteria | 2342 |
| 696 | Ga0496124_0105241 | 3300048927 | Bacteria | 2280 |
| 697 | Ga0496125_0000168 | 3300048928 | Bacteria | 146364 |
| 698 | Ga0496125_0000938 | 3300048928 | Bacteria | 45852 |
| 699 | Ga0496125_0002050 | 3300048928 | Bacteria | 27214 |
| 700 | Ga0496125_0008706 | 3300048928 | Bacteria | 10560 |
| 701 | Ga0496125_0012148 | 3300048928 | Bacteria | 8567 |
| 702 | Ga0496125_0027872 | 3300048928 | Bacteria | 5111 |
| 703 | Ga0496125_0119617 | 3300048928 | Bacteria | 1883 |
| 704 | Ga0496126_0000421 | 3300048929 | Bacteria | 85210 |
| 705 | Ga0496126_0000426 | 3300048929 | Bacteria | 84838 |
| 706 | Ga0496126_0000915 | 3300048929 | Bacteria | 51060 |
| 707 | Ga0496126_0011309 | 3300048929 | Bacteria | 9257 |
| 708 | Ga0496126_0019373 | 3300048929 | Bacteria | 6702 |
| 709 | Ga0496126_0023069 | 3300048929 | Bacteria | 6033 |
| 710 | Ga0496126_0028380 | 3300048929 | Bacteria | 5335 |
| 711 | Ga0496126_0135288 | 3300048929 | Bacteria | 2126 |
| 712 | Ga0496126_0194142 | 3300048929 | Bacteria | 1718 |
| 713 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 714 | Ga0495678_000015 | 3300049459 | Bacteria | 309544 |
| 715 | Ga0495678_000022 | 3300049459 | Bacteria | 237031 |
| 716 | Ga0495678_000229 | 3300049459 | Bacteria | 64743 |
| 717 | Ga0495678_002011 | 3300049459 | Bacteria | 14589 |
| 718 | Ga0495678_004103 | 3300049459 | Bacteria | 8631 |
| 719 | Ga0495678_005612 | 3300049459 | Bacteria | 6865 |
| 720 | Ga0495678_009379 | 3300049459 | Bacteria | 4847 |
| 721 | Ga0501034_0000129 | 3300049571 | Bacteria | 139927 |
| 722 | Ga0501222_008685 | 3300049662 | Bacteria | 1347 |
| 723 | Ga0501044_0013906 | 3300049823 | Bacteria | 8696 |
| 724 | nmdc:mga00v17_11321_c1 | 3300050491 | Bacteria | 4903 |
| 725 | nmdc:mga00v17_22831_c1 | 3300050491 | Bacteria | 3615 |
| 726 | nmdc:mga07m45_13078_c1 | 3300050496 | Bacteria | 4394 |
| 727 | Ga0500610_0020896 | 3300053079 | Bacteria | 3203 |
| 728 | Ga0500643_016204 | 3300053087 | Bacteria | 2531 |
| 729 | Ga0500651_0000305 | 3300053093 | Bacteria | 28418 |
| 730 | Ga0500571_004833 | 3300053110 | Bacteria | 7132 |
| 731 | Ga0500592_003231 | 3300053116 | Bacteria | 2600 |
| 732 | Ga0500593_027001 | 3300053117 | Bacteria | 2560 |
| 733 | Ga0500594_0002897 | 3300053118 | Bacteria | 3742 |
| 734 | Ga0500607_000744 | 3300053121 | Bacteria | 31300 |
| 735 | Ga0500608_027954 | 3300053122 | Bacteria | 2660 |
| 736 | Ga0500618_000601 | 3300053125 | Bacteria | 22092 |
| 737 | Ga0500618_001391 | 3300053125 | Bacteria | 10903 |
| 738 | Ga0500618_003518 | 3300053125 | Bacteria | 5335 |
| 739 | Ga0500618_005834 | 3300053125 | Bacteria | 3694 |
| 740 | Ga0500559_0004612 | 3300053136 | Bacteria | 6510 |
| 741 | Ga0500568_0000934 | 3300053139 | Bacteria | 20169 |
| 742 | Ga0500586_000583 | 3300053145 | Bacteria | 7424 |
| 743 | Ga0500616_0028639 | 3300053153 | Bacteria | 3068 |
| 744 | Ga0500627_0000537 | 3300053158 | Bacteria | 10255 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0000005 | Ga0495605_0000005_251004_251999 | 309 |
| 2 | 3300046507 | Ga0495606_0004822 | Ga0495606_0004822_5158_6171 | 313 |
| 3 | iso_pu_bacteria | 2818991467 | 2819717590 | 315 |
| 4 | 3300003322 | rootL2_10056250 | rootL2_100562504 | 316 |
| 5 | 3300025233 | Ga0209437_109925 | Ga0209437_1099252 | 316 |
| 6 | 3300025272 | Ga0209455_1000063 | Ga0209455_1000063105 | 316 |
| 7 | 3300053125 | Ga0500618_000601 | Ga0500618_000601_5732_6730 | 317 |
| 8 | 3300003187 | JGI25151J46595_10000356 | JGI25151J46595_1000035625 | 318 |
| 9 | 3300025294 | Ga0209025_1000198 | Ga0209025_100019882 | 318 |
| 10 | 3300046691 | Ga0495670_0060542 | Ga0495670_0060542_225_1232 | 318 |
| 11 | 3300025292 | Ga0209676_1006414 | Ga0209676_10064144 | 319 |
| 12 | 3300025298 | Ga0209050_1013309 | Ga0209050_10133093 | 319 |
| 13 | 3300046512 | Ga0495610_0006834 | Ga0495610_0006834_3079_4086 | 319 |
| 14 | 3300048919 | Ga0496116_0030930 | Ga0496116_0030930_1489_2532 | 319 |
| 15 | 3300048925 | Ga0496122_0000878 | Ga0496122_0000878_43714_44814 | 319 |
| 16 | 3300048926 | Ga0496123_0003057 | Ga0496123_0003057_6768_7868 | 319 |
| 17 | 3300048926 | Ga0496123_0028479 | Ga0496123_0028479_1986_2948 | 319 |
| 18 | 3300048928 | Ga0496125_0012148 | Ga0496125_0012148_1220_2338 | 319 |
| 19 | 3300048929 | Ga0496126_0135288 | Ga0496126_0135288_784_1884 | 319 |
| 20 | 3300047320 | Ga0495672_0040205 | Ga0495672_0040205_529_1548 | 321 |
| 21 | 3300048927 | Ga0496124_0000435 | Ga0496124_0000435_38036_39025 | 321 |
| 22 | 3300046522 | Ga0495643_0021681 | Ga0495643_0021681_1201_2217 | 322 |
| 23 | 3300049823 | Ga0501044_0013906 | Ga0501044_0013906_3720_4763 | 322 |
| 24 | 3300053125 | Ga0500618_003518 | Ga0500618_003518_2709_3686 | 322 |
| 25 | 3300009011 | Ga0105251_10000335 | Ga0105251_1000033541 | 323 |
| 26 | 3300025302 | Ga0207426_1005743 | Ga0207426_10057431 | 323 |
| 27 | 3300025735 | Ga0207713_1003535 | Ga0207713_10035358 | 323 |
| 28 | 3300025913 | Ga0207695_10083955 | Ga0207695_100839552 | 323 |
| 29 | 3300026121 | Ga0207683_10431174 | Ga0207683_104311741 | 323 |
| 30 | 3300037471 | Ga0395905_0006264 | Ga0395905_0006264_7641_8651 | 323 |
| 31 | 3300046452 | Ga0495617_002891 | Ga0495617_002891_399_1406 | 323 |
| 32 | 3300046507 | Ga0495606_0010046 | Ga0495606_0010046_3237_4244 | 323 |
| 33 | 3300046512 | Ga0495610_0010610 | Ga0495610_0010610_2506_3513 | 323 |
| 34 | 3300046542 | Ga0495597_0002593 | Ga0495597_0002593_2203_3210 | 323 |
| 35 | iso_pu_bacteria | 2738541297 | 2738825804 | 323 |
| 36 | iso_pu_bacteria | 2738541357 | 2739149601 | 323 |
| 37 | iso_pu_bacteria | 2738543003 | 2739191520 | 323 |
| 38 | iso_pu_bacteria | 2738543026 | 2739317997 | 323 |
| 39 | iso_pu_bacteria | 2738543029 | 2739336238 | 323 |
| 40 | iso_pu_bacteria | 2857564685 | 2857566189 | 323 |
| 41 | iso_pu_bacteria | 2904434214 | 2904437886 | 324 |
| 42 | 3300048927 | Ga0496124_0105241 | Ga0496124_0105241_452_1474 | 325 |
| 43 | iso_pu_bacteria | 2857542790 | 2857543622 | 325 |
| 44 | 3300009545 | Ga0105237_10139121 | Ga0105237_101391212 | 326 |
| 45 | 3300009176 | Ga0105242_10017049 | Ga0105242_100170493 | 327 |
| 46 | 3300025934 | Ga0207686_10000746 | Ga0207686_1000074620 | 327 |
| 47 | 3300046452 | Ga0495617_000061 | Ga0495617_000061_37861_38856 | 327 |
| 48 | 3300046471 | Ga0495650_0002073 | Ga0495650_0002073_4973_5968 | 327 |
| 49 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_229596_230591 | 327 |
| 50 | 3300046524 | Ga0495648_0012248 | Ga0495648_0012248_1801_2796 | 327 |
| 51 | 3300046530 | Ga0495654_0009589 | Ga0495654_0009589_619_1614 | 327 |
| 52 | 3300046616 | Ga0495668_0005909 | Ga0495668_0005909_3690_4685 | 327 |
| 53 | 3300046665 | Ga0495661_0000040 | Ga0495661_0000040_137576_138628 | 327 |
| 54 | 3300046692 | Ga0495671_0000024 | Ga0495671_0000024_101271_102266 | 327 |
| 55 | 3300047446 | Ga0495679_016919 | Ga0495679_016919_709_1704 | 327 |
| 56 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_212033_213028 | 327 |
| 57 | 3300047469 | Ga0495673_0000120 | Ga0495673_0000120_37713_38708 | 327 |
| 58 | 3300048919 | Ga0496116_0147324 | Ga0496116_0147324_131_1186 | 327 |
| 59 | iso_pu_bacteria | 2513237150 | 2513954888 | 327 |
| 60 | iso_pu_bacteria | 2513237165 | 2514042842 | 327 |
| 61 | iso_pu_bacteria | 2857553236 | 2857554940 | 327 |
| 62 | iso_pu_bacteria | 2857558681 | 2857562369 | 327 |
| 63 | iso_pu_bacteria | 2904424332 | 2904429864 | 327 |
| 64 | iso_pu_bacteria | 644736347 | 644752002 | 327 |
| 65 | 3300046463 | Ga0495653_0000018 | Ga0495653_0000018_154308_155306 | 328 |
| 66 | 3300046471 | Ga0495650_0002855 | Ga0495650_0002855_4992_5990 | 328 |
| 67 | 3300046491 | Ga0495584_0053300 | Ga0495584_0053300_64_1071 | 328 |
| 68 | 3300046492 | Ga0495585_0063822 | Ga0495585_0063822_862_1869 | 328 |
| 69 | 3300046500 | Ga0495596_0018767 | Ga0495596_0018767_1098_2105 | 328 |
| 70 | 3300046501 | Ga0495607_0016406 | Ga0495607_0016406_1562_2569 | 328 |
| 71 | 3300046506 | Ga0495583_0001117 | Ga0495583_0001117_27044_28051 | 328 |
| 72 | 3300046513 | Ga0495616_0009081 | Ga0495616_0009081_4651_5658 | 328 |
| 73 | 3300046518 | Ga0495631_0026006 | Ga0495631_0026006_1509_2516 | 328 |
| 74 | 3300046519 | Ga0495632_0001594 | Ga0495632_0001594_1355_2362 | 328 |
| 75 | 3300046520 | Ga0495637_0000456 | Ga0495637_0000456_2700_3698 | 328 |
| 76 | 3300046523 | Ga0495644_0002155 | Ga0495644_0002155_3606_4613 | 328 |
| 77 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_198287_199285 | 328 |
| 78 | 3300046648 | Ga0495611_0003995 | Ga0495611_0003995_3899_4906 | 328 |
| 79 | 3300046660 | Ga0495625_0008242 | Ga0495625_0008242_4749_5747 | 328 |
| 80 | 3300046810 | Ga0495660_0011186 | Ga0495660_0011186_1734_2741 | 328 |
| 81 | 3300047323 | Ga0495683_0005453 | Ga0495683_0005453_5545_6552 | 328 |
| 82 | 3300047445 | Ga0495677_0003291 | Ga0495677_0003291_1227_2234 | 328 |
| 83 | 3300047470 | Ga0495681_0024100 | Ga0495681_0024100_862_1869 | 328 |
| 84 | 3300048091 | Ga0495626_0090632 | Ga0495626_0090632_262_1269 | 328 |
| 85 | 3300048924 | Ga0496121_0076744 | Ga0496121_0076744_447_1445 | 328 |
| 86 | 3300048925 | Ga0496122_0054311 | Ga0496122_0054311_762_1760 | 328 |
| 87 | 3300048926 | Ga0496123_0010920 | Ga0496123_0010920_3254_4252 | 328 |
| 88 | 3300049459 | Ga0495678_002011 | Ga0495678_002011_5795_6802 | 328 |
| 89 | iso_pu_bacteria | 8047673197 | 8047674974 | 328 |
| 90 | 3300006051 | Ga0075364_10024414 | Ga0075364_100244144 | 329 |
| 91 | 3300013102 | Ga0157371_10254747 | Ga0157371_102547472 | 329 |
| 92 | 3300046471 | Ga0495650_0011102 | Ga0495650_0011102_1242_2255 | 329 |
| 93 | 3300046501 | Ga0495607_0001836 | Ga0495607_0001836_243_1256 | 329 |
| 94 | 3300046519 | Ga0495632_0002005 | Ga0495632_0002005_8829_9842 | 329 |
| 95 | 3300046538 | Ga0495609_0000883 | Ga0495609_0000883_2430_3443 | 329 |
| 96 | 3300046542 | Ga0495597_0000070 | Ga0495597_0000070_33522_34535 | 329 |
| 97 | 3300046665 | Ga0495661_0000728 | Ga0495661_0000728_9619_10632 | 329 |
| 98 | 3300047470 | Ga0495681_0000005 | Ga0495681_0000005_114823_115836 | 329 |
| 99 | 3300048091 | Ga0495626_0003919 | Ga0495626_0003919_7066_8079 | 329 |
| 100 | 3300048912 | Ga0496109_0008922 | Ga0496109_0008922_5925_7001 | 329 |
| 101 | 3300048916 | Ga0496113_0007095 | Ga0496113_0007095_4737_5813 | 329 |
| 102 | 3300048924 | Ga0496121_0001111 | Ga0496121_0001111_44545_45558 | 329 |
| 103 | 3300048925 | Ga0496122_0000279 | Ga0496122_0000279_16183_17259 | 329 |
| 104 | 3300048925 | Ga0496122_0093168 | Ga0496122_0093168_571_1584 | 329 |
| 105 | 3300048926 | Ga0496123_0000146 | Ga0496123_0000146_126762_127838 | 329 |
| 106 | 3300048926 | Ga0496123_0020872 | Ga0496123_0020872_2132_3145 | 329 |
| 107 | 3300048927 | Ga0496124_0100630 | Ga0496124_0100630_344_1357 | 329 |
| 108 | 3300048928 | Ga0496125_0000168 | Ga0496125_0000168_44747_45760 | 329 |
| 109 | 3300048928 | Ga0496125_0000938 | Ga0496125_0000938_8552_9628 | 329 |
| 110 | 3300048929 | Ga0496126_0028380 | Ga0496126_0028380_1840_2853 | 329 |
| 111 | 3300050491 | nmdc:mga00v17_11321_c1 | nmdc:mga00v17_11321_c1_907_1965 | 329 |
| 112 | 3300002067 | JGI24735J21928_10001861 | JGI24735J21928_100018616 | 330 |
| 113 | 3300003187 | JGI25151J46595_10000065 | JGI25151J46595_1000006542 | 330 |
| 114 | 3300003187 | JGI25151J46595_10002865 | JGI25151J46595_100028652 | 330 |
| 115 | 3300003187 | JGI25151J46595_10030097 | JGI25151J46595_100300972 | 330 |
| 116 | 3300003322 | rootL2_10097683 | rootL2_100976832 | 330 |
| 117 | 3300003771 | Ga0055526_1002292 | Ga0055526_10022923 | 330 |
| 118 | 3300003771 | Ga0055526_1005476 | Ga0055526_10054765 | 330 |
| 119 | 3300003773 | Ga0055537_1000409 | Ga0055537_10004096 | 330 |
| 120 | 3300003775 | Ga0055524_1001775 | Ga0055524_10017751 | 330 |
| 121 | 3300003781 | Ga0055536_1000026 | Ga0055536_100002653 | 330 |
| 122 | 3300003784 | Ga0055534_1000189 | Ga0055534_100018937 | 330 |
| 123 | 3300003784 | Ga0055534_1001063 | Ga0055534_10010635 | 330 |
| 124 | 3300005288 | Ga0065714_10075233 | Ga0065714_100752333 | 330 |
| 125 | 3300005293 | Ga0065715_10000585 | Ga0065715_1000058516 | 330 |
| 126 | 3300005337 | Ga0070682_100231570 | Ga0070682_1002315701 | 330 |
| 127 | 3300005339 | Ga0070660_100035788 | Ga0070660_1000357882 | 330 |
| 128 | 3300005366 | Ga0070659_100014815 | Ga0070659_1000148155 | 330 |
| 129 | 3300005457 | Ga0070662_100108379 | Ga0070662_1001083791 | 330 |
| 130 | 3300005457 | Ga0070662_100130378 | Ga0070662_1001303782 | 330 |
| 131 | 3300005563 | Ga0068855_100036130 | Ga0068855_1000361306 | 330 |
| 132 | 3300005616 | Ga0068852_100402317 | Ga0068852_1004023172 | 330 |
| 133 | 3300009093 | Ga0105240_10558615 | Ga0105240_105586151 | 330 |
| 134 | 3300009174 | Ga0105241_10081750 | Ga0105241_100817503 | 330 |
| 135 | 3300025263 | Ga0209565_1000109 | Ga0209565_1000109107 | 330 |
| 136 | 3300025263 | Ga0209565_1004483 | Ga0209565_10044834 | 330 |
| 137 | 3300025284 | Ga0209130_1021883 | Ga0209130_10218831 | 330 |
| 138 | 3300025291 | Ga0209675_1000026 | Ga0209675_1000026148 | 330 |
| 139 | 3300025291 | Ga0209675_1000118 | Ga0209675_10001186 | 330 |
| 140 | 3300025291 | Ga0209675_1003453 | Ga0209675_10034533 | 330 |
| 141 | 3300025292 | Ga0209676_1000059 | Ga0209676_1000059157 | 330 |
| 142 | 3300025294 | Ga0209025_1000066 | Ga0209025_1000066172 | 330 |
| 143 | 3300025294 | Ga0209025_1000159 | Ga0209025_100015951 | 330 |
| 144 | 3300025294 | Ga0209025_1002020 | Ga0209025_10020209 | 330 |
| 145 | 3300025295 | Ga0209564_1000084 | Ga0209564_100008411 | 330 |
| 146 | 3300025295 | Ga0209564_1000161 | Ga0209564_1000161141 | 330 |
| 147 | 3300025295 | Ga0209564_1001556 | Ga0209564_100155615 | 330 |
| 148 | 3300025297 | Ga0209758_1008905 | Ga0209758_10089054 | 330 |
| 149 | 3300025299 | Ga0209256_1000602 | Ga0209256_100060238 | 330 |
| 150 | 3300025299 | Ga0209256_1001890 | Ga0209256_100189013 | 330 |
| 151 | 3300025303 | Ga0209051_1016101 | Ga0209051_10161012 | 330 |
| 152 | 3300025303 | Ga0209051_1018820 | Ga0209051_10188201 | 330 |
| 153 | 3300025904 | Ga0207647_10052444 | Ga0207647_100524442 | 330 |
| 154 | 3300025909 | Ga0207705_10000223 | Ga0207705_1000022313 | 330 |
| 155 | 3300025911 | Ga0207654_10035446 | Ga0207654_100354463 | 330 |
| 156 | 3300025919 | Ga0207657_10026304 | Ga0207657_100263047 | 330 |
| 157 | 3300025919 | Ga0207657_10200028 | Ga0207657_102000281 | 330 |
| 158 | 3300025932 | Ga0207690_10352918 | Ga0207690_103529182 | 330 |
| 159 | 3300025933 | Ga0207706_10063890 | Ga0207706_100638902 | 330 |
| 160 | 3300025933 | Ga0207706_10093265 | Ga0207706_100932652 | 330 |
| 161 | 3300025938 | Ga0207704_10214941 | Ga0207704_102149412 | 330 |
| 162 | 3300025945 | Ga0207679_10084716 | Ga0207679_100847162 | 330 |
| 163 | 3300025949 | Ga0207667_10032546 | Ga0207667_100325466 | 330 |
| 164 | 3300037312 | Ga0395899_0001188 | Ga0395899_0001188_6035_7042 | 330 |
| 165 | 3300037312 | Ga0395899_0075159 | Ga0395899_0075159_293_1300 | 330 |
| 166 | 3300037418 | Ga0395900_0000497 | Ga0395900_0000497_28534_29541 | 330 |
| 167 | 3300037418 | Ga0395900_0027237 | Ga0395900_0027237_3953_4960 | 330 |
| 168 | 3300037418 | Ga0395900_0098421 | Ga0395900_0098421_467_1474 | 330 |
| 169 | 3300037418 | Ga0395900_0203525 | Ga0395900_0203525_143_1165 | 330 |
| 170 | 3300037418 | Ga0395900_0521185 | Ga0395900_0521185_86_1093 | 330 |
| 171 | 3300037466 | Ga0395898_0005084 | Ga0395898_0005084_7736_8743 | 330 |
| 172 | 3300037466 | Ga0395898_0116731 | Ga0395898_0116731_1428_2435 | 330 |
| 173 | 3300037466 | Ga0395898_0120157 | Ga0395898_0120157_1199_2206 | 330 |
| 174 | 3300037471 | Ga0395905_0016771 | Ga0395905_0016771_4419_5426 | 330 |
| 175 | 3300037471 | Ga0395905_0087515 | Ga0395905_0087515_1638_2645 | 330 |
| 176 | 3300038443 | Ga0395901_0016576 | Ga0395901_0016576_4793_5800 | 330 |
| 177 | 3300042134 | Ga0450898_009738 | Ga0450898_009738_337_1344 | 330 |
| 178 | 3300044656 | Ga0466969_0040944 | Ga0466969_0040944_671_1678 | 330 |
| 179 | 3300044658 | Ga0466972_0057401 | Ga0466972_0057401_540_1547 | 330 |
| 180 | 3300044683 | Ga0466965_0011432 | Ga0466965_0011432_2248_3255 | 330 |
| 181 | 3300044683 | Ga0466965_0020839 | Ga0466965_0020839_945_1952 | 330 |
| 182 | 3300044684 | Ga0466966_0160128 | Ga0466966_0160128_130_1137 | 330 |
| 183 | 3300044693 | Ga0466961_0035934 | Ga0466961_0035934_837_1856 | 330 |
| 184 | 3300044735 | Ga0466968_0020072 | Ga0466968_0020072_1442_2449 | 330 |
| 185 | 3300044765 | Ga0466970_0060533 | Ga0466970_0060533_818_1837 | 330 |
| 186 | 3300044842 | Ga0466957_0000005 | Ga0466957_0000005_43284_44291 | 330 |
| 187 | 3300045836 | Ga0466958_0017206 | Ga0466958_0017206_1989_2996 | 330 |
| 188 | 3300046457 | Ga0495590_0003678 | Ga0495590_0003678_2333_3355 | 330 |
| 189 | 3300046457 | Ga0495590_0034983 | Ga0495590_0034983_193_1200 | 330 |
| 190 | 3300046459 | Ga0495629_0037348 | Ga0495629_0037348_1410_2432 | 330 |
| 191 | 3300046463 | Ga0495653_0001244 | Ga0495653_0001244_585_1607 | 330 |
| 192 | 3300046474 | Ga0495605_0000262 | Ga0495605_0000262_7766_8773 | 330 |
| 193 | 3300046474 | Ga0495605_0007936 | Ga0495605_0007936_3104_4111 | 330 |
| 194 | 3300046474 | Ga0495605_0061276 | Ga0495605_0061276_631_1653 | 330 |
| 195 | 3300046474 | Ga0495605_0077002 | Ga0495605_0077002_351_1358 | 330 |
| 196 | 3300046491 | Ga0495584_0000075 | Ga0495584_0000075_65565_66572 | 330 |
| 197 | 3300046491 | Ga0495584_0020139 | Ga0495584_0020139_1650_2657 | 330 |
| 198 | 3300046491 | Ga0495584_0073824 | Ga0495584_0073824_441_1463 | 330 |
| 199 | 3300046500 | Ga0495596_0001540 | Ga0495596_0001540_1099_2106 | 330 |
| 200 | 3300046501 | Ga0495607_0001693 | Ga0495607_0001693_3918_4925 | 330 |
| 201 | 3300046501 | Ga0495607_0002147 | Ga0495607_0002147_1769_2776 | 330 |
| 202 | 3300046501 | Ga0495607_0002797 | Ga0495607_0002797_3976_4983 | 330 |
| 203 | 3300046506 | Ga0495583_0000134 | Ga0495583_0000134_94287_95291 | 330 |
| 204 | 3300046506 | Ga0495583_0004563 | Ga0495583_0004563_2770_3774 | 330 |
| 205 | 3300046506 | Ga0495583_0114397 | Ga0495583_0114397_57_1064 | 330 |
| 206 | 3300046507 | Ga0495606_0000755 | Ga0495606_0000755_20176_21183 | 330 |
| 207 | 3300046513 | Ga0495616_0000796 | Ga0495616_0000796_8865_9872 | 330 |
| 208 | 3300046513 | Ga0495616_0012282 | Ga0495616_0012282_3229_4236 | 330 |
| 209 | 3300046518 | Ga0495631_0033643 | Ga0495631_0033643_221_1228 | 330 |
| 210 | 3300046520 | Ga0495637_0048937 | Ga0495637_0048937_561_1568 | 330 |
| 211 | 3300046522 | Ga0495643_0000829 | Ga0495643_0000829_7766_8773 | 330 |
| 212 | 3300046522 | Ga0495643_0001229 | Ga0495643_0001229_12926_13933 | 330 |
| 213 | 3300046522 | Ga0495643_0009176 | Ga0495643_0009176_4729_5739 | 330 |
| 214 | 3300046528 | Ga0495642_0000124 | Ga0495642_0000124_13259_14266 | 330 |
| 215 | 3300046529 | Ga0495652_0019824 | Ga0495652_0019824_1346_2368 | 330 |
| 216 | 3300046530 | Ga0495654_0013403 | Ga0495654_0013403_1567_2574 | 330 |
| 217 | 3300046535 | Ga0495586_0079556 | Ga0495586_0079556_105_1127 | 330 |
| 218 | 3300046536 | Ga0495587_0030350 | Ga0495587_0030350_54_1076 | 330 |
| 219 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_1004277_1005284 | 330 |
| 220 | 3300046538 | Ga0495609_0005357 | Ga0495609_0005357_1288_2295 | 330 |
| 221 | 3300046542 | Ga0495597_0003217 | Ga0495597_0003217_1910_2932 | 330 |
| 222 | 3300046557 | Ga0495622_0039060 | Ga0495622_0039060_980_1987 | 330 |
| 223 | 3300046615 | Ga0495656_0007265 | Ga0495656_0007265_702_1709 | 330 |
| 224 | 3300046615 | Ga0495656_0010496 | Ga0495656_0010496_1371_2378 | 330 |
| 225 | 3300046616 | Ga0495668_0014693 | Ga0495668_0014693_1771_2778 | 330 |
| 226 | 3300046648 | Ga0495611_0038144 | Ga0495611_0038144_182_1189 | 330 |
| 227 | 3300046665 | Ga0495661_0000063 | Ga0495661_0000063_76220_77227 | 330 |
| 228 | 3300046665 | Ga0495661_0001664 | Ga0495661_0001664_7777_8784 | 330 |
| 229 | 3300046665 | Ga0495661_0027647 | Ga0495661_0027647_730_1752 | 330 |
| 230 | 3300046665 | Ga0495661_0049022 | Ga0495661_0049022_639_1646 | 330 |
| 231 | 3300046665 | Ga0495661_0124766 | Ga0495661_0124766_73_1080 | 330 |
| 232 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_88815_89822 | 330 |
| 233 | 3300046674 | Ga0495588_0058293 | Ga0495588_0058293_380_1387 | 330 |
| 234 | 3300046680 | Ga0495646_0072232 | Ga0495646_0072232_489_1511 | 330 |
| 235 | 3300046684 | Ga0495669_0056936 | Ga0495669_0056936_249_1271 | 330 |
| 236 | 3300046694 | Ga0495649_0000880 | Ga0495649_0000880_21575_22585 | 330 |
| 237 | 3300046794 | Ga0495589_0000015 | Ga0495589_0000015_35994_37001 | 330 |
| 238 | 3300046794 | Ga0495589_0000116 | Ga0495589_0000116_66857_67864 | 330 |
| 239 | 3300046794 | Ga0495589_0045557 | Ga0495589_0045557_577_1584 | 330 |
| 240 | 3300046809 | Ga0495600_0063140 | Ga0495600_0063140_958_1980 | 330 |
| 241 | 3300046810 | Ga0495660_0000145 | Ga0495660_0000145_7777_8784 | 330 |
| 242 | 3300046810 | Ga0495660_0004796 | Ga0495660_0004796_2815_3816 | 330 |
| 243 | 3300046810 | Ga0495660_0091016 | Ga0495660_0091016_157_1164 | 330 |
| 244 | 3300047317 | Ga0495604_0001690 | Ga0495604_0001690_16967_17989 | 330 |
| 245 | 3300047318 | Ga0495636_0001565 | Ga0495636_0001565_5467_6471 | 330 |
| 246 | 3300047318 | Ga0495636_0016350 | Ga0495636_0016350_1329_2339 | 330 |
| 247 | 3300047320 | Ga0495672_0015756 | Ga0495672_0015756_3673_4680 | 330 |
| 248 | 3300047323 | Ga0495683_0005694 | Ga0495683_0005694_5587_6609 | 330 |
| 249 | 3300047323 | Ga0495683_0006362 | Ga0495683_0006362_1391_2398 | 330 |
| 250 | 3300047323 | Ga0495683_0071817 | Ga0495683_0071817_358_1365 | 330 |
| 251 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_495517_496524 | 330 |
| 252 | 3300047443 | Ga0495687_000073 | Ga0495687_000073_66148_67155 | 330 |
| 253 | 3300047443 | Ga0495687_000635 | Ga0495687_000635_7777_8784 | 330 |
| 254 | 3300047444 | Ga0495675_0018177 | Ga0495675_0018177_2315_3337 | 330 |
| 255 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_662630_663637 | 330 |
| 256 | 3300047445 | Ga0495677_0000847 | Ga0495677_0000847_6161_7168 | 330 |
| 257 | 3300047469 | Ga0495673_0013175 | Ga0495673_0013175_744_1751 | 330 |
| 258 | 3300047472 | Ga0495686_0000051 | Ga0495686_0000051_18755_19762 | 330 |
| 259 | 3300047673 | Ga0495593_0002192 | Ga0495593_0002192_7521_8543 | 330 |
| 260 | 3300048088 | Ga0495602_0002837 | Ga0495602_0002837_9717_10739 | 330 |
| 261 | 3300048091 | Ga0495626_0000020 | Ga0495626_0000020_180082_181092 | 330 |
| 262 | 3300048091 | Ga0495626_0000128 | Ga0495626_0000128_32140_33147 | 330 |
| 263 | 3300048091 | Ga0495626_0000171 | Ga0495626_0000171_7777_8784 | 330 |
| 264 | 3300048091 | Ga0495626_0006950 | Ga0495626_0006950_3631_4638 | 330 |
| 265 | 3300048091 | Ga0495626_0012053 | Ga0495626_0012053_1242_2252 | 330 |
| 266 | 3300048904 | Ga0496101_0003169 | Ga0496101_0003169_6761_7783 | 330 |
| 267 | 3300048904 | Ga0496101_0174772 | Ga0496101_0174772_519_1541 | 330 |
| 268 | 3300048905 | Ga0496102_0111792 | Ga0496102_0111792_254_1261 | 330 |
| 269 | 3300048905 | Ga0496102_0262564 | Ga0496102_0262564_600_1607 | 330 |
| 270 | 3300048906 | Ga0496103_0004666 | Ga0496103_0004666_152_1174 | 330 |
| 271 | 3300048908 | Ga0496105_0119419 | Ga0496105_0119419_931_1953 | 330 |
| 272 | 3300048913 | Ga0496110_0008599 | Ga0496110_0008599_5741_6763 | 330 |
| 273 | 3300048914 | Ga0496111_0001836 | Ga0496111_0001836_6938_7960 | 330 |
| 274 | 3300048915 | Ga0496112_0016434 | Ga0496112_0016434_4031_5053 | 330 |
| 275 | 3300048919 | Ga0496116_0003171 | Ga0496116_0003171_8646_9668 | 330 |
| 276 | 3300048921 | Ga0496118_0068631 | Ga0496118_0068631_236_1258 | 330 |
| 277 | 3300048924 | Ga0496121_0011238 | Ga0496121_0011238_5884_6906 | 330 |
| 278 | 3300048925 | Ga0496122_0018858 | Ga0496122_0018858_4678_5685 | 330 |
| 279 | 3300048925 | Ga0496122_0044505 | Ga0496122_0044505_55_1077 | 330 |
| 280 | 3300048927 | Ga0496124_0063624 | Ga0496124_0063624_1522_2544 | 330 |
| 281 | 3300048928 | Ga0496125_0027872 | Ga0496125_0027872_732_1754 | 330 |
| 282 | 3300048928 | Ga0496125_0119617 | Ga0496125_0119617_265_1287 | 330 |
| 283 | 3300048929 | Ga0496126_0194142 | Ga0496126_0194142_390_1412 | 330 |
| 284 | 3300049571 | Ga0501034_0000129 | Ga0501034_0000129_24253_25263 | 330 |
| 285 | 3300049662 | Ga0501222_008685 | Ga0501222_008685_175_1182 | 330 |
| 286 | iso_pu_bacteria | 2548876994 | 2550696747 | 330 |
| 287 | iso_pu_bacteria | 2818991445 | 2819594413 | 330 |
| 288 | iso_pu_bacteria | 2884811622 | 2884815320 | 330 |
| 289 | iso_pu_bacteria | 2884836552 | 2884840836 | 330 |
| 290 | iso_pu_bacteria | 2884852848 | 2884857568 | 330 |
| 291 | iso_pu_bacteria | 2896154374 | 2896158508 | 330 |
| 292 | 3300003771 | Ga0055526_1000289 | Ga0055526_10002895 | 331 |
| 293 | 3300005262 | Ga0065165_1001419 | Ga0065165_10014196 | 331 |
| 294 | 3300005335 | Ga0070666_10234942 | Ga0070666_102349421 | 331 |
| 295 | 3300006946 | Ga0079104_1004008 | Ga0079104_10040085 | 331 |
| 296 | 3300009177 | Ga0105248_10182322 | Ga0105248_101823222 | 331 |
| 297 | 3300013306 | Ga0163162_10007880 | Ga0163162_100078804 | 331 |
| 298 | 3300013308 | Ga0157375_10018197 | Ga0157375_100181975 | 331 |
| 299 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006788 | 331 |
| 300 | 3300026067 | Ga0207678_10064508 | Ga0207678_100645082 | 331 |
| 301 | 3300037466 | Ga0395898_0230158 | Ga0395898_0230158_274_1287 | 331 |
| 302 | 3300037471 | Ga0395905_0054981 | Ga0395905_0054981_1661_2674 | 331 |
| 303 | 3300039447 | Ga0436361_0082685 | Ga0436361_0082685_1196_2197 | 331 |
| 304 | 3300046452 | Ga0495617_000001 | Ga0495617_000001_430363_431373 | 331 |
| 305 | 3300046453 | Ga0495627_000026 | Ga0495627_000026_58399_59409 | 331 |
| 306 | 3300046453 | Ga0495627_000065 | Ga0495627_000065_101209_102216 | 331 |
| 307 | 3300046457 | Ga0495590_0000023 | Ga0495590_0000023_63637_64638 | 331 |
| 308 | 3300046457 | Ga0495590_0000083 | Ga0495590_0000083_11843_12859 | 331 |
| 309 | 3300046457 | Ga0495590_0001408 | Ga0495590_0001408_2322_3341 | 331 |
| 310 | 3300046458 | Ga0495591_000038 | Ga0495591_000038_62804_63829 | 331 |
| 311 | 3300046474 | Ga0495605_0000004 | Ga0495605_0000004_80235_81245 | 331 |
| 312 | 3300046474 | Ga0495605_0016154 | Ga0495605_0016154_940_1965 | 331 |
| 313 | 3300046474 | Ga0495605_0018303 | Ga0495605_0018303_279_1292 | 331 |
| 314 | 3300046491 | Ga0495584_0000234 | Ga0495584_0000234_12285_13310 | 331 |
| 315 | 3300046491 | Ga0495584_0012819 | Ga0495584_0012819_2083_3096 | 331 |
| 316 | 3300046491 | Ga0495584_0092552 | Ga0495584_0092552_392_1405 | 331 |
| 317 | 3300046492 | Ga0495585_0000521 | Ga0495585_0000521_12562_13575 | 331 |
| 318 | 3300046492 | Ga0495585_0002143 | Ga0495585_0002143_5216_6229 | 331 |
| 319 | 3300046492 | Ga0495585_0102178 | Ga0495585_0102178_190_1203 | 331 |
| 320 | 3300046500 | Ga0495596_0000353 | Ga0495596_0000353_28642_29661 | 331 |
| 321 | 3300046500 | Ga0495596_0001910 | Ga0495596_0001910_8653_9666 | 331 |
| 322 | 3300046500 | Ga0495596_0006189 | Ga0495596_0006189_3007_4017 | 331 |
| 323 | 3300046500 | Ga0495596_0006673 | Ga0495596_0006673_4046_5059 | 331 |
| 324 | 3300046501 | Ga0495607_0000272 | Ga0495607_0000272_42981_43991 | 331 |
| 325 | 3300046501 | Ga0495607_0009775 | Ga0495607_0009775_5294_6319 | 331 |
| 326 | 3300046506 | Ga0495583_0000345 | Ga0495583_0000345_62546_63571 | 331 |
| 327 | 3300046506 | Ga0495583_0008005 | Ga0495583_0008005_1281_2300 | 331 |
| 328 | 3300046506 | Ga0495583_0012287 | Ga0495583_0012287_3252_4271 | 331 |
| 329 | 3300046506 | Ga0495583_0028120 | Ga0495583_0028120_1612_2631 | 331 |
| 330 | 3300046506 | Ga0495583_0074465 | Ga0495583_0074465_412_1431 | 331 |
| 331 | 3300046507 | Ga0495606_0030185 | Ga0495606_0030185_1661_2680 | 331 |
| 332 | 3300046512 | Ga0495610_0004953 | Ga0495610_0004953_158_1183 | 331 |
| 333 | 3300046512 | Ga0495610_0018789 | Ga0495610_0018789_2689_3696 | 331 |
| 334 | 3300046513 | Ga0495616_0001609 | Ga0495616_0001609_10554_11564 | 331 |
| 335 | 3300046513 | Ga0495616_0020294 | Ga0495616_0020294_126_1145 | 331 |
| 336 | 3300046513 | Ga0495616_0045258 | Ga0495616_0045258_830_1849 | 331 |
| 337 | 3300046518 | Ga0495631_0000438 | Ga0495631_0000438_26101_27126 | 331 |
| 338 | 3300046518 | Ga0495631_0000980 | Ga0495631_0000980_3347_4360 | 331 |
| 339 | 3300046518 | Ga0495631_0001103 | Ga0495631_0001103_5703_6722 | 331 |
| 340 | 3300046518 | Ga0495631_0009591 | Ga0495631_0009591_402_1412 | 331 |
| 341 | 3300046518 | Ga0495631_0010803 | Ga0495631_0010803_801_1820 | 331 |
| 342 | 3300046518 | Ga0495631_0066757 | Ga0495631_0066757_484_1497 | 331 |
| 343 | 3300046519 | Ga0495632_0000024 | Ga0495632_0000024_99618_100628 | 331 |
| 344 | 3300046519 | Ga0495632_0000028 | Ga0495632_0000028_168794_169813 | 331 |
| 345 | 3300046519 | Ga0495632_0000043 | Ga0495632_0000043_102984_104003 | 331 |
| 346 | 3300046519 | Ga0495632_0012261 | Ga0495632_0012261_156_1181 | 331 |
| 347 | 3300046520 | Ga0495637_0000002 | Ga0495637_0000002_94052_95077 | 331 |
| 348 | 3300046520 | Ga0495637_0003770 | Ga0495637_0003770_3599_4606 | 331 |
| 349 | 3300046520 | Ga0495637_0038480 | Ga0495637_0038480_987_1991 | 331 |
| 350 | 3300046522 | Ga0495643_0000138 | Ga0495643_0000138_34820_35827 | 331 |
| 351 | 3300046522 | Ga0495643_0002875 | Ga0495643_0002875_9787_10812 | 331 |
| 352 | 3300046522 | Ga0495643_0008722 | Ga0495643_0008722_2155_3156 | 331 |
| 353 | 3300046522 | Ga0495643_0089697 | Ga0495643_0089697_353_1390 | 331 |
| 354 | 3300046523 | Ga0495644_0005637 | Ga0495644_0005637_2381_3406 | 331 |
| 355 | 3300046523 | Ga0495644_0012939 | Ga0495644_0012939_1949_2956 | 331 |
| 356 | 3300046524 | Ga0495648_0000022 | Ga0495648_0000022_224751_225761 | 331 |
| 357 | 3300046524 | Ga0495648_0010741 | Ga0495648_0010741_889_1908 | 331 |
| 358 | 3300046524 | Ga0495648_0041114 | Ga0495648_0041114_1864_2877 | 331 |
| 359 | 3300046528 | Ga0495642_0000001 | Ga0495642_0000001_171146_172156 | 331 |
| 360 | 3300046528 | Ga0495642_0000041 | Ga0495642_0000041_197_1207 | 331 |
| 361 | 3300046528 | Ga0495642_0007249 | Ga0495642_0007249_538_1551 | 331 |
| 362 | 3300046528 | Ga0495642_0008755 | Ga0495642_0008755_221_1234 | 331 |
| 363 | 3300046528 | Ga0495642_0019716 | Ga0495642_0019716_1293_2306 | 331 |
| 364 | 3300046530 | Ga0495654_0004648 | Ga0495654_0004648_5990_7009 | 331 |
| 365 | 3300046530 | Ga0495654_0029866 | Ga0495654_0029866_1382_2392 | 331 |
| 366 | 3300046538 | Ga0495609_0004066 | Ga0495609_0004066_2368_3375 | 331 |
| 367 | 3300046538 | Ga0495609_0005788 | Ga0495609_0005788_2177_3214 | 331 |
| 368 | 3300046538 | Ga0495609_0018521 | Ga0495609_0018521_1877_2890 | 331 |
| 369 | 3300046538 | Ga0495609_0032516 | Ga0495609_0032516_543_1556 | 331 |
| 370 | 3300046542 | Ga0495597_0000189 | Ga0495597_0000189_13031_14050 | 331 |
| 371 | 3300046542 | Ga0495597_0002006 | Ga0495597_0002006_5782_6795 | 331 |
| 372 | 3300046542 | Ga0495597_0004354 | Ga0495597_0004354_3112_4113 | 331 |
| 373 | 3300046558 | Ga0495633_0001372 | Ga0495633_0001372_9082_10107 | 331 |
| 374 | 3300046558 | Ga0495633_0001858 | Ga0495633_0001858_9361_10374 | 331 |
| 375 | 3300046558 | Ga0495633_0005278 | Ga0495633_0005278_3119_4126 | 331 |
| 376 | 3300046615 | Ga0495656_0098344 | Ga0495656_0098344_147_1157 | 331 |
| 377 | 3300046616 | Ga0495668_0000036 | Ga0495668_0000036_169920_170933 | 331 |
| 378 | 3300046616 | Ga0495668_0000280 | Ga0495668_0000280_10823_11833 | 331 |
| 379 | 3300046616 | Ga0495668_0000304 | Ga0495668_0000304_3339_4340 | 331 |
| 380 | 3300046616 | Ga0495668_0004592 | Ga0495668_0004592_1866_2879 | 331 |
| 381 | 3300046616 | Ga0495668_0010138 | Ga0495668_0010138_4001_5020 | 331 |
| 382 | 3300046616 | Ga0495668_0070733 | Ga0495668_0070733_478_1491 | 331 |
| 383 | 3300046616 | Ga0495668_0173282 | Ga0495668_0173282_111_1172 | 331 |
| 384 | 3300046648 | Ga0495611_0000191 | Ga0495611_0000191_21126_22151 | 331 |
| 385 | 3300046648 | Ga0495611_0016700 | Ga0495611_0016700_364_1377 | 331 |
| 386 | 3300046660 | Ga0495625_0022425 | Ga0495625_0022425_2824_3843 | 331 |
| 387 | 3300046665 | Ga0495661_0001045 | Ga0495661_0001045_15156_16169 | 331 |
| 388 | 3300046665 | Ga0495661_0002785 | Ga0495661_0002785_6109_7119 | 331 |
| 389 | 3300046665 | Ga0495661_0009113 | Ga0495661_0009113_1826_2845 | 331 |
| 390 | 3300046665 | Ga0495661_0017937 | Ga0495661_0017937_1449_2462 | 331 |
| 391 | 3300046665 | Ga0495661_0029380 | Ga0495661_0029380_626_1639 | 331 |
| 392 | 3300046665 | Ga0495661_0040087 | Ga0495661_0040087_437_1450 | 331 |
| 393 | 3300046674 | Ga0495588_0164185 | Ga0495588_0164185_69_1082 | 331 |
| 394 | 3300046684 | Ga0495669_0000013 | Ga0495669_0000013_131271_132284 | 331 |
| 395 | 3300046684 | Ga0495669_0000818 | Ga0495669_0000818_8419_9432 | 331 |
| 396 | 3300046684 | Ga0495669_0000834 | Ga0495669_0000834_5169_6179 | 331 |
| 397 | 3300046684 | Ga0495669_0018538 | Ga0495669_0018538_1340_2350 | 331 |
| 398 | 3300046691 | Ga0495670_0000052 | Ga0495670_0000052_6942_7955 | 331 |
| 399 | 3300046692 | Ga0495671_0000313 | Ga0495671_0000313_4758_5768 | 331 |
| 400 | 3300046692 | Ga0495671_0009433 | Ga0495671_0009433_2281_3300 | 331 |
| 401 | 3300046692 | Ga0495671_0026510 | Ga0495671_0026510_1792_2799 | 331 |
| 402 | 3300046694 | Ga0495649_0000085 | Ga0495649_0000085_28342_29367 | 331 |
| 403 | 3300046794 | Ga0495589_0000227 | Ga0495589_0000227_40654_41673 | 331 |
| 404 | 3300046794 | Ga0495589_0005507 | Ga0495589_0005507_776_1786 | 331 |
| 405 | 3300046794 | Ga0495589_0019142 | Ga0495589_0019142_795_1808 | 331 |
| 406 | 3300046794 | Ga0495589_0103993 | Ga0495589_0103993_192_1217 | 331 |
| 407 | 3300046810 | Ga0495660_0008371 | Ga0495660_0008371_2102_3109 | 331 |
| 408 | 3300046810 | Ga0495660_0011577 | Ga0495660_0011577_1846_2847 | 331 |
| 409 | 3300047320 | Ga0495672_0000065 | Ga0495672_0000065_9661_10686 | 331 |
| 410 | 3300047320 | Ga0495672_0002150 | Ga0495672_0002150_11327_12334 | 331 |
| 411 | 3300047320 | Ga0495672_0036059 | Ga0495672_0036059_78_1091 | 331 |
| 412 | 3300047320 | Ga0495672_0037417 | Ga0495672_0037417_1029_2042 | 331 |
| 413 | 3300047320 | Ga0495672_0040711 | Ga0495672_0040711_1521_2540 | 331 |
| 414 | 3300047321 | Ga0495676_0000029 | Ga0495676_0000029_123069_124082 | 331 |
| 415 | 3300047323 | Ga0495683_0000012 | Ga0495683_0000012_152634_153659 | 331 |
| 416 | 3300047323 | Ga0495683_0020718 | Ga0495683_0020718_1159_2178 | 331 |
| 417 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_231294_232307 | 331 |
| 418 | 3300047443 | Ga0495687_000007 | Ga0495687_000007_314415_315434 | 331 |
| 419 | 3300047443 | Ga0495687_000445 | Ga0495687_000445_34940_35959 | 331 |
| 420 | 3300047443 | Ga0495687_000827 | Ga0495687_000827_16870_17871 | 331 |
| 421 | 3300047443 | Ga0495687_003439 | Ga0495687_003439_3286_4287 | 331 |
| 422 | 3300047445 | Ga0495677_0001330 | Ga0495677_0001330_3490_4515 | 331 |
| 423 | 3300047445 | Ga0495677_0006184 | Ga0495677_0006184_2892_3905 | 331 |
| 424 | 3300047445 | Ga0495677_0008510 | Ga0495677_0008510_1829_2839 | 331 |
| 425 | 3300047445 | Ga0495677_0054801 | Ga0495677_0054801_358_1371 | 331 |
| 426 | 3300047446 | Ga0495679_004825 | Ga0495679_004825_4398_5417 | 331 |
| 427 | 3300047447 | Ga0495685_002660 | Ga0495685_002660_1218_2237 | 331 |
| 428 | 3300047470 | Ga0495681_0001808 | Ga0495681_0001808_2645_3658 | 331 |
| 429 | 3300047470 | Ga0495681_0050794 | Ga0495681_0050794_404_1423 | 331 |
| 430 | 3300047472 | Ga0495686_0022171 | Ga0495686_0022171_2179_3204 | 331 |
| 431 | 3300048091 | Ga0495626_0002911 | Ga0495626_0002911_1533_2546 | 331 |
| 432 | 3300048091 | Ga0495626_0027661 | Ga0495626_0027661_729_1748 | 331 |
| 433 | 3300048091 | Ga0495626_0032073 | Ga0495626_0032073_174_1193 | 331 |
| 434 | 3300048091 | Ga0495626_0053463 | Ga0495626_0053463_660_1685 | 331 |
| 435 | 3300048905 | Ga0496102_0000033 | Ga0496102_0000033_193949_194959 | 331 |
| 436 | 3300048906 | Ga0496103_0001739 | Ga0496103_0001739_7969_8976 | 331 |
| 437 | 3300048906 | Ga0496103_0111529 | Ga0496103_0111529_645_1706 | 331 |
| 438 | 3300048907 | Ga0496104_0158567 | Ga0496104_0158567_624_1685 | 331 |
| 439 | 3300048913 | Ga0496110_0021223 | Ga0496110_0021223_4132_5151 | 331 |
| 440 | 3300048929 | Ga0496126_0023069 | Ga0496126_0023069_1688_2707 | 331 |
| 441 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_959994_961001 | 331 |
| 442 | 3300049459 | Ga0495678_000015 | Ga0495678_000015_187837_188862 | 331 |
| 443 | 3300049459 | Ga0495678_000022 | Ga0495678_000022_102619_103638 | 331 |
| 444 | 3300049459 | Ga0495678_000229 | Ga0495678_000229_61317_62336 | 331 |
| 445 | 3300049459 | Ga0495678_004103 | Ga0495678_004103_3812_4819 | 331 |
| 446 | 3300049459 | Ga0495678_005612 | Ga0495678_005612_752_1771 | 331 |
| 447 | 3300049459 | Ga0495678_009379 | Ga0495678_009379_1781_2782 | 331 |
| 448 | 3300053145 | Ga0500586_000583 | Ga0500586_000583_3773_4780 | 331 |
| 449 | iso_pu_bacteria | 2511231003 | 2511252219 | 331 |
| 450 | 3300046460 | Ga0495638_0000067 | Ga0495638_0000067_103152_104165 | 332 |
| 451 | 3300046471 | Ga0495650_0008218 | Ga0495650_0008218_2210_3223 | 332 |
| 452 | 3300046475 | Ga0495639_0027630 | Ga0495639_0027630_14_1027 | 332 |
| 453 | 3300046506 | Ga0495583_0000162 | Ga0495583_0000162_10754_11767 | 332 |
| 454 | 3300046524 | Ga0495648_0000008 | Ga0495648_0000008_130632_131645 | 332 |
| 455 | 3300046528 | Ga0495642_0003464 | Ga0495642_0003464_2285_3298 | 332 |
| 456 | 3300046557 | Ga0495622_0000407 | Ga0495622_0000407_25748_26761 | 332 |
| 457 | 3300046558 | Ga0495633_0000075 | Ga0495633_0000075_48804_49817 | 332 |
| 458 | 3300046660 | Ga0495625_0010510 | Ga0495625_0010510_3154_4167 | 332 |
| 459 | 3300047469 | Ga0495673_0000034 | Ga0495673_0000034_101894_102907 | 332 |
| 460 | 3300048919 | Ga0496116_0153613 | Ga0496116_0153613_100_1116 | 332 |
| 461 | 3300048920 | Ga0496117_0143230 | Ga0496117_0143230_181_1245 | 332 |
| 462 | 3300048927 | Ga0496124_0039254 | Ga0496124_0039254_377_1399 | 332 |
| 463 | iso_pu_bacteria | 2599185214 | 2599620811 | 332 |
| 464 | iso_pu_bacteria | 2599185226 | 2599674110 | 332 |
| 465 | iso_pu_bacteria | 2599185227 | 2599678573 | 332 |
| 466 | iso_pu_bacteria | 2599185229 | 2599690322 | 332 |
| 467 | iso_pu_bacteria | 2643221683 | 2644465941 | 332 |
| 468 | iso_pu_bacteria | 2738541277 | 2738720661 | 332 |
| 469 | iso_pu_bacteria | 2738543013 | 2739248406 | 332 |
| 470 | iso_pu_bacteria | 2738543019 | 2739279860 | 332 |
| 471 | iso_pu_bacteria | 2818991446 | 2819601344 | 332 |
| 472 | iso_pu_bacteria | 2831265667 | 2831269765 | 332 |
| 473 | iso_pu_bacteria | 2838054893 | 2838055217 | 332 |
| 474 | iso_pu_bacteria | 2842698319 | 2842701545 | 332 |
| 475 | iso_pu_bacteria | 2842733646 | 2842736478 | 332 |
| 476 | iso_pu_bacteria | 2842747753 | 2842747755 | 332 |
| 477 | iso_pu_bacteria | 2881412998 | 2881416695 | 332 |
| 478 | iso_pu_bacteria | 2885198086 | 2885201696 | 332 |
| 479 | iso_pu_bacteria | 2885211737 | 2885215593 | 332 |
| 480 | iso_pu_bacteria | 2899924645 | 2899927307 | 332 |
| 481 | iso_pu_bacteria | 2904541872 | 2904549206 | 332 |
| 482 | iso_pu_bacteria | 2928037797 | 2928042779 | 332 |
| 483 | iso_pu_bacteria | 2928044640 | 2928048794 | 332 |
| 484 | iso_pu_bacteria | 2928051484 | 2928055126 | 332 |
| 485 | iso_pu_bacteria | 2928064002 | 2928068552 | 332 |
| 486 | iso_pu_bacteria | 2928070936 | 2928073539 | 332 |
| 487 | iso_pu_bacteria | 2928084124 | 2928089758 | 332 |
| 488 | iso_pu_bacteria | 2928115317 | 2928119521 | 332 |
| 489 | iso_pu_bacteria | 2929160207 | 2929161383 | 332 |
| 490 | iso_pu_bacteria | 2945909444 | 2945914158 | 332 |
| 491 | iso_pu_bacteria | 2945984333 | 2945990458 | 332 |
| 492 | 3300031250 | Ga0265331_10000850 | Ga0265331_100008506 | 333 |
| 493 | 3300031251 | Ga0265327_10001272 | Ga0265327_1000127210 | 333 |
| 494 | 3300041498 | Ga0451841_1002159 | Ga0451841_1002159_101_1111 | 333 |
| 495 | 3300048913 | Ga0496110_0000007 | Ga0496110_0000007_57637_58668 | 333 |
| 496 | iso_pu_bacteria | 2738541307 | 2738886249 | 333 |
| 497 | iso_pu_bacteria | 2834641062 | 2834644450 | 333 |
| 498 | 3300002704 | JGI25155J39150_1000278 | JGI25155J39150_100027812 | 334 |
| 499 | 3300002705 | JGI25156J39149_1000603 | JGI25156J39149_100060313 | 334 |
| 500 | 3300002737 | JGI25162J39368_1004886 | JGI25162J39368_10048862 | 334 |
| 501 | 3300002738 | JGI25154J39366_1000546 | JGI25154J39366_100054612 | 334 |
| 502 | 3300002741 | JGI25157J39369_1000507 | JGI25157J39369_100050712 | 334 |
| 503 | 3300003320 | rootH2_10144172 | rootH2_101441722 | 334 |
| 504 | 3300003758 | Ga0055532_1000089 | Ga0055532_100008968 | 334 |
| 505 | 3300003761 | Ga0055535_1007254 | Ga0055535_10072541 | 334 |
| 506 | 3300003775 | Ga0055524_1000203 | Ga0055524_100020337 | 334 |
| 507 | 3300003791 | Ga0055530_10002316 | Ga0055530_100023169 | 334 |
| 508 | 3300003792 | Ga0055540_1000119 | Ga0055540_100011954 | 334 |
| 509 | 3300005331 | Ga0070670_100019932 | Ga0070670_1000199323 | 334 |
| 510 | 3300005563 | Ga0068855_100083619 | Ga0068855_1000836193 | 334 |
| 511 | 3300005614 | Ga0068856_100005665 | Ga0068856_1000056655 | 334 |
| 512 | 3300005616 | Ga0068852_100025954 | Ga0068852_1000259544 | 334 |
| 513 | 3300006946 | Ga0079104_1000019 | Ga0079104_1000019115 | 334 |
| 514 | 3300009093 | Ga0105240_10017286 | Ga0105240_100172866 | 334 |
| 515 | 3300009177 | Ga0105248_10117010 | Ga0105248_101170102 | 334 |
| 516 | 3300009551 | Ga0105238_10250395 | Ga0105238_102503952 | 334 |
| 517 | 3300013306 | Ga0163162_10012287 | Ga0163162_100122873 | 334 |
| 518 | 3300016635 | Ga0183361_10008 | Ga0183361_10008206 | 334 |
| 519 | 3300025206 | Ga0209435_100088 | Ga0209435_10008833 | 334 |
| 520 | 3300025229 | Ga0209147_100060 | Ga0209147_100060132 | 334 |
| 521 | 3300025233 | Ga0209437_100442 | Ga0209437_1004424 | 334 |
| 522 | 3300025242 | Ga0209258_100141 | Ga0209258_100141104 | 334 |
| 523 | 3300025246 | Ga0209646_1000101 | Ga0209646_1000101122 | 334 |
| 524 | 3300025250 | Ga0209026_1000264 | Ga0209026_100026433 | 334 |
| 525 | 3300025256 | Ga0209759_1000264 | Ga0209759_100026448 | 334 |
| 526 | 3300025291 | Ga0209675_1011912 | Ga0209675_10119123 | 334 |
| 527 | 3300025298 | Ga0209050_1000478 | Ga0209050_100047821 | 334 |
| 528 | 3300025298 | Ga0209050_1003977 | Ga0209050_10039777 | 334 |
| 529 | 3300025299 | Ga0209256_1000024 | Ga0209256_1000024117 | 334 |
| 530 | 3300025303 | Ga0209051_1000063 | Ga0209051_100006354 | 334 |
| 531 | 3300025304 | Ga0209257_1000118 | Ga0209257_1000118153 | 334 |
| 532 | 3300025735 | Ga0207713_1036865 | Ga0207713_10368652 | 334 |
| 533 | 3300025913 | Ga0207695_10002329 | Ga0207695_1000232921 | 334 |
| 534 | 3300025913 | Ga0207695_10063866 | Ga0207695_100638662 | 334 |
| 535 | 3300025924 | Ga0207694_10045712 | Ga0207694_100457122 | 334 |
| 536 | 3300025925 | Ga0207650_10004198 | Ga0207650_100041982 | 334 |
| 537 | 3300025941 | Ga0207711_10329710 | Ga0207711_103297101 | 334 |
| 538 | 3300025949 | Ga0207667_10013354 | Ga0207667_100133546 | 334 |
| 539 | 3300026078 | Ga0207702_10048467 | Ga0207702_100484672 | 334 |
| 540 | 3300026142 | Ga0207698_10113843 | Ga0207698_101138431 | 334 |
| 541 | 3300027111 | Ga0209281_1000160 | Ga0209281_1000160115 | 334 |
| 542 | 3300028800 | Ga0265338_10000045 | Ga0265338_1000004537 | 334 |
| 543 | 3300042125 | Ga0450923_021396 | Ga0450923_021396_190_1212 | 334 |
| 544 | 3300042531 | Ga0450918_000093 | Ga0450918_000093_14554_15576 | 334 |
| 545 | 3300046516 | Ga0495628_0032728 | Ga0495628_0032728_1961_3070 | 334 |
| 546 | 3300046660 | Ga0495625_0013764 | Ga0495625_0013764_1882_2898 | 334 |
| 547 | 3300047320 | Ga0495672_0043617 | Ga0495672_0043617_478_1539 | 334 |
| 548 | 3300047469 | Ga0495673_0019688 | Ga0495673_0019688_766_1827 | 334 |
| 549 | 3300047472 | Ga0495686_0000021 | Ga0495686_0000021_103176_104285 | 334 |
| 550 | 3300048909 | Ga0496106_0000032 | Ga0496106_0000032_91441_92496 | 334 |
| 551 | 3300048921 | Ga0496118_0054990 | Ga0496118_0054990_326_1381 | 334 |
| 552 | 3300048924 | Ga0496121_0086377 | Ga0496121_0086377_1215_2270 | 334 |
| 553 | 3300048925 | Ga0496122_0000146 | Ga0496122_0000146_100347_101363 | 334 |
| 554 | 3300048926 | Ga0496123_0000894 | Ga0496123_0000894_7695_8711 | 334 |
| 555 | 3300048928 | Ga0496125_0002050 | Ga0496125_0002050_5436_6452 | 334 |
| 556 | 3300048929 | Ga0496126_0000421 | Ga0496126_0000421_58158_59213 | 334 |
| 557 | 3300048929 | Ga0496126_0019373 | Ga0496126_0019373_104_1141 | 334 |
| 558 | iso_pu_bacteria | 2808606384 | 2808967615 | 334 |
| 559 | iso_pu_bacteria | 2808606390 | 2809002446 | 334 |
| 560 | iso_pu_bacteria | 2808606391 | 2809009724 | 334 |
| 561 | iso_pu_bacteria | 2857357740 | 2857365612 | 334 |
| 562 | iso_pu_bacteria | 2904479285 | 2904481599 | 334 |
| 563 | iso_pu_bacteria | 8039098773 | 8039099939 | 334 |
| 564 | 3300002704 | JGI25155J39150_1000435 | JGI25155J39150_10004355 | 335 |
| 565 | 3300002738 | JGI25154J39366_1000296 | JGI25154J39366_10002968 | 335 |
| 566 | 3300005577 | Ga0068857_100120080 | Ga0068857_1001200802 | 335 |
| 567 | 3300005578 | Ga0068854_100037948 | Ga0068854_1000379482 | 335 |
| 568 | 3300006948 | Ga0099826_10000074 | Ga0099826_1000007430 | 335 |
| 569 | 3300009545 | Ga0105237_10010237 | Ga0105237_100102374 | 335 |
| 570 | 3300009551 | Ga0105238_10000125 | Ga0105238_1000012570 | 335 |
| 571 | 3300010375 | Ga0105239_10003165 | Ga0105239_100031654 | 335 |
| 572 | 3300013105 | Ga0157369_10031722 | Ga0157369_100317223 | 335 |
| 573 | 3300015261 | Ga0182006_1017245 | Ga0182006_10172453 | 335 |
| 574 | 3300021361 | Ga0213872_10000043 | Ga0213872_1000004324 | 335 |
| 575 | 3300021361 | Ga0213872_10000086 | Ga0213872_1000008686 | 335 |
| 576 | 3300021361 | Ga0213872_10026701 | Ga0213872_100267013 | 335 |
| 577 | 3300025206 | Ga0209435_100155 | Ga0209435_10015519 | 335 |
| 578 | 3300025246 | Ga0209646_1000176 | Ga0209646_100017647 | 335 |
| 579 | 3300025250 | Ga0209026_1001144 | Ga0209026_10011446 | 335 |
| 580 | 3300025256 | Ga0209759_1000296 | Ga0209759_100029615 | 335 |
| 581 | 3300025913 | Ga0207695_10003770 | Ga0207695_1000377013 | 335 |
| 582 | 3300025914 | Ga0207671_10002331 | Ga0207671_1000233113 | 335 |
| 583 | 3300025924 | Ga0207694_10001397 | Ga0207694_1000139716 | 335 |
| 584 | 3300025981 | Ga0207640_10044059 | Ga0207640_100440592 | 335 |
| 585 | 3300026116 | Ga0207674_10101251 | Ga0207674_101012512 | 335 |
| 586 | 3300027666 | Ga0209282_1000113 | Ga0209282_100011317 | 335 |
| 587 | 3300033180 | Ga0307510_10000462 | Ga0307510_1000046220 | 335 |
| 588 | 3300039447 | Ga0436361_0493011 | Ga0436361_0493011_1330_2343 | 335 |
| 589 | 3300039447 | Ga0436361_0943694 | Ga0436361_0943694_86926_87939 | 335 |
| 590 | 3300039447 | Ga0436361_1133215 | Ga0436361_1133215_53874_54887 | 335 |
| 591 | 3300039447 | Ga0436361_1136892 | Ga0436361_1136892_1675_2685 | 335 |
| 592 | 3300044683 | Ga0466965_0034922 | Ga0466965_0034922_511_1572 | 335 |
| 593 | 3300046455 | Ga0495603_0001852 | Ga0495603_0001852_11005_12054 | 335 |
| 594 | 3300046459 | Ga0495629_0000088 | Ga0495629_0000088_18942_19991 | 335 |
| 595 | 3300046462 | Ga0495651_0113752 | Ga0495651_0113752_182_1225 | 335 |
| 596 | 3300046471 | Ga0495650_0001305 | Ga0495650_0001305_13637_14686 | 335 |
| 597 | 3300046472 | Ga0495580_0000056 | Ga0495580_0000056_2629_3681 | 335 |
| 598 | 3300046472 | Ga0495580_0010163 | Ga0495580_0010163_368_1417 | 335 |
| 599 | 3300046473 | Ga0495582_0066393 | Ga0495582_0066393_587_1636 | 335 |
| 600 | 3300046500 | Ga0495596_0008428 | Ga0495596_0008428_1465_2514 | 335 |
| 601 | 3300046516 | Ga0495628_0020955 | Ga0495628_0020955_949_2001 | 335 |
| 602 | 3300046517 | Ga0495630_0014034 | Ga0495630_0014034_4738_5790 | 335 |
| 603 | 3300046526 | Ga0495666_0003483 | Ga0495666_0003483_3082_4134 | 335 |
| 604 | 3300046543 | Ga0495645_0000452 | Ga0495645_0000452_17961_19010 | 335 |
| 605 | 3300046678 | Ga0495599_0013941 | Ga0495599_0013941_1738_2790 | 335 |
| 606 | 3300046689 | Ga0495613_0014673 | Ga0495613_0014673_2181_3230 | 335 |
| 607 | 3300046690 | Ga0495624_0001726 | Ga0495624_0001726_13432_14484 | 335 |
| 608 | 3300046694 | Ga0495649_0084399 | Ga0495649_0084399_249_1292 | 335 |
| 609 | 3300046809 | Ga0495600_0046096 | Ga0495600_0046096_421_1470 | 335 |
| 610 | 3300047317 | Ga0495604_0021007 | Ga0495604_0021007_2327_3379 | 335 |
| 611 | 3300047320 | Ga0495672_0117484 | Ga0495672_0117484_88_1140 | 335 |
| 612 | 3300047322 | Ga0495680_0043744 | Ga0495680_0043744_918_1970 | 335 |
| 613 | 3300048903 | Ga0496100_0072005 | Ga0496100_0072005_907_1956 | 335 |
| 614 | 3300048904 | Ga0496101_0061325 | Ga0496101_0061325_1088_2137 | 335 |
| 615 | 3300048905 | Ga0496102_0136988 | Ga0496102_0136988_608_1654 | 335 |
| 616 | 3300048908 | Ga0496105_0031194 | Ga0496105_0031194_1715_2764 | 335 |
| 617 | 3300048917 | Ga0496114_0003502 | Ga0496114_0003502_417_1478 | 335 |
| 618 | 3300048920 | Ga0496117_0000392 | Ga0496117_0000392_62830_63876 | 335 |
| 619 | 3300048921 | Ga0496118_0003657 | Ga0496118_0003657_16104_17150 | 335 |
| 620 | 3300048924 | Ga0496121_0000672 | Ga0496121_0000672_7230_8282 | 335 |
| 621 | 3300048929 | Ga0496126_0000426 | Ga0496126_0000426_43391_44437 | 335 |
| 622 | 3300048929 | Ga0496126_0000915 | Ga0496126_0000915_2930_3982 | 335 |
| 623 | 3300048929 | Ga0496126_0011309 | Ga0496126_0011309_698_1750 | 335 |
| 624 | iso_pu_bacteria | 2643221569 | 2643861802 | 335 |
| 625 | iso_pu_bacteria | 2643221594 | 2643983169 | 335 |
| 626 | iso_pu_bacteria | 2643221621 | 2644123430 | 335 |
| 627 | iso_pu_bacteria | 2808606395 | 2809033307 | 335 |
| 628 | iso_pu_bacteria | 2818991449 | 2819618525 | 335 |
| 629 | iso_pu_bacteria | 2857537821 | 2857538201 | 335 |
| 630 | iso_pu_bacteria | 2858950400 | 2858952017 | 335 |
| 631 | iso_pu_bacteria | 2904439833 | 2904444238 | 335 |
| 632 | iso_pu_bacteria | 2904530477 | 2904533843 | 335 |
| 633 | iso_pu_bacteria | 2904584206 | 2904589321 | 335 |
| 634 | iso_pu_bacteria | 2904589729 | 2904595023 | 335 |
| 635 | iso_pu_bacteria | 2904601388 | 2904606496 | 335 |
| 636 | iso_pu_bacteria | 2919079590 | 2919084554 | 335 |
| 637 | iso_pu_bacteria | 2923510766 | 2923514645 | 335 |
| 638 | iso_pu_bacteria | 2928130867 | 2928135449 | 335 |
| 639 | iso_pu_bacteria | 2941479691 | 2941482439 | 335 |
| 640 | iso_pu_bacteria | 8003400568 | 8003404142 | 335 |
| 641 | 3300002773 | JGI25152J39213_1009578 | JGI25152J39213_10095782 | 336 |
| 642 | 3300002774 | JGI25150J39212_1007157 | JGI25150J39212_10071571 | 336 |
| 643 | 3300002987 | JGI25159J45721_1023305 | JGI25159J45721_10233051 | 336 |
| 644 | 3300003187 | JGI25151J46595_10004463 | JGI25151J46595_100044635 | 336 |
| 645 | 3300003187 | JGI25151J46595_10022671 | JGI25151J46595_100226712 | 336 |
| 646 | 3300003215 | JGI25153J46596_10021175 | JGI25153J46596_100211752 | 336 |
| 647 | 3300003751 | Ga0055538_1000053 | Ga0055538_100005364 | 336 |
| 648 | 3300003752 | Ga0055539_1000078 | Ga0055539_100007864 | 336 |
| 649 | 3300003756 | Ga0055533_1000084 | Ga0055533_100008464 | 336 |
| 650 | 3300003759 | Ga0055525_1000112 | Ga0055525_100011258 | 336 |
| 651 | 3300003761 | Ga0055535_1004789 | Ga0055535_10047892 | 336 |
| 652 | 3300003762 | Ga0055542_1000084 | Ga0055542_10000842 | 336 |
| 653 | 3300003775 | Ga0055524_1006315 | Ga0055524_10063152 | 336 |
| 654 | 3300003781 | Ga0055536_1001919 | Ga0055536_100191913 | 336 |
| 655 | 3300003781 | Ga0055536_1035560 | Ga0055536_10355602 | 336 |
| 656 | 3300003784 | Ga0055534_1000873 | Ga0055534_100087310 | 336 |
| 657 | 3300003791 | Ga0055530_10001195 | Ga0055530_100011952 | 336 |
| 658 | 3300003792 | Ga0055540_1004031 | Ga0055540_10040312 | 336 |
| 659 | 3300003792 | Ga0055540_1009042 | Ga0055540_10090423 | 336 |
| 660 | 3300003792 | Ga0055540_1012930 | Ga0055540_10129302 | 336 |
| 661 | 3300003794 | Ga0055531_10003661 | Ga0055531_1000366110 | 336 |
| 662 | 3300003794 | Ga0055531_10023250 | Ga0055531_100232502 | 336 |
| 663 | 3300003841 | Ga0055541_1000055 | Ga0055541_100005558 | 336 |
| 664 | 3300005327 | Ga0070658_10146196 | Ga0070658_101461962 | 336 |
| 665 | 3300005364 | Ga0070673_100188926 | Ga0070673_1001889262 | 336 |
| 666 | 3300005457 | Ga0070662_100097260 | Ga0070662_1000972602 | 336 |
| 667 | 3300005564 | Ga0070664_100023285 | Ga0070664_1000232852 | 336 |
| 668 | 3300005577 | Ga0068857_100029509 | Ga0068857_1000295093 | 336 |
| 669 | 3300005834 | Ga0068851_10006805 | Ga0068851_100068052 | 336 |
| 670 | 3300005844 | Ga0068862_100192029 | Ga0068862_1001920292 | 336 |
| 671 | 3300006051 | Ga0075364_10167379 | Ga0075364_101673791 | 336 |
| 672 | 3300006353 | Ga0075370_10002922 | Ga0075370_100029228 | 336 |
| 673 | 3300006353 | Ga0075370_10005862 | Ga0075370_100058627 | 336 |
| 674 | 3300009036 | Ga0105244_10005858 | Ga0105244_1000585810 | 336 |
| 675 | 3300009148 | Ga0105243_10003150 | Ga0105243_1000315015 | 336 |
| 676 | 3300009148 | Ga0105243_10006289 | Ga0105243_1000628910 | 336 |
| 677 | 3300009148 | Ga0105243_10021336 | Ga0105243_100213363 | 336 |
| 678 | 3300009545 | Ga0105237_10389383 | Ga0105237_103893831 | 336 |
| 679 | 3300009551 | Ga0105238_10351303 | Ga0105238_103513032 | 336 |
| 680 | 3300009551 | Ga0105238_10380894 | Ga0105238_103808942 | 336 |
| 681 | 3300010375 | Ga0105239_10432678 | Ga0105239_104326782 | 336 |
| 682 | 3300011119 | Ga0105246_10041696 | Ga0105246_100416962 | 336 |
| 683 | 3300013102 | Ga0157371_10032343 | Ga0157371_100323432 | 336 |
| 684 | 3300013104 | Ga0157370_10249487 | Ga0157370_102494872 | 336 |
| 685 | 3300013306 | Ga0163162_10190964 | Ga0163162_101909642 | 336 |
| 686 | 3300013307 | Ga0157372_10064239 | Ga0157372_100642393 | 336 |
| 687 | 3300014497 | Ga0182008_10000579 | Ga0182008_100005792 | 336 |
| 688 | 3300014497 | Ga0182008_10003531 | Ga0182008_1000353110 | 336 |
| 689 | 3300015261 | Ga0182006_1000912 | Ga0182006_100091220 | 336 |
| 690 | 3300015262 | Ga0182007_10003417 | Ga0182007_100034172 | 336 |
| 691 | 3300017792 | Ga0163161_10001053 | Ga0163161_100010532 | 336 |
| 692 | 3300017792 | Ga0163161_10066144 | Ga0163161_100661442 | 336 |
| 693 | 3300017792 | Ga0163161_10223794 | Ga0163161_102237942 | 336 |
| 694 | 3300021361 | Ga0213872_10005011 | Ga0213872_100050113 | 336 |
| 695 | 3300025208 | Ga0209436_105353 | Ga0209436_1053531 | 336 |
| 696 | 3300025224 | Ga0209784_100035 | Ga0209784_10003558 | 336 |
| 697 | 3300025225 | Ga0209566_100040 | Ga0209566_10004058 | 336 |
| 698 | 3300025226 | Ga0209674_100057 | Ga0209674_10005758 | 336 |
| 699 | 3300025228 | Ga0209672_100776 | Ga0209672_1007763 | 336 |
| 700 | 3300025229 | Ga0209147_101867 | Ga0209147_1018673 | 336 |
| 701 | 3300025230 | Ga0209563_100059 | Ga0209563_10005958 | 336 |
| 702 | 3300025242 | Ga0209258_100790 | Ga0209258_1007902 | 336 |
| 703 | 3300025245 | Ga0207425_1000552 | Ga0207425_10005522 | 336 |
| 704 | 3300025253 | Ga0209677_100036 | Ga0209677_10003658 | 336 |
| 705 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071185 | 336 |
| 706 | 3300025258 | Ga0209129_1000147 | Ga0209129_100014772 | 336 |
| 707 | 3300025258 | Ga0209129_1002420 | Ga0209129_10024205 | 336 |
| 708 | 3300025258 | Ga0209129_1010367 | Ga0209129_10103672 | 336 |
| 709 | 3300025263 | Ga0209565_1000282 | Ga0209565_100028222 | 336 |
| 710 | 3300025263 | Ga0209565_1003395 | Ga0209565_10033956 | 336 |
| 711 | 3300025273 | Ga0209673_1001256 | Ga0209673_10012565 | 336 |
| 712 | 3300025273 | Ga0209673_1001287 | Ga0209673_100128722 | 336 |
| 713 | 3300025284 | Ga0209130_1001468 | Ga0209130_10014685 | 336 |
| 714 | 3300025284 | Ga0209130_1001869 | Ga0209130_10018699 | 336 |
| 715 | 3300025291 | Ga0209675_1000745 | Ga0209675_10007452 | 336 |
| 716 | 3300025291 | Ga0209675_1001335 | Ga0209675_100133512 | 336 |
| 717 | 3300025291 | Ga0209675_1004919 | Ga0209675_10049192 | 336 |
| 718 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028491 | 336 |
| 719 | 3300025292 | Ga0209676_1000216 | Ga0209676_100021628 | 336 |
| 720 | 3300025292 | Ga0209676_1000486 | Ga0209676_100048614 | 336 |
| 721 | 3300025292 | Ga0209676_1008584 | Ga0209676_10085842 | 336 |
| 722 | 3300025294 | Ga0209025_1000375 | Ga0209025_100037575 | 336 |
| 723 | 3300025294 | Ga0209025_1000503 | Ga0209025_10005032 | 336 |
| 724 | 3300025294 | Ga0209025_1001127 | Ga0209025_100112711 | 336 |
| 725 | 3300025294 | Ga0209025_1004317 | Ga0209025_10043172 | 336 |
| 726 | 3300025295 | Ga0209564_1000220 | Ga0209564_100022029 | 336 |
| 727 | 3300025295 | Ga0209564_1000327 | Ga0209564_100032753 | 336 |
| 728 | 3300025297 | Ga0209758_1000199 | Ga0209758_100019919 | 336 |
| 729 | 3300025298 | Ga0209050_1000072 | Ga0209050_1000072248 | 336 |
| 730 | 3300025298 | Ga0209050_1000133 | Ga0209050_100013319 | 336 |
| 731 | 3300025298 | Ga0209050_1025015 | Ga0209050_10250152 | 336 |
| 732 | 3300025299 | Ga0209256_1000117 | Ga0209256_100011729 | 336 |
| 733 | 3300025299 | Ga0209256_1000206 | Ga0209256_100020676 | 336 |
| 734 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049212 | 336 |
| 735 | 3300025302 | Ga0207426_1000166 | Ga0207426_100016629 | 336 |
| 736 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015420 | 336 |
| 737 | 3300025303 | Ga0209051_1000255 | Ga0209051_100025566 | 336 |
| 738 | 3300025303 | Ga0209051_1000440 | Ga0209051_100044022 | 336 |
| 739 | 3300025303 | Ga0209051_1006243 | Ga0209051_10062438 | 336 |
| 740 | 3300025303 | Ga0209051_1010689 | Ga0209051_10106894 | 336 |
| 741 | 3300025304 | Ga0209257_1000037 | Ga0209257_1000037325 | 336 |
| 742 | 3300025304 | Ga0209257_1003603 | Ga0209257_10036032 | 336 |
| 743 | 3300025304 | Ga0209257_1006169 | Ga0209257_10061693 | 336 |
| 744 | 3300025321 | Ga0207656_10047471 | Ga0207656_100474712 | 336 |
| 745 | 3300025728 | Ga0207655_1000689 | Ga0207655_100068917 | 336 |
| 746 | 3300025914 | Ga0207671_10156929 | Ga0207671_101569291 | 336 |
| 747 | 3300025933 | Ga0207706_10163822 | Ga0207706_101638222 | 336 |
| 748 | 3300025935 | Ga0207709_10001078 | Ga0207709_1000107820 | 336 |
| 749 | 3300025935 | Ga0207709_10003894 | Ga0207709_100038946 | 336 |
| 750 | 3300025935 | Ga0207709_10008677 | Ga0207709_100086775 | 336 |
| 751 | 3300025945 | Ga0207679_10008799 | Ga0207679_100087998 | 336 |
| 752 | 3300025960 | Ga0207651_10162383 | Ga0207651_101623832 | 336 |
| 753 | 3300026041 | Ga0207639_10401445 | Ga0207639_104014452 | 336 |
| 754 | 3300026116 | Ga0207674_10034062 | Ga0207674_100340622 | 336 |
| 755 | 3300026121 | Ga0207683_10302047 | Ga0207683_103020472 | 336 |
| 756 | 3300026142 | Ga0207698_10287080 | Ga0207698_102870802 | 336 |
| 757 | 3300028380 | Ga0268265_10089327 | Ga0268265_100893272 | 336 |
| 758 | 3300028794 | Ga0307515_10000215 | Ga0307515_1000021536 | 336 |
| 759 | 3300028794 | Ga0307515_10000267 | Ga0307515_1000026710 | 336 |
| 760 | 3300031251 | Ga0265327_10007497 | Ga0265327_100074975 | 336 |
| 761 | 3300031456 | Ga0307513_10014657 | Ga0307513_100146573 | 336 |
| 762 | 3300031649 | Ga0307514_10000806 | Ga0307514_1000080640 | 336 |
| 763 | 3300031731 | Ga0307405_10058007 | Ga0307405_100580072 | 336 |
| 764 | 3300031731 | Ga0307405_10058723 | Ga0307405_100587232 | 336 |
| 765 | 3300031911 | Ga0307412_10000120 | Ga0307412_1000012045 | 336 |
| 766 | 3300031911 | Ga0307412_10081052 | Ga0307412_100810521 | 336 |
| 767 | 3300032002 | Ga0307416_100207257 | Ga0307416_1002072572 | 336 |
| 768 | 3300032002 | Ga0307416_100298625 | Ga0307416_1002986252 | 336 |
| 769 | 3300032002 | Ga0307416_100315814 | Ga0307416_1003158142 | 336 |
| 770 | 3300039447 | Ga0436361_0442878 | Ga0436361_0442878_2034_3074 | 336 |
| 771 | 3300042115 | Ga0450911_000086 | Ga0450911_000086_8740_9750 | 336 |
| 772 | 3300046460 | Ga0495638_0062390 | Ga0495638_0062390_412_1422 | 336 |
| 773 | 3300046512 | Ga0495610_0059988 | Ga0495610_0059988_89_1099 | 336 |
| 774 | 3300046513 | Ga0495616_0002314 | Ga0495616_0002314_1388_2398 | 336 |
| 775 | 3300046515 | Ga0495620_0071760 | Ga0495620_0071760_369_1379 | 336 |
| 776 | 3300046518 | Ga0495631_0000007 | Ga0495631_0000007_15045_16055 | 336 |
| 777 | 3300046520 | Ga0495637_0001478 | Ga0495637_0001478_7991_9001 | 336 |
| 778 | 3300046530 | Ga0495654_0009711 | Ga0495654_0009711_564_1574 | 336 |
| 779 | 3300046535 | Ga0495586_0187961 | Ga0495586_0187961_108_1118 | 336 |
| 780 | 3300046615 | Ga0495656_0000306 | Ga0495656_0000306_3448_4458 | 336 |
| 781 | 3300046660 | Ga0495625_0009663 | Ga0495625_0009663_5978_6988 | 336 |
| 782 | 3300046660 | Ga0495625_0132954 | Ga0495625_0132954_329_1339 | 336 |
| 783 | 3300047673 | Ga0495593_0019591 | Ga0495593_0019591_515_1525 | 336 |
| 784 | 3300048089 | Ga0495614_0059770 | Ga0495614_0059770_42_1052 | 336 |
| 785 | 3300048904 | Ga0496101_0109160 | Ga0496101_0109160_503_1513 | 336 |
| 786 | 3300048907 | Ga0496104_0015936 | Ga0496104_0015936_277_1287 | 336 |
| 787 | 3300048908 | Ga0496105_0000920 | Ga0496105_0000920_1386_2396 | 336 |
| 788 | 3300048909 | Ga0496106_0036283 | Ga0496106_0036283_1058_2068 | 336 |
| 789 | 3300048913 | Ga0496110_0039713 | Ga0496110_0039713_2938_3948 | 336 |
| 790 | 3300048914 | Ga0496111_0042384 | Ga0496111_0042384_30_1040 | 336 |
| 791 | 3300048914 | Ga0496111_0092460 | Ga0496111_0092460_245_1255 | 336 |
| 792 | 3300048919 | Ga0496116_0056363 | Ga0496116_0056363_1469_2479 | 336 |
| 793 | 3300048919 | Ga0496116_0147132 | Ga0496116_0147132_116_1126 | 336 |
| 794 | 3300048920 | Ga0496117_0051388 | Ga0496117_0051388_732_1742 | 336 |
| 795 | 3300048924 | Ga0496121_0076246 | Ga0496121_0076246_727_1737 | 336 |
| 796 | 3300048925 | Ga0496122_0001985 | Ga0496122_0001985_18259_19269 | 336 |
| 797 | 3300048926 | Ga0496123_0000108 | Ga0496123_0000108_4097_5107 | 336 |
| 798 | 3300048928 | Ga0496125_0008706 | Ga0496125_0008706_9124_10134 | 336 |
| 799 | 3300050491 | nmdc:mga00v17_22831_c1 | nmdc:mga00v17_22831_c1_1809_2867 | 336 |
| 800 | 3300050496 | nmdc:mga07m45_13078_c1 | nmdc:mga07m45_13078_c1_800_1810 | 336 |
| 801 | 3300053079 | Ga0500610_0020896 | Ga0500610_0020896_968_1978 | 336 |
| 802 | 3300053087 | Ga0500643_016204 | Ga0500643_016204_31_1041 | 336 |
| 803 | 3300053093 | Ga0500651_0000305 | Ga0500651_0000305_8466_9476 | 336 |
| 804 | 3300053110 | Ga0500571_004833 | Ga0500571_004833_135_1145 | 336 |
| 805 | 3300053116 | Ga0500592_003231 | Ga0500592_003231_428_1438 | 336 |
| 806 | 3300053117 | Ga0500593_027001 | Ga0500593_027001_542_1552 | 336 |
| 807 | 3300053118 | Ga0500594_0002897 | Ga0500594_0002897_2600_3610 | 336 |
| 808 | 3300053121 | Ga0500607_000744 | Ga0500607_000744_17943_18953 | 336 |
| 809 | 3300053122 | Ga0500608_027954 | Ga0500608_027954_1060_2070 | 336 |
| 810 | 3300053125 | Ga0500618_001391 | Ga0500618_001391_8578_9630 | 336 |
| 811 | 3300053136 | Ga0500559_0004612 | Ga0500559_0004612_2946_3956 | 336 |
| 812 | 3300053139 | Ga0500568_0000934 | Ga0500568_0000934_18625_19635 | 336 |
| 813 | 3300053153 | Ga0500616_0028639 | Ga0500616_0028639_823_1833 | 336 |
| 814 | 3300053158 | Ga0500627_0000537 | Ga0500627_0000537_1201_2211 | 336 |
| 815 | iso_pu_bacteria | 2511231026 | 2511386711 | 336 |
| 816 | iso_pu_bacteria | 2738543012 | 2739241799 | 336 |
| 817 | iso_pu_bacteria | 2765235838 | 2765567248 | 336 |
| 818 | iso_pu_bacteria | 2808606386 | 2808984135 | 336 |
| 819 | iso_pu_bacteria | 2808606415 | 2809131939 | 336 |
| 820 | iso_pu_bacteria | 2808606419 | 2809151562 | 336 |
| 821 | iso_pu_bacteria | 2816332133 | 2816470896 | 336 |
| 822 | iso_pu_bacteria | 2839094727 | 2839095190 | 336 |
| 823 | iso_pu_bacteria | 2852618963 | 2852622979 | 336 |
| 824 | iso_pu_bacteria | 2855730933 | 2855732684 | 336 |
| 825 | iso_pu_bacteria | 2855767633 | 2855771436 | 336 |
| 826 | iso_pu_bacteria | 2919046199 | 2919051158 | 336 |
| 827 | 3300001979 | JGI24740J21852_10021376 | JGI24740J21852_100213761 | 337 |
| 828 | 3300025294 | Ga0209025_1030131 | Ga0209025_10301312 | 337 |
| 829 | 3300028800 | Ga0265338_10001261 | Ga0265338_1000126137 | 337 |
| 830 | 3300048919 | Ga0496116_0053964 | Ga0496116_0053964_489_1511 | 337 |
| 831 | 3300048920 | Ga0496117_0062360 | Ga0496117_0062360_235_1257 | 337 |
| 832 | 3300048921 | Ga0496118_0007943 | Ga0496118_0007943_9450_10463 | 337 |
| 833 | 3300053125 | Ga0500618_005834 | Ga0500618_005834_620_1696 | 337 |
| 834 | iso_pu_bacteria | 2547132374 | 2548499414 | 337 |
| 835 | iso_pu_bacteria | 2643221609 | 2644057527 | 337 |
| 836 | iso_pu_bacteria | 2643221611 | 2644072384 | 337 |
| 837 | iso_pu_bacteria | 2643221717 | 2644648073 | 337 |
| 838 | iso_pu_bacteria | 2643221733 | 2644730739 | 337 |
| 839 | iso_pu_bacteria | 2841760612 | 2841766372 | 337 |
| 840 | iso_pu_bacteria | 2841911363 | 2841916347 | 337 |
| 841 | iso_pu_bacteria | 2841917233 | 2841920984 | 337 |
| 842 | iso_pu_bacteria | 2844104063 | 2844106139 | 337 |
| 843 | iso_pu_bacteria | 2851182111 | 2851186640 | 337 |
| 844 | iso_pu_bacteria | 2851246043 | 2851246495 | 337 |
| 845 | iso_pu_bacteria | 2974320154 | 2974320762 | 337 |
| 846 | iso_pu_bacteria | 643348564 | 643600396 | 337 |
| 847 | iso_pu_bacteria | 8057529695 | 8057531298 | 337 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7998 | 26 | 325 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.785 | 26 | 325 |
| 6st1-assembly2.cif.gz_B | taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) | 0.779 | 30 | 327 |
| 6st1-assembly2.cif.gz_B | taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) | 0.7627 | 30 | 327 |
| 3qsl-assembly1.cif.gz_A | structure of cae31940 from bordetella bronchiseptica rb50 | 0.7585 | 29 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t66A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8659 | 66 | 90 | 3.40.190.10 |
| 2x7qA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7657 | 30 | 323 | 3.40.190.10 |
| 4nmyB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7627 | 30 | 329 | 3.40.190.10 |
| 4h65B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7618 | 27 | 297 | 3.40.190.10 |
| 4nmyB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7351 | 30 | 329 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A226X8Y2-F1-model_v4 | Taurine-binding periplasmic protein TauA | 0.993 | 40 | 337 |
|
| AF-A0A226X8Y2-F1-model_v4 | Taurine-binding periplasmic protein TauA | 0.9864 | 40 | 337 |
|
| AF-A0A3M2ZRZ6-F1-model_v4 | ABC transporter periplasmic substrate-binding protein | 0.984 | 97 | 337 |
|
| AF-A0A3M2W264-F1-model_v4 | deleted | 0.983 | 67 | 302 |
|
| AF-A0A4V2BIW2-F1-model_v4 | deleted | 0.9827 | 179 | 337 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar