F483334

General Info

Members Datasets Scaffolds Average Seq Length
847 390 744 338

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0006264|Ga0395905_0006264_7641_8651
Length 324
Sequence MKNTAKRLAALGLAGLLAFGAGAARAEGQIRIADQFGIVYLLLDVAKDQKLIEKHGKAQGLDIAVTQVTLSGGSAMNDALLSGSLDIAAAGVGPLLTLWDRTHGRQNVRGVASLGNFPYYLVSNNPAVKTIADFGDKDRIALPAVGVSVQSRILQMAAAKTWGDAQHARLDKISVALPHPEAAAAIVKGGTEITAHFGNPPFQEQELAGNPAARVVLKSYDTTDKFRSENPKTYRAFTAALAEAAQWISANPEAATDLFLRVNKSKVDRKLVLDIVKSPEVQFKLTPQNTFALAEFMHRVGAIKNKPASARDYFFDDPHNAGAN

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2547132374 Acidovorax radicis N35 Isolate Unclassified
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221569 Achromobacter sp. Root565 Isolate Unclassified
12 2643221594 Achromobacter sp. Root170 Isolate Unclassified
13 2643221609 Acidovorax sp. Root217 Isolate Unclassified
14 2643221611 Acidovorax sp. Root219 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2643221733 Bosea sp. Root381 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541297 Duganella sp. GV083 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738541357 Duganella sp. GV053 Isolate Unclassified
23 2738543003 Duganella sp. GV066 Isolate Unclassified
24 2738543012 Acidovorax sp. CF301 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2738543026 Duganella sp. GV089 Isolate Unclassified
28 2738543029 Duganella sp. GV039 Isolate Unclassified
29 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
30 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
31 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
32 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
33 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
34 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
35 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
36 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
37 2816332133 Acidovorax radicis 2721A Isolate Unclassified
38 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
39 2818991446 Variovorax sp. 1180 Isolate Unclassified
40 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
41 2818991467 Bosea vestrisii 3192 Isolate Unclassified
42 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
43 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
44 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
45 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
46 2841760612 Bosea sp. Tri-49 Isolate Nodule
47 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
48 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
49 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
50 2842733646 Variovorax sp. R-72446 Isolate Unclassified
51 2842747753 Variovorax sp. R-72060 Isolate Unclassified
52 2844104063 Bosea sp. Tri-39 Isolate Nodule
53 2851182111 Bosea sp. Tri-44 Isolate Nodule
54 2851246043 Bosea sp. Tri-54 Isolate Nodule
55 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
56 2855730933 Achromobacter sp. HZ28 Isolate Nodule
57 2855767633 Achromobacter sp. HZ34 Isolate Nodule
58 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
59 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
60 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
61 2857553236 Duganella sp. R-74557 Isolate Unclassified
62 2857558681 Duganella sp. R-74565 Isolate Unclassified
63 2857564685 Duganella sp. R-74599 Isolate Unclassified
64 2858950400 Achromobacter sp. K91 Isolate Unclassified
65 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
66 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
67 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
68 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
69 2885198086 Variovorax sp. 679 Isolate Unclassified
70 2885211737 Variovorax sp. 553 Isolate Unclassified
71 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
72 2899924645 Variovorax sp. 369 Isolate Unclassified
73 2904424332 Duganella sp. 1411 Isolate Rhizosphere
74 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
75 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
76 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
77 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
78 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
79 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
80 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
81 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
82 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
83 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
84 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
85 2928037797 Variovorax sp. 1126 Isolate Unclassified
86 2928044640 Variovorax sp. 1128 Isolate Unclassified
87 2928051484 Variovorax sp. 1133 Isolate Unclassified
88 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
89 2928070936 Variovorax gossypii 1167 Isolate Unclassified
90 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
91 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
92 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
93 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
94 2941479691
95 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
96 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
97 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
100 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
101 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
102 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
103 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
104 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
105 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
106 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
107 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
108 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
111 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
112 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
113 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
114 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
115 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
116 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
117 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
118 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
119 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
120 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
121 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
122 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
123 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
124 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
125 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
126 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
127 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
128 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
129 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
130 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
131 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
132 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
133 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
134 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
135 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
136 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
143 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
144 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
145 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
150 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
151 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
152 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
175 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
185 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
186 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
190 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
191 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
252 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
253 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
254 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
255 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
371 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
374 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
376 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
377 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
385 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
386 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
387 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
388 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
389 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
390 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.84
Metatranscriptomes 0
Isolates 12.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.95
Nodule 2.6
Rhizoplane 3.9
Rhizosphere 59.27
Stem 0
Stem Tuber 0
Unclassified 16.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021376 3300001979 Bacteria 2244
2 JGI24735J21928_10001861 3300002067 Bacteria 7399
3 JGI25155J39150_1000278 3300002704 Bacteria 18670
4 JGI25155J39150_1000435 3300002704 Bacteria 11038
5 JGI25156J39149_1000603 3300002705 Bacteria 19976
6 JGI25162J39368_1004886 3300002737 Bacteria 2874
7 JGI25154J39366_1000296 3300002738 Bacteria 29599
8 JGI25154J39366_1000546 3300002738 Bacteria 18670
9 JGI25157J39369_1000507 3300002741 Bacteria 23998
10 JGI25152J39213_1009578 3300002773 Bacteria 2289
11 JGI25150J39212_1007157 3300002774 Bacteria 2259
12 JGI25159J45721_1023305 3300002987 Bacteria 1125
13 JGI25151J46595_10000065 3300003187 Bacteria 145136
14 JGI25151J46595_10000356 3300003187 Bacteria 48719
15 JGI25151J46595_10002865 3300003187 Bacteria 9916
16 JGI25151J46595_10004463 3300003187 Bacteria 7398
17 JGI25151J46595_10022671 3300003187 Bacteria 2602
18 JGI25151J46595_10030097 3300003187 Bacteria 2140
19 JGI25153J46596_10021175 3300003215 Bacteria 2430
20 rootH2_10144172 3300003320 Bacteria 1733
21 rootL2_10056250 3300003322 Bacteria 6100
22 rootL2_10097683 3300003322 Bacteria 6819
23 Ga0055538_1000053 3300003751 Bacteria 127408
24 Ga0055539_1000078 3300003752 Bacteria 127408
25 Ga0055533_1000084 3300003756 Bacteria 127408
26 Ga0055532_1000089 3300003758 Bacteria 105631
27 Ga0055525_1000112 3300003759 Bacteria 127408
28 Ga0055535_1004789 3300003761 Bacteria 3165
29 Ga0055535_1007254 3300003761 Bacteria 2139
30 Ga0055542_1000084 3300003762 Bacteria 125518
31 Ga0055526_1000289 3300003771 Bacteria 42000
32 Ga0055526_1002292 3300003771 Bacteria 13062
33 Ga0055526_1005476 3300003771 Bacteria 7286
34 Ga0055537_1000409 3300003773 Bacteria 28111
35 Ga0055524_1000203 3300003775 Bacteria 64635
36 Ga0055524_1001775 3300003775 Bacteria 11868
37 Ga0055524_1006315 3300003775 Bacteria 5154
38 Ga0055536_1000026 3300003781 Bacteria 166220
39 Ga0055536_1001919 3300003781 Bacteria 12045
40 Ga0055536_1035560 3300003781 Bacteria 1244
41 Ga0055534_1000189 3300003784 Bacteria 45268
42 Ga0055534_1000873 3300003784 Bacteria 13789
43 Ga0055534_1001063 3300003784 Bacteria 11875
44 Ga0055530_10001195 3300003791 Bacteria 20077
45 Ga0055530_10002316 3300003791 Bacteria 12445
46 Ga0055540_1000119 3300003792 Bacteria 82568
47 Ga0055540_1004031 3300003792 Bacteria 6834
48 Ga0055540_1009042 3300003792 Bacteria 3502
49 Ga0055540_1012930 3300003792 Bacteria 2584
50 Ga0055531_10003661 3300003794 Bacteria 9688
51 Ga0055531_10023250 3300003794 Bacteria 2331
52 Ga0055541_1000055 3300003841 Bacteria 127408
53 Ga0065165_1001419 3300005262 Bacteria 26069
54 Ga0065714_10075233 3300005288 Bacteria 2931
55 Ga0065715_10000585 3300005293 Bacteria 14517
56 Ga0070658_10146196 3300005327 Bacteria 1977
57 Ga0070670_100019932 3300005331 Bacteria 5757
58 Ga0070666_10234942 3300005335 Bacteria 1295
59 Ga0070682_100231570 3300005337 Bacteria 1321
60 Ga0070660_100035788 3300005339 Bacteria 3759
61 Ga0070673_100188926 3300005364 Bacteria 1768
62 Ga0070659_100014815 3300005366 Bacteria 5830
63 Ga0070662_100097260 3300005457 Bacteria 2222
64 Ga0070662_100108379 3300005457 Bacteria 2112
65 Ga0070662_100130378 3300005457 Bacteria 1938
66 Ga0068855_100036130 3300005563 Bacteria 5882
67 Ga0068855_100083619 3300005563 Bacteria 3697
68 Ga0070664_100023285 3300005564 Bacteria 5115
69 Ga0068857_100029509 3300005577 Bacteria 4840
70 Ga0068857_100120080 3300005577 Bacteria 2366
71 Ga0068854_100037948 3300005578 Bacteria 3385
72 Ga0068856_100005665 3300005614 Bacteria 12296
73 Ga0068852_100025954 3300005616 Bacteria 4755
74 Ga0068852_100402317 3300005616 Bacteria 1347
75 Ga0068851_10006805 3300005834 Bacteria 5231
76 Ga0068862_100192029 3300005844 Bacteria 1838
77 Ga0075364_10024414 3300006051 Bacteria 3839
78 Ga0075364_10167379 3300006051 Bacteria 1485
79 Ga0075370_10002922 3300006353 Bacteria 8028
80 Ga0075370_10005862 3300006353 Bacteria 6140
81 Ga0079104_1000019 3300006946 Bacteria 269313
82 Ga0079104_1004008 3300006946 Bacteria 6536
83 Ga0099826_10000074 3300006948 Bacteria 52710
84 Ga0105251_10000335 3300009011 Bacteria 47275
85 Ga0105244_10005858 3300009036 Bacteria 8071
86 Ga0105240_10017286 3300009093 Bacteria 9725
87 Ga0105240_10558615 3300009093 Bacteria 1265
88 Ga0105243_10003150 3300009148 Bacteria 13542
89 Ga0105243_10006289 3300009148 Bacteria 9175
90 Ga0105243_10021336 3300009148 Bacteria 4916
91 Ga0105241_10081750 3300009174 Bacteria 2531
92 Ga0105242_10017049 3300009176 Bacteria 5655
93 Ga0105248_10117010 3300009177 Bacteria 3006
94 Ga0105248_10182322 3300009177 Bacteria 2366
95 Ga0105237_10010237 3300009545 Bacteria 9992
96 Ga0105237_10139121 3300009545 Bacteria 2422
97 Ga0105237_10389383 3300009545 Bacteria 1399
98 Ga0105238_10000125 3300009551 Bacteria 84436
99 Ga0105238_10250395 3300009551 Bacteria 1750
100 Ga0105238_10351303 3300009551 Bacteria 1463
101 Ga0105238_10380894 3300009551 Bacteria 1402
102 Ga0105239_10003165 3300010375 Bacteria 20393
103 Ga0105239_10432678 3300010375 Bacteria 1491
104 Ga0105246_10041696 3300011119 Bacteria 3104
105 Ga0157371_10032343 3300013102 Bacteria 3765
106 Ga0157371_10254747 3300013102 Bacteria 1264
107 Ga0157370_10249487 3300013104 Bacteria 1642
108 Ga0157369_10031722 3300013105 Bacteria 5815
109 Ga0163162_10007880 3300013306 Bacteria 10377
110 Ga0163162_10012287 3300013306 Bacteria 8360
111 Ga0163162_10190964 3300013306 Bacteria 2176
112 Ga0157372_10064239 3300013307 Bacteria 4118
113 Ga0157375_10018197 3300013308 Bacteria 6368
114 Ga0182008_10000579 3300014497 Bacteria 27013
115 Ga0182008_10003531 3300014497 Bacteria 9398
116 Ga0182006_1000912 3300015261 Bacteria 19708
117 Ga0182006_1017245 3300015261 Bacteria 3070
118 Ga0182007_10003417 3300015262 Bacteria 7481
119 Ga0183361_10008 3300016635 Bacteria 259171
120 Ga0163161_10001053 3300017792 Bacteria 20949
121 Ga0163161_10066144 3300017792 Bacteria 2639
122 Ga0163161_10223794 3300017792 Bacteria 1458
123 Ga0213872_10000043 3300021361 Bacteria 117678
124 Ga0213872_10000086 3300021361 Bacteria 84955
125 Ga0213872_10005011 3300021361 Bacteria 6876
126 Ga0213872_10026701 3300021361 Bacteria 2652
127 Ga0209435_100088 3300025206 Bacteria 43747
128 Ga0209435_100155 3300025206 Bacteria 22381
129 Ga0209436_105353 3300025208 Bacteria 2970
130 Ga0209784_100035 3300025224 Bacteria 299760
131 Ga0209566_100040 3300025225 Bacteria 299760
132 Ga0209674_100057 3300025226 Bacteria 299760
133 Ga0209672_100776 3300025228 Bacteria 15278
134 Ga0209147_100060 3300025229 Bacteria 249588
135 Ga0209147_101867 3300025229 Bacteria 6422
136 Ga0209563_100059 3300025230 Bacteria 299760
137 Ga0209437_100442 3300025233 Bacteria 34637
138 Ga0209437_109925 3300025233 Bacteria 1469
139 Ga0209258_100141 3300025242 Bacteria 166385
140 Ga0209258_100790 3300025242 Bacteria 18961
141 Ga0207425_1000552 3300025245 Bacteria 22339
142 Ga0209646_1000101 3300025246 Bacteria 164503
143 Ga0209646_1000176 3300025246 Bacteria 81901
144 Ga0209026_1000264 3300025250 Bacteria 64186
145 Ga0209026_1001144 3300025250 Bacteria 12465
146 Ga0209677_100036 3300025253 Bacteria 299760
147 Ga0209148_1000007 3300025254 Bacteria 1592273
148 Ga0209759_1000264 3300025256 Bacteria 75893
149 Ga0209759_1000296 3300025256 Bacteria 68965
150 Ga0209129_1000147 3300025258 Bacteria 115120
151 Ga0209129_1002420 3300025258 Bacteria 9170
152 Ga0209129_1010367 3300025258 Bacteria 2332
153 Ga0209565_1000109 3300025263 Bacteria 120345
154 Ga0209565_1000282 3300025263 Bacteria 50138
155 Ga0209565_1003395 3300025263 Bacteria 5180
156 Ga0209565_1004483 3300025263 Bacteria 4225
157 Ga0209455_1000063 3300025272 Bacteria 333019
158 Ga0209673_1001256 3300025273 Bacteria 26191
159 Ga0209673_1001287 3300025273 Bacteria 25651
160 Ga0209130_1001468 3300025284 Bacteria 15478
161 Ga0209130_1001869 3300025284 Bacteria 12044
162 Ga0209130_1021883 3300025284 Bacteria 1435
163 Ga0209675_1000026 3300025291 Bacteria 284716
164 Ga0209675_1000118 3300025291 Bacteria 110507
165 Ga0209675_1000745 3300025291 Bacteria 21972
166 Ga0209675_1001335 3300025291 Bacteria 14600
167 Ga0209675_1003453 3300025291 Bacteria 7508
168 Ga0209675_1004919 3300025291 Bacteria 5768
169 Ga0209675_1011912 3300025291 Bacteria 2844
170 Ga0209676_1000028 3300025292 Bacteria 559745
171 Ga0209676_1000059 3300025292 Bacteria 344882
172 Ga0209676_1000216 3300025292 Bacteria 125759
173 Ga0209676_1000486 3300025292 Bacteria 64563
174 Ga0209676_1006414 3300025292 Bacteria 5815
175 Ga0209676_1008584 3300025292 Bacteria 4531
176 Ga0209025_1000066 3300025294 Bacteria 298742
177 Ga0209025_1000159 3300025294 Bacteria 167081
178 Ga0209025_1000198 3300025294 Bacteria 146276
179 Ga0209025_1000375 3300025294 Bacteria 93043
180 Ga0209025_1000503 3300025294 Bacteria 75048
181 Ga0209025_1001127 3300025294 Bacteria 38261
182 Ga0209025_1002020 3300025294 Bacteria 23152
183 Ga0209025_1004317 3300025294 Bacteria 12442
184 Ga0209025_1030131 3300025294 Bacteria 2605
185 Ga0209564_1000006 3300025295 Bacteria 1100927
186 Ga0209564_1000084 3300025295 Bacteria 252729
187 Ga0209564_1000161 3300025295 Bacteria 162489
188 Ga0209564_1000220 3300025295 Bacteria 129579
189 Ga0209564_1000327 3300025295 Bacteria 92740
190 Ga0209564_1001556 3300025295 Bacteria 22580
191 Ga0209758_1000199 3300025297 Bacteria 133164
192 Ga0209758_1008905 3300025297 Bacteria 6369
193 Ga0209050_1000072 3300025298 Bacteria 293619
194 Ga0209050_1000133 3300025298 Bacteria 184688
195 Ga0209050_1000478 3300025298 Bacteria 70631
196 Ga0209050_1003977 3300025298 Bacteria 10426
197 Ga0209050_1013309 3300025298 Bacteria 3666
198 Ga0209050_1025015 3300025298 Bacteria 2044
199 Ga0209256_1000024 3300025299 Bacteria 448909
200 Ga0209256_1000117 3300025299 Bacteria 169435
201 Ga0209256_1000206 3300025299 Bacteria 111425
202 Ga0209256_1000602 3300025299 Bacteria 49884
203 Ga0209256_1001890 3300025299 Bacteria 19210
204 Ga0207426_1000049 3300025302 Bacteria 401954
205 Ga0207426_1000166 3300025302 Bacteria 169435
206 Ga0207426_1005743 3300025302 Bacteria 5588
207 Ga0209051_1000015 3300025303 Bacteria 546798
208 Ga0209051_1000063 3300025303 Bacteria 249739
209 Ga0209051_1000255 3300025303 Bacteria 89418
210 Ga0209051_1000440 3300025303 Bacteria 56410
211 Ga0209051_1006243 3300025303 Bacteria 6757
212 Ga0209051_1010689 3300025303 Bacteria 4603
213 Ga0209051_1016101 3300025303 Bacteria 3408
214 Ga0209051_1018820 3300025303 Bacteria 3041
215 Ga0209257_1000037 3300025304 Bacteria 612915
216 Ga0209257_1000118 3300025304 Bacteria 225963
217 Ga0209257_1003603 3300025304 Bacteria 13054
218 Ga0209257_1006169 3300025304 Bacteria 7903
219 Ga0207656_10047471 3300025321 Bacteria 1846
220 Ga0207655_1000689 3300025728 Bacteria 39302
221 Ga0207713_1003535 3300025735 Bacteria 10585
222 Ga0207713_1036865 3300025735 Bacteria 2092
223 Ga0207647_10052444 3300025904 Bacteria 2518
224 Ga0207705_10000223 3300025909 Bacteria 56633
225 Ga0207654_10035446 3300025911 Bacteria 2780
226 Ga0207695_10002329 3300025913 Bacteria 28298
227 Ga0207695_10003770 3300025913 Bacteria 21033
228 Ga0207695_10063866 3300025913 Bacteria 3793
229 Ga0207695_10083955 3300025913 Bacteria 3216
230 Ga0207671_10002331 3300025914 Bacteria 20489
231 Ga0207671_10156929 3300025914 Bacteria 1760
232 Ga0207657_10026304 3300025919 Bacteria 5349
233 Ga0207657_10200028 3300025919 Bacteria 1608
234 Ga0207694_10001397 3300025924 Bacteria 20729
235 Ga0207694_10045712 3300025924 Bacteria 3382
236 Ga0207650_10004198 3300025925 Bacteria 9841
237 Ga0207690_10352918 3300025932 Bacteria 1163
238 Ga0207706_10063890 3300025933 Bacteria 3241
239 Ga0207706_10093265 3300025933 Bacteria 2648
240 Ga0207706_10163822 3300025933 Bacteria 1954
241 Ga0207686_10000746 3300025934 Bacteria 20059
242 Ga0207709_10001078 3300025935 Bacteria 20070
243 Ga0207709_10003894 3300025935 Bacteria 8725
244 Ga0207709_10008677 3300025935 Bacteria 5608
245 Ga0207704_10214941 3300025938 Bacteria 1418
246 Ga0207711_10329710 3300025941 Bacteria 1411
247 Ga0207679_10008799 3300025945 Bacteria 6437
248 Ga0207679_10084716 3300025945 Bacteria 2433
249 Ga0207667_10013354 3300025949 Bacteria 9401
250 Ga0207667_10032546 3300025949 Bacteria 5617
251 Ga0207651_10162383 3300025960 Bacteria 1753
252 Ga0207640_10044059 3300025981 Bacteria 2856
253 Ga0207639_10401445 3300026041 Bacteria 1235
254 Ga0207678_10064508 3300026067 Bacteria 3147
255 Ga0207702_10048467 3300026078 Bacteria 3583
256 Ga0207674_10034062 3300026116 Bacteria 5327
257 Ga0207674_10101251 3300026116 Bacteria 2862
258 Ga0207683_10302047 3300026121 Bacteria 1464
259 Ga0207683_10431174 3300026121 Bacteria 1215
260 Ga0207698_10113843 3300026142 Bacteria 2274
261 Ga0207698_10287080 3300026142 Bacteria 1525
262 Ga0209281_1000160 3300027111 Bacteria 161071
263 Ga0209282_1000113 3300027666 Bacteria 52714
264 Ga0268265_10089327 3300028380 Bacteria 2457
265 Ga0307515_10000215 3300028794 Bacteria 142594
266 Ga0307515_10000267 3300028794 Bacteria 128554
267 Ga0265338_10000045 3300028800 Bacteria 223264
268 Ga0265338_10001261 3300028800 Bacteria 41728
269 Ga0265331_10000850 3300031250 Bacteria 24826
270 Ga0265327_10001272 3300031251 Bacteria 33201
271 Ga0265327_10007497 3300031251 Bacteria 8411
272 Ga0307513_10014657 3300031456 Bacteria 9544
273 Ga0307514_10000806 3300031649 Bacteria 51095
274 Ga0307405_10058007 3300031731 Bacteria 2434
275 Ga0307405_10058723 3300031731 Bacteria 2422
276 Ga0307412_10000120 3300031911 Bacteria 59537
277 Ga0307412_10081052 3300031911 Bacteria 2243
278 Ga0307416_100207257 3300032002 Bacteria 1866
279 Ga0307416_100298625 3300032002 Bacteria 1599
280 Ga0307416_100315814 3300032002 Bacteria 1562
281 Ga0307510_10000462 3300033180 Bacteria 39513
282 Ga0395899_0001188 3300037312 Bacteria 22947
283 Ga0395899_0075159 3300037312 Bacteria 2467
284 Ga0395900_0000497 3300037418 Bacteria 55302
285 Ga0395900_0027237 3300037418 Bacteria 5853
286 Ga0395900_0098421 3300037418 Bacteria 3005
287 Ga0395900_0203525 3300037418 Bacteria 2002
288 Ga0395900_0521185 3300037418 Bacteria 1136
289 Ga0395898_0005084 3300037466 Bacteria 14256
290 Ga0395898_0116731 3300037466 Bacteria 2557
291 Ga0395898_0120157 3300037466 Bacteria 2517
292 Ga0395898_0230158 3300037466 Bacteria 1768
293 Ga0395905_0006264 3300037471 Bacteria 12008
294 Ga0395905_0016771 3300037471 Bacteria 6961
295 Ga0395905_0054981 3300037471 Bacteria 3725
296 Ga0395905_0087515 3300037471 Bacteria 2920
297 Ga0395901_0016576 3300038443 Bacteria 7508
298 Ga0436361_0082685 3300039447 Bacteria 7552
299 Ga0436361_0442878 3300039447 Bacteria 7602
300 Ga0436361_0493011 3300039447 Bacteria 8828
301 Ga0436361_0943694 3300039447 Bacteria 119574
302 Ga0436361_1133215 3300039447 Bacteria 77136
303 Ga0436361_1136892 3300039447 Bacteria 5983
304 Ga0451841_1002159 3300041498 Bacteria 1227
305 Ga0450911_000086 3300042115 Bacteria 37180
306 Ga0450923_021396 3300042125 Bacteria 1261
307 Ga0450898_009738 3300042134 Bacteria 1542
308 Ga0450918_000093 3300042531 Bacteria 18997
309 Ga0466969_0040944 3300044656 Bacteria 2320
310 Ga0466972_0057401 3300044658 Bacteria 1870
311 Ga0466965_0011432 3300044683 Bacteria 4160
312 Ga0466965_0020839 3300044683 Bacteria 3154
313 Ga0466965_0034922 3300044683 Bacteria 2462
314 Ga0466966_0160128 3300044684 Bacteria 1370
315 Ga0466961_0035934 3300044693 Bacteria 3181
316 Ga0466968_0020072 3300044735 Bacteria 2694
317 Ga0466970_0060533 3300044765 Bacteria 2028
318 Ga0466957_0000005 3300044842 Bacteria 102026
319 Ga0466958_0017206 3300045836 Bacteria 4175
320 Ga0495617_000001 3300046452 Bacteria 877032
321 Ga0495617_000061 3300046452 Bacteria 96850
322 Ga0495617_002891 3300046452 Bacteria 6608
323 Ga0495627_000026 3300046453 Bacteria 238494
324 Ga0495627_000065 3300046453 Bacteria 132414
325 Ga0495603_0001852 3300046455 Bacteria 12474
326 Ga0495590_0000023 3300046457 Bacteria 196939
327 Ga0495590_0000083 3300046457 Bacteria 62385
328 Ga0495590_0001408 3300046457 Bacteria 10437
329 Ga0495590_0003678 3300046457 Bacteria 6243
330 Ga0495590_0034983 3300046457 Bacteria 1754
331 Ga0495591_000038 3300046458 Bacteria 157347
332 Ga0495629_0000088 3300046459 Bacteria 80848
333 Ga0495629_0037348 3300046459 Bacteria 3424
334 Ga0495638_0000067 3300046460 Bacteria 167869
335 Ga0495638_0062390 3300046460 Bacteria 2301
336 Ga0495651_0113752 3300046462 Bacteria 1997
337 Ga0495653_0000018 3300046463 Bacteria 185787
338 Ga0495653_0001244 3300046463 Bacteria 19708
339 Ga0495650_0001305 3300046471 Bacteria 25286
340 Ga0495650_0002073 3300046471 Bacteria 17371
341 Ga0495650_0002855 3300046471 Bacteria 13213
342 Ga0495650_0008218 3300046471 Bacteria 6129
343 Ga0495650_0011102 3300046471 Bacteria 4965
344 Ga0495580_0000056 3300046472 Bacteria 64894
345 Ga0495580_0010163 3300046472 Bacteria 7350
346 Ga0495582_0066393 3300046473 Bacteria 1993
347 Ga0495605_0000004 3300046474 Bacteria 395282
348 Ga0495605_0000005 3300046474 Bacteria 376973
349 Ga0495605_0000262 3300046474 Bacteria 61506
350 Ga0495605_0007936 3300046474 Bacteria 6011
351 Ga0495605_0016154 3300046474 Bacteria 4044
352 Ga0495605_0018303 3300046474 Bacteria 3757
353 Ga0495605_0061276 3300046474 Bacteria 1801
354 Ga0495605_0077002 3300046474 Bacteria 1565
355 Ga0495639_0027630 3300046475 Bacteria 2512
356 Ga0495584_0000075 3300046491 Bacteria 70256
357 Ga0495584_0000234 3300046491 Bacteria 39911
358 Ga0495584_0012819 3300046491 Bacteria 4277
359 Ga0495584_0020139 3300046491 Bacteria 3390
360 Ga0495584_0053300 3300046491 Bacteria 2036
361 Ga0495584_0073824 3300046491 Bacteria 1714
362 Ga0495584_0092552 3300046491 Bacteria 1525
363 Ga0495585_0000521 3300046492 Bacteria 36396
364 Ga0495585_0002143 3300046492 Bacteria 14401
365 Ga0495585_0063822 3300046492 Bacteria 2020
366 Ga0495585_0102178 3300046492 Bacteria 1532
367 Ga0495596_0000353 3300046500 Bacteria 29811
368 Ga0495596_0001540 3300046500 Bacteria 13166
369 Ga0495596_0001910 3300046500 Bacteria 11567
370 Ga0495596_0006189 3300046500 Bacteria 5542
371 Ga0495596_0006673 3300046500 Bacteria 5285
372 Ga0495596_0008428 3300046500 Bacteria 4588
373 Ga0495596_0018767 3300046500 Bacteria 2849
374 Ga0495607_0000272 3300046501 Bacteria 55661
375 Ga0495607_0001693 3300046501 Bacteria 18970
376 Ga0495607_0001836 3300046501 Bacteria 18090
377 Ga0495607_0002147 3300046501 Bacteria 16454
378 Ga0495607_0002797 3300046501 Bacteria 13878
379 Ga0495607_0009775 3300046501 Bacteria 6474
380 Ga0495607_0016406 3300046501 Bacteria 4779
381 Ga0495583_0000134 3300046506 Bacteria 124077
382 Ga0495583_0000162 3300046506 Bacteria 112598
383 Ga0495583_0000345 3300046506 Bacteria 73236
384 Ga0495583_0001117 3300046506 Bacteria 29592
385 Ga0495583_0004563 3300046506 Bacteria 9848
386 Ga0495583_0008005 3300046506 Bacteria 6532
387 Ga0495583_0012287 3300046506 Bacteria 4858
388 Ga0495583_0028120 3300046506 Bacteria 2768
389 Ga0495583_0074465 3300046506 Bacteria 1486
390 Ga0495583_0114397 3300046506 Bacteria 1141
391 Ga0495606_0000755 3300046507 Bacteria 49730
392 Ga0495606_0004822 3300046507 Bacteria 13249
393 Ga0495606_0010046 3300046507 Bacteria 7910
394 Ga0495606_0030185 3300046507 Bacteria 3790
395 Ga0495610_0000021 3300046512 Bacteria 336300
396 Ga0495610_0004953 3300046512 Bacteria 9651
397 Ga0495610_0006834 3300046512 Bacteria 7735
398 Ga0495610_0010610 3300046512 Bacteria 5710
399 Ga0495610_0018789 3300046512 Bacteria 3888
400 Ga0495610_0059988 3300046512 Bacteria 1813
401 Ga0495616_0000796 3300046513 Bacteria 23096
402 Ga0495616_0001609 3300046513 Bacteria 15477
403 Ga0495616_0002314 3300046513 Bacteria 12736
404 Ga0495616_0009081 3300046513 Bacteria 5832
405 Ga0495616_0012282 3300046513 Bacteria 4867
406 Ga0495616_0020294 3300046513 Bacteria 3618
407 Ga0495616_0045258 3300046513 Bacteria 2228
408 Ga0495620_0071760 3300046515 Bacteria 1415
409 Ga0495628_0020955 3300046516 Bacteria 5384
410 Ga0495628_0032728 3300046516 Bacteria 4195
411 Ga0495630_0014034 3300046517 Bacteria 5829
412 Ga0495631_0000007 3300046518 Bacteria 130158
413 Ga0495631_0000438 3300046518 Bacteria 28481
414 Ga0495631_0000980 3300046518 Bacteria 17729
415 Ga0495631_0001103 3300046518 Bacteria 16750
416 Ga0495631_0009591 3300046518 Bacteria 4829
417 Ga0495631_0010803 3300046518 Bacteria 4511
418 Ga0495631_0026006 3300046518 Bacteria 2691
419 Ga0495631_0033643 3300046518 Bacteria 2301
420 Ga0495631_0066757 3300046518 Bacteria 1556
421 Ga0495632_0000024 3300046519 Bacteria 179517
422 Ga0495632_0000028 3300046519 Bacteria 171089
423 Ga0495632_0000043 3300046519 Bacteria 143694
424 Ga0495632_0001594 3300046519 Bacteria 18701
425 Ga0495632_0002005 3300046519 Bacteria 16078
426 Ga0495632_0012261 3300046519 Bacteria 4948
427 Ga0495637_0000002 3300046520 Bacteria 629280
428 Ga0495637_0000456 3300046520 Bacteria 29812
429 Ga0495637_0001478 3300046520 Bacteria 13799
430 Ga0495637_0003770 3300046520 Bacteria 7989
431 Ga0495637_0038480 3300046520 Bacteria 2071
432 Ga0495637_0048937 3300046520 Bacteria 1778
433 Ga0495643_0000138 3300046522 Bacteria 117580
434 Ga0495643_0000829 3300046522 Bacteria 33683
435 Ga0495643_0001229 3300046522 Bacteria 24725
436 Ga0495643_0002875 3300046522 Bacteria 13073
437 Ga0495643_0008722 3300046522 Bacteria 6392
438 Ga0495643_0009176 3300046522 Bacteria 6173
439 Ga0495643_0021681 3300046522 Bacteria 3680
440 Ga0495643_0089697 3300046522 Bacteria 1587
441 Ga0495644_0002155 3300046523 Bacteria 7899
442 Ga0495644_0005637 3300046523 Bacteria 4882
443 Ga0495644_0012939 3300046523 Bacteria 3208
444 Ga0495648_0000008 3300046524 Bacteria 336584
445 Ga0495648_0000022 3300046524 Bacteria 242791
446 Ga0495648_0010741 3300046524 Bacteria 6952
447 Ga0495648_0012248 3300046524 Bacteria 6407
448 Ga0495648_0041114 3300046524 Bacteria 2923
449 Ga0495666_0003483 3300046526 Bacteria 7942
450 Ga0495642_0000001 3300046528 Bacteria 389656
451 Ga0495642_0000041 3300046528 Bacteria 76279
452 Ga0495642_0000124 3300046528 Bacteria 44239
453 Ga0495642_0003464 3300046528 Bacteria 6214
454 Ga0495642_0007249 3300046528 Bacteria 4257
455 Ga0495642_0008755 3300046528 Bacteria 3866
456 Ga0495642_0019716 3300046528 Bacteria 2644
457 Ga0495652_0019824 3300046529 Bacteria 5984
458 Ga0495654_0000005 3300046530 Bacteria 491381
459 Ga0495654_0004648 3300046530 Bacteria 8099
460 Ga0495654_0009589 3300046530 Bacteria 5303
461 Ga0495654_0009711 3300046530 Bacteria 5267
462 Ga0495654_0013403 3300046530 Bacteria 4388
463 Ga0495654_0029866 3300046530 Bacteria 2778
464 Ga0495586_0079556 3300046535 Bacteria 1800
465 Ga0495586_0187961 3300046535 Bacteria 1170
466 Ga0495587_0030350 3300046536 Bacteria 3279
467 Ga0495609_0000001 3300046538 Bacteria 1060094
468 Ga0495609_0000883 3300046538 Bacteria 21964
469 Ga0495609_0004066 3300046538 Bacteria 8149
470 Ga0495609_0005357 3300046538 Bacteria 6768
471 Ga0495609_0005788 3300046538 Bacteria 6422
472 Ga0495609_0018521 3300046538 Bacteria 3226
473 Ga0495609_0032516 3300046538 Bacteria 2369
474 Ga0495597_0000070 3300046542 Bacteria 89649
475 Ga0495597_0000189 3300046542 Bacteria 55865
476 Ga0495597_0002006 3300046542 Bacteria 13648
477 Ga0495597_0002593 3300046542 Bacteria 11296
478 Ga0495597_0003217 3300046542 Bacteria 9714
479 Ga0495597_0004354 3300046542 Bacteria 7805
480 Ga0495645_0000452 3300046543 Bacteria 28201
481 Ga0495622_0000407 3300046557 Bacteria 28827
482 Ga0495622_0039060 3300046557 Bacteria 2210
483 Ga0495633_0000075 3300046558 Bacteria 130139
484 Ga0495633_0001372 3300046558 Bacteria 19021
485 Ga0495633_0001858 3300046558 Bacteria 15505
486 Ga0495633_0005278 3300046558 Bacteria 7951
487 Ga0495656_0000306 3300046615 Bacteria 16984
488 Ga0495656_0007265 3300046615 Bacteria 3909
489 Ga0495656_0010496 3300046615 Bacteria 3370
490 Ga0495656_0098344 3300046615 Bacteria 1349
491 Ga0495668_0000036 3300046616 Bacteria 235057
492 Ga0495668_0000280 3300046616 Bacteria 70339
493 Ga0495668_0000304 3300046616 Bacteria 67905
494 Ga0495668_0004592 3300046616 Bacteria 9712
495 Ga0495668_0005909 3300046616 Bacteria 8143
496 Ga0495668_0010138 3300046616 Bacteria 5730
497 Ga0495668_0014693 3300046616 Bacteria 4585
498 Ga0495668_0070733 3300046616 Bacteria 1918
499 Ga0495668_0173282 3300046616 Bacteria 1182
500 Ga0495611_0000191 3300046648 Bacteria 43883
501 Ga0495611_0003995 3300046648 Bacteria 6420
502 Ga0495611_0016700 3300046648 Bacteria 3137
503 Ga0495611_0038144 3300046648 Bacteria 2136
504 Ga0495625_0008242 3300046660 Bacteria 8913
505 Ga0495625_0009663 3300046660 Bacteria 8040
506 Ga0495625_0010510 3300046660 Bacteria 7648
507 Ga0495625_0013764 3300046660 Bacteria 6485
508 Ga0495625_0022425 3300046660 Bacteria 4842
509 Ga0495625_0132954 3300046660 Bacteria 1684
510 Ga0495661_0000040 3300046665 Bacteria 151437
511 Ga0495661_0000063 3300046665 Bacteria 129706
512 Ga0495661_0000728 3300046665 Bacteria 32238
513 Ga0495661_0001045 3300046665 Bacteria 24545
514 Ga0495661_0001664 3300046665 Bacteria 18107
515 Ga0495661_0002785 3300046665 Bacteria 13245
516 Ga0495661_0009113 3300046665 Bacteria 6824
517 Ga0495661_0017937 3300046665 Bacteria 4665
518 Ga0495661_0027647 3300046665 Bacteria 3638
519 Ga0495661_0029380 3300046665 Bacteria 3509
520 Ga0495661_0040087 3300046665 Bacteria 2907
521 Ga0495661_0049022 3300046665 Bacteria 2563
522 Ga0495661_0124766 3300046665 Bacteria 1418
523 Ga0495588_0000052 3300046674 Bacteria 304493
524 Ga0495588_0058293 3300046674 Bacteria 1996
525 Ga0495588_0164185 3300046674 Bacteria 1174
526 Ga0495599_0013941 3300046678 Bacteria 4975
527 Ga0495646_0072232 3300046680 Bacteria 2029
528 Ga0495669_0000013 3300046684 Bacteria 151423
529 Ga0495669_0000818 3300046684 Bacteria 13241
530 Ga0495669_0000834 3300046684 Bacteria 13127
531 Ga0495669_0018538 3300046684 Bacteria 2993
532 Ga0495669_0056936 3300046684 Bacteria 1763
533 Ga0495613_0014673 3300046689 Bacteria 5813
534 Ga0495624_0001726 3300046690 Bacteria 16713
535 Ga0495670_0000052 3300046691 Bacteria 63490
536 Ga0495670_0060542 3300046691 Bacteria 1902
537 Ga0495671_0000024 3300046692 Bacteria 246812
538 Ga0495671_0000313 3300046692 Bacteria 41127
539 Ga0495671_0009433 3300046692 Bacteria 5449
540 Ga0495671_0026510 3300046692 Bacteria 3004
541 Ga0495649_0000085 3300046694 Bacteria 80698
542 Ga0495649_0000880 3300046694 Bacteria 24063
543 Ga0495649_0084399 3300046694 Bacteria 1696
544 Ga0495589_0000015 3300046794 Bacteria 224112
545 Ga0495589_0000116 3300046794 Bacteria 75640
546 Ga0495589_0000227 3300046794 Bacteria 47488
547 Ga0495589_0005507 3300046794 Bacteria 6676
548 Ga0495589_0019142 3300046794 Bacteria 3512
549 Ga0495589_0045557 3300046794 Bacteria 2179
550 Ga0495589_0103993 3300046794 Bacteria 1372
551 Ga0495600_0046096 3300046809 Bacteria 2845
552 Ga0495600_0063140 3300046809 Bacteria 2420
553 Ga0495660_0000145 3300046810 Bacteria 76912
554 Ga0495660_0004796 3300046810 Bacteria 8159
555 Ga0495660_0008371 3300046810 Bacteria 6048
556 Ga0495660_0011186 3300046810 Bacteria 5209
557 Ga0495660_0011577 3300046810 Bacteria 5116
558 Ga0495660_0091016 3300046810 Bacteria 1585
559 Ga0495604_0001690 3300047317 Bacteria 18145
560 Ga0495604_0021007 3300047317 Bacteria 5209
561 Ga0495636_0001565 3300047318 Bacteria 8705
562 Ga0495636_0016350 3300047318 Bacteria 2963
563 Ga0495672_0000065 3300047320 Bacteria 193941
564 Ga0495672_0002150 3300047320 Bacteria 18425
565 Ga0495672_0015756 3300047320 Bacteria 5119
566 Ga0495672_0036059 3300047320 Bacteria 3040
567 Ga0495672_0037417 3300047320 Bacteria 2969
568 Ga0495672_0040205 3300047320 Bacteria 2838
569 Ga0495672_0040711 3300047320 Bacteria 2815
570 Ga0495672_0043617 3300047320 Bacteria 2696
571 Ga0495672_0117484 3300047320 Bacteria 1419
572 Ga0495676_0000029 3300047321 Bacteria 140281
573 Ga0495680_0043744 3300047322 Bacteria 3544
574 Ga0495683_0000012 3300047323 Bacteria 205754
575 Ga0495683_0005453 3300047323 Bacteria 7057
576 Ga0495683_0005694 3300047323 Bacteria 6883
577 Ga0495683_0006362 3300047323 Bacteria 6453
578 Ga0495683_0020718 3300047323 Bacteria 3390
579 Ga0495683_0071817 3300047323 Bacteria 1698
580 Ga0495687_000002 3300047443 Bacteria 1085770
581 Ga0495687_000003 3300047443 Bacteria 859509
582 Ga0495687_000007 3300047443 Bacteria 552679
583 Ga0495687_000073 3300047443 Bacteria 155429
584 Ga0495687_000445 3300047443 Bacteria 51086
585 Ga0495687_000635 3300047443 Bacteria 40213
586 Ga0495687_000827 3300047443 Bacteria 33123
587 Ga0495687_003439 3300047443 Bacteria 11479
588 Ga0495675_0018177 3300047444 Bacteria 4460
589 Ga0495677_0000001 3300047445 Bacteria 715000
590 Ga0495677_0000847 3300047445 Bacteria 12366
591 Ga0495677_0001330 3300047445 Bacteria 9898
592 Ga0495677_0003291 3300047445 Bacteria 6298
593 Ga0495677_0006184 3300047445 Bacteria 4523
594 Ga0495677_0008510 3300047445 Bacteria 3808
595 Ga0495677_0054801 3300047445 Bacteria 1471
596 Ga0495679_004825 3300047446 Bacteria 6095
597 Ga0495679_016919 3300047446 Bacteria 2623
598 Ga0495685_002660 3300047447 Bacteria 5631
599 Ga0495673_0000033 3300047469 Bacteria 354152
600 Ga0495673_0000034 3300047469 Bacteria 326920
601 Ga0495673_0000120 3300047469 Bacteria 144972
602 Ga0495673_0013175 3300047469 Bacteria 4353
603 Ga0495673_0019688 3300047469 Bacteria 3378
604 Ga0495681_0000005 3300047470 Bacteria 225279
605 Ga0495681_0001808 3300047470 Bacteria 15724
606 Ga0495681_0024100 3300047470 Bacteria 3216
607 Ga0495681_0050794 3300047470 Bacteria 1952
608 Ga0495686_0000021 3300047472 Bacteria 426560
609 Ga0495686_0000051 3300047472 Bacteria 263489
610 Ga0495686_0022171 3300047472 Bacteria 4204
611 Ga0495593_0002192 3300047673 Bacteria 11687
612 Ga0495593_0019591 3300047673 Bacteria 3793
613 Ga0495602_0002837 3300048088 Bacteria 17751
614 Ga0495614_0059770 3300048089 Bacteria 1637
615 Ga0495626_0000020 3300048091 Bacteria 222537
616 Ga0495626_0000128 3300048091 Bacteria 96772
617 Ga0495626_0000171 3300048091 Bacteria 80200
618 Ga0495626_0002911 3300048091 Bacteria 11403
619 Ga0495626_0003919 3300048091 Bacteria 9322
620 Ga0495626_0006950 3300048091 Bacteria 6370
621 Ga0495626_0012053 3300048091 Bacteria 4548
622 Ga0495626_0027661 3300048091 Bacteria 2755
623 Ga0495626_0032073 3300048091 Bacteria 2525
624 Ga0495626_0053463 3300048091 Bacteria 1858
625 Ga0495626_0090632 3300048091 Bacteria 1344
626 Ga0496100_0072005 3300048903 Bacteria 2309
627 Ga0496101_0003169 3300048904 Bacteria 10187
628 Ga0496101_0061325 3300048904 Bacteria 2731
629 Ga0496101_0109160 3300048904 Bacteria 2081
630 Ga0496101_0174772 3300048904 Bacteria 1651
631 Ga0496102_0000033 3300048905 Bacteria 213952
632 Ga0496102_0111792 3300048905 Bacteria 2547
633 Ga0496102_0136988 3300048905 Bacteria 2294
634 Ga0496102_0262564 3300048905 Bacteria 1628
635 Ga0496103_0001739 3300048906 Bacteria 14221
636 Ga0496103_0004666 3300048906 Bacteria 8299
637 Ga0496103_0111529 3300048906 Bacteria 1738
638 Ga0496104_0015936 3300048907 Bacteria 6821
639 Ga0496104_0158567 3300048907 Bacteria 2171
640 Ga0496105_0000920 3300048908 Bacteria 20080
641 Ga0496105_0031194 3300048908 Bacteria 4369
642 Ga0496105_0119419 3300048908 Bacteria 2174
643 Ga0496106_0000032 3300048909 Bacteria 134707
644 Ga0496106_0036283 3300048909 Bacteria 3688
645 Ga0496109_0008922 3300048912 Bacteria 8542
646 Ga0496110_0000007 3300048913 Bacteria 114271
647 Ga0496110_0008599 3300048913 Bacteria 8221
648 Ga0496110_0021223 3300048913 Bacteria 5494
649 Ga0496110_0039713 3300048913 Bacteria 4098
650 Ga0496111_0001836 3300048914 Bacteria 12505
651 Ga0496111_0042384 3300048914 Bacteria 3268
652 Ga0496111_0092460 3300048914 Bacteria 2217
653 Ga0496112_0016434 3300048915 Bacteria 6933
654 Ga0496113_0007095 3300048916 Bacteria 7173
655 Ga0496114_0003502 3300048917 Bacteria 12046
656 Ga0496116_0003171 3300048919 Bacteria 16474
657 Ga0496116_0030930 3300048919 Bacteria 3840
658 Ga0496116_0053964 3300048919 Bacteria 2651
659 Ga0496116_0056363 3300048919 Bacteria 2576
660 Ga0496116_0147132 3300048919 Bacteria 1315
661 Ga0496116_0147324 3300048919 Bacteria 1314
662 Ga0496116_0153613 3300048919 Bacteria 1274
663 Ga0496117_0000392 3300048920 Bacteria 74904
664 Ga0496117_0051388 3300048920 Bacteria 2914
665 Ga0496117_0062360 3300048920 Bacteria 2555
666 Ga0496117_0143230 3300048920 Bacteria 1428
667 Ga0496118_0003657 3300048921 Bacteria 19098
668 Ga0496118_0007943 3300048921 Bacteria 11101
669 Ga0496118_0054990 3300048921 Bacteria 3009
670 Ga0496118_0068631 3300048921 Bacteria 2573
671 Ga0496121_0000672 3300048924 Bacteria 63750
672 Ga0496121_0001111 3300048924 Bacteria 47443
673 Ga0496121_0011238 3300048924 Bacteria 9977
674 Ga0496121_0076246 3300048924 Bacteria 2674
675 Ga0496121_0076744 3300048924 Bacteria 2663
676 Ga0496121_0086377 3300048924 Bacteria 2465
677 Ga0496122_0000146 3300048925 Bacteria 165614
678 Ga0496122_0000279 3300048925 Bacteria 114185
679 Ga0496122_0000878 3300048925 Bacteria 56301
680 Ga0496122_0001985 3300048925 Bacteria 30535
681 Ga0496122_0018858 3300048925 Bacteria 6341
682 Ga0496122_0044505 3300048925 Bacteria 3462
683 Ga0496122_0054311 3300048925 Bacteria 3010
684 Ga0496122_0093168 3300048925 Bacteria 2044
685 Ga0496123_0000108 3300048926 Bacteria 166102
686 Ga0496123_0000146 3300048926 Bacteria 143990
687 Ga0496123_0000894 3300048926 Bacteria 47171
688 Ga0496123_0003057 3300048926 Bacteria 19234
689 Ga0496123_0010920 3300048926 Bacteria 7948
690 Ga0496123_0020872 3300048926 Bacteria 5108
691 Ga0496123_0028479 3300048926 Bacteria 4134
692 Ga0496124_0000435 3300048927 Bacteria 74150
693 Ga0496124_0039254 3300048927 Bacteria 4105
694 Ga0496124_0063624 3300048927 Bacteria 3081
695 Ga0496124_0100630 3300048927 Bacteria 2342
696 Ga0496124_0105241 3300048927 Bacteria 2280
697 Ga0496125_0000168 3300048928 Bacteria 146364
698 Ga0496125_0000938 3300048928 Bacteria 45852
699 Ga0496125_0002050 3300048928 Bacteria 27214
700 Ga0496125_0008706 3300048928 Bacteria 10560
701 Ga0496125_0012148 3300048928 Bacteria 8567
702 Ga0496125_0027872 3300048928 Bacteria 5111
703 Ga0496125_0119617 3300048928 Bacteria 1883
704 Ga0496126_0000421 3300048929 Bacteria 85210
705 Ga0496126_0000426 3300048929 Bacteria 84838
706 Ga0496126_0000915 3300048929 Bacteria 51060
707 Ga0496126_0011309 3300048929 Bacteria 9257
708 Ga0496126_0019373 3300048929 Bacteria 6702
709 Ga0496126_0023069 3300048929 Bacteria 6033
710 Ga0496126_0028380 3300048929 Bacteria 5335
711 Ga0496126_0135288 3300048929 Bacteria 2126
712 Ga0496126_0194142 3300048929 Bacteria 1718
713 Ga0495678_000001 3300049459 Bacteria 1060340
714 Ga0495678_000015 3300049459 Bacteria 309544
715 Ga0495678_000022 3300049459 Bacteria 237031
716 Ga0495678_000229 3300049459 Bacteria 64743
717 Ga0495678_002011 3300049459 Bacteria 14589
718 Ga0495678_004103 3300049459 Bacteria 8631
719 Ga0495678_005612 3300049459 Bacteria 6865
720 Ga0495678_009379 3300049459 Bacteria 4847
721 Ga0501034_0000129 3300049571 Bacteria 139927
722 Ga0501222_008685 3300049662 Bacteria 1347
723 Ga0501044_0013906 3300049823 Bacteria 8696
724 nmdc:mga00v17_11321_c1 3300050491 Bacteria 4903
725 nmdc:mga00v17_22831_c1 3300050491 Bacteria 3615
726 nmdc:mga07m45_13078_c1 3300050496 Bacteria 4394
727 Ga0500610_0020896 3300053079 Bacteria 3203
728 Ga0500643_016204 3300053087 Bacteria 2531
729 Ga0500651_0000305 3300053093 Bacteria 28418
730 Ga0500571_004833 3300053110 Bacteria 7132
731 Ga0500592_003231 3300053116 Bacteria 2600
732 Ga0500593_027001 3300053117 Bacteria 2560
733 Ga0500594_0002897 3300053118 Bacteria 3742
734 Ga0500607_000744 3300053121 Bacteria 31300
735 Ga0500608_027954 3300053122 Bacteria 2660
736 Ga0500618_000601 3300053125 Bacteria 22092
737 Ga0500618_001391 3300053125 Bacteria 10903
738 Ga0500618_003518 3300053125 Bacteria 5335
739 Ga0500618_005834 3300053125 Bacteria 3694
740 Ga0500559_0004612 3300053136 Bacteria 6510
741 Ga0500568_0000934 3300053139 Bacteria 20169
742 Ga0500586_000583 3300053145 Bacteria 7424
743 Ga0500616_0028639 3300053153 Bacteria 3068
744 Ga0500627_0000537 3300053158 Bacteria 10255

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0000005 Ga0495605_0000005_251004_251999 309
2 3300046507 Ga0495606_0004822 Ga0495606_0004822_5158_6171 313
3 iso_pu_bacteria 2818991467 2819717590 315
4 3300003322 rootL2_10056250 rootL2_100562504 316
5 3300025233 Ga0209437_109925 Ga0209437_1099252 316
6 3300025272 Ga0209455_1000063 Ga0209455_1000063105 316
7 3300053125 Ga0500618_000601 Ga0500618_000601_5732_6730 317
8 3300003187 JGI25151J46595_10000356 JGI25151J46595_1000035625 318
9 3300025294 Ga0209025_1000198 Ga0209025_100019882 318
10 3300046691 Ga0495670_0060542 Ga0495670_0060542_225_1232 318
11 3300025292 Ga0209676_1006414 Ga0209676_10064144 319
12 3300025298 Ga0209050_1013309 Ga0209050_10133093 319
13 3300046512 Ga0495610_0006834 Ga0495610_0006834_3079_4086 319
14 3300048919 Ga0496116_0030930 Ga0496116_0030930_1489_2532 319
15 3300048925 Ga0496122_0000878 Ga0496122_0000878_43714_44814 319
16 3300048926 Ga0496123_0003057 Ga0496123_0003057_6768_7868 319
17 3300048926 Ga0496123_0028479 Ga0496123_0028479_1986_2948 319
18 3300048928 Ga0496125_0012148 Ga0496125_0012148_1220_2338 319
19 3300048929 Ga0496126_0135288 Ga0496126_0135288_784_1884 319
20 3300047320 Ga0495672_0040205 Ga0495672_0040205_529_1548 321
21 3300048927 Ga0496124_0000435 Ga0496124_0000435_38036_39025 321
22 3300046522 Ga0495643_0021681 Ga0495643_0021681_1201_2217 322
23 3300049823 Ga0501044_0013906 Ga0501044_0013906_3720_4763 322
24 3300053125 Ga0500618_003518 Ga0500618_003518_2709_3686 322
25 3300009011 Ga0105251_10000335 Ga0105251_1000033541 323
26 3300025302 Ga0207426_1005743 Ga0207426_10057431 323
27 3300025735 Ga0207713_1003535 Ga0207713_10035358 323
28 3300025913 Ga0207695_10083955 Ga0207695_100839552 323
29 3300026121 Ga0207683_10431174 Ga0207683_104311741 323
30 3300037471 Ga0395905_0006264 Ga0395905_0006264_7641_8651 323
31 3300046452 Ga0495617_002891 Ga0495617_002891_399_1406 323
32 3300046507 Ga0495606_0010046 Ga0495606_0010046_3237_4244 323
33 3300046512 Ga0495610_0010610 Ga0495610_0010610_2506_3513 323
34 3300046542 Ga0495597_0002593 Ga0495597_0002593_2203_3210 323
35 iso_pu_bacteria 2738541297 2738825804 323
36 iso_pu_bacteria 2738541357 2739149601 323
37 iso_pu_bacteria 2738543003 2739191520 323
38 iso_pu_bacteria 2738543026 2739317997 323
39 iso_pu_bacteria 2738543029 2739336238 323
40 iso_pu_bacteria 2857564685 2857566189 323
41 iso_pu_bacteria 2904434214 2904437886 324
42 3300048927 Ga0496124_0105241 Ga0496124_0105241_452_1474 325
43 iso_pu_bacteria 2857542790 2857543622 325
44 3300009545 Ga0105237_10139121 Ga0105237_101391212 326
45 3300009176 Ga0105242_10017049 Ga0105242_100170493 327
46 3300025934 Ga0207686_10000746 Ga0207686_1000074620 327
47 3300046452 Ga0495617_000061 Ga0495617_000061_37861_38856 327
48 3300046471 Ga0495650_0002073 Ga0495650_0002073_4973_5968 327
49 3300046512 Ga0495610_0000021 Ga0495610_0000021_229596_230591 327
50 3300046524 Ga0495648_0012248 Ga0495648_0012248_1801_2796 327
51 3300046530 Ga0495654_0009589 Ga0495654_0009589_619_1614 327
52 3300046616 Ga0495668_0005909 Ga0495668_0005909_3690_4685 327
53 3300046665 Ga0495661_0000040 Ga0495661_0000040_137576_138628 327
54 3300046692 Ga0495671_0000024 Ga0495671_0000024_101271_102266 327
55 3300047446 Ga0495679_016919 Ga0495679_016919_709_1704 327
56 3300047469 Ga0495673_0000033 Ga0495673_0000033_212033_213028 327
57 3300047469 Ga0495673_0000120 Ga0495673_0000120_37713_38708 327
58 3300048919 Ga0496116_0147324 Ga0496116_0147324_131_1186 327
59 iso_pu_bacteria 2513237150 2513954888 327
60 iso_pu_bacteria 2513237165 2514042842 327
61 iso_pu_bacteria 2857553236 2857554940 327
62 iso_pu_bacteria 2857558681 2857562369 327
63 iso_pu_bacteria 2904424332 2904429864 327
64 iso_pu_bacteria 644736347 644752002 327
65 3300046463 Ga0495653_0000018 Ga0495653_0000018_154308_155306 328
66 3300046471 Ga0495650_0002855 Ga0495650_0002855_4992_5990 328
67 3300046491 Ga0495584_0053300 Ga0495584_0053300_64_1071 328
68 3300046492 Ga0495585_0063822 Ga0495585_0063822_862_1869 328
69 3300046500 Ga0495596_0018767 Ga0495596_0018767_1098_2105 328
70 3300046501 Ga0495607_0016406 Ga0495607_0016406_1562_2569 328
71 3300046506 Ga0495583_0001117 Ga0495583_0001117_27044_28051 328
72 3300046513 Ga0495616_0009081 Ga0495616_0009081_4651_5658 328
73 3300046518 Ga0495631_0026006 Ga0495631_0026006_1509_2516 328
74 3300046519 Ga0495632_0001594 Ga0495632_0001594_1355_2362 328
75 3300046520 Ga0495637_0000456 Ga0495637_0000456_2700_3698 328
76 3300046523 Ga0495644_0002155 Ga0495644_0002155_3606_4613 328
77 3300046530 Ga0495654_0000005 Ga0495654_0000005_198287_199285 328
78 3300046648 Ga0495611_0003995 Ga0495611_0003995_3899_4906 328
79 3300046660 Ga0495625_0008242 Ga0495625_0008242_4749_5747 328
80 3300046810 Ga0495660_0011186 Ga0495660_0011186_1734_2741 328
81 3300047323 Ga0495683_0005453 Ga0495683_0005453_5545_6552 328
82 3300047445 Ga0495677_0003291 Ga0495677_0003291_1227_2234 328
83 3300047470 Ga0495681_0024100 Ga0495681_0024100_862_1869 328
84 3300048091 Ga0495626_0090632 Ga0495626_0090632_262_1269 328
85 3300048924 Ga0496121_0076744 Ga0496121_0076744_447_1445 328
86 3300048925 Ga0496122_0054311 Ga0496122_0054311_762_1760 328
87 3300048926 Ga0496123_0010920 Ga0496123_0010920_3254_4252 328
88 3300049459 Ga0495678_002011 Ga0495678_002011_5795_6802 328
89 iso_pu_bacteria 8047673197 8047674974 328
90 3300006051 Ga0075364_10024414 Ga0075364_100244144 329
91 3300013102 Ga0157371_10254747 Ga0157371_102547472 329
92 3300046471 Ga0495650_0011102 Ga0495650_0011102_1242_2255 329
93 3300046501 Ga0495607_0001836 Ga0495607_0001836_243_1256 329
94 3300046519 Ga0495632_0002005 Ga0495632_0002005_8829_9842 329
95 3300046538 Ga0495609_0000883 Ga0495609_0000883_2430_3443 329
96 3300046542 Ga0495597_0000070 Ga0495597_0000070_33522_34535 329
97 3300046665 Ga0495661_0000728 Ga0495661_0000728_9619_10632 329
98 3300047470 Ga0495681_0000005 Ga0495681_0000005_114823_115836 329
99 3300048091 Ga0495626_0003919 Ga0495626_0003919_7066_8079 329
100 3300048912 Ga0496109_0008922 Ga0496109_0008922_5925_7001 329
101 3300048916 Ga0496113_0007095 Ga0496113_0007095_4737_5813 329
102 3300048924 Ga0496121_0001111 Ga0496121_0001111_44545_45558 329
103 3300048925 Ga0496122_0000279 Ga0496122_0000279_16183_17259 329
104 3300048925 Ga0496122_0093168 Ga0496122_0093168_571_1584 329
105 3300048926 Ga0496123_0000146 Ga0496123_0000146_126762_127838 329
106 3300048926 Ga0496123_0020872 Ga0496123_0020872_2132_3145 329
107 3300048927 Ga0496124_0100630 Ga0496124_0100630_344_1357 329
108 3300048928 Ga0496125_0000168 Ga0496125_0000168_44747_45760 329
109 3300048928 Ga0496125_0000938 Ga0496125_0000938_8552_9628 329
110 3300048929 Ga0496126_0028380 Ga0496126_0028380_1840_2853 329
111 3300050491 nmdc:mga00v17_11321_c1 nmdc:mga00v17_11321_c1_907_1965 329
112 3300002067 JGI24735J21928_10001861 JGI24735J21928_100018616 330
113 3300003187 JGI25151J46595_10000065 JGI25151J46595_1000006542 330
114 3300003187 JGI25151J46595_10002865 JGI25151J46595_100028652 330
115 3300003187 JGI25151J46595_10030097 JGI25151J46595_100300972 330
116 3300003322 rootL2_10097683 rootL2_100976832 330
117 3300003771 Ga0055526_1002292 Ga0055526_10022923 330
118 3300003771 Ga0055526_1005476 Ga0055526_10054765 330
119 3300003773 Ga0055537_1000409 Ga0055537_10004096 330
120 3300003775 Ga0055524_1001775 Ga0055524_10017751 330
121 3300003781 Ga0055536_1000026 Ga0055536_100002653 330
122 3300003784 Ga0055534_1000189 Ga0055534_100018937 330
123 3300003784 Ga0055534_1001063 Ga0055534_10010635 330
124 3300005288 Ga0065714_10075233 Ga0065714_100752333 330
125 3300005293 Ga0065715_10000585 Ga0065715_1000058516 330
126 3300005337 Ga0070682_100231570 Ga0070682_1002315701 330
127 3300005339 Ga0070660_100035788 Ga0070660_1000357882 330
128 3300005366 Ga0070659_100014815 Ga0070659_1000148155 330
129 3300005457 Ga0070662_100108379 Ga0070662_1001083791 330
130 3300005457 Ga0070662_100130378 Ga0070662_1001303782 330
131 3300005563 Ga0068855_100036130 Ga0068855_1000361306 330
132 3300005616 Ga0068852_100402317 Ga0068852_1004023172 330
133 3300009093 Ga0105240_10558615 Ga0105240_105586151 330
134 3300009174 Ga0105241_10081750 Ga0105241_100817503 330
135 3300025263 Ga0209565_1000109 Ga0209565_1000109107 330
136 3300025263 Ga0209565_1004483 Ga0209565_10044834 330
137 3300025284 Ga0209130_1021883 Ga0209130_10218831 330
138 3300025291 Ga0209675_1000026 Ga0209675_1000026148 330
139 3300025291 Ga0209675_1000118 Ga0209675_10001186 330
140 3300025291 Ga0209675_1003453 Ga0209675_10034533 330
141 3300025292 Ga0209676_1000059 Ga0209676_1000059157 330
142 3300025294 Ga0209025_1000066 Ga0209025_1000066172 330
143 3300025294 Ga0209025_1000159 Ga0209025_100015951 330
144 3300025294 Ga0209025_1002020 Ga0209025_10020209 330
145 3300025295 Ga0209564_1000084 Ga0209564_100008411 330
146 3300025295 Ga0209564_1000161 Ga0209564_1000161141 330
147 3300025295 Ga0209564_1001556 Ga0209564_100155615 330
148 3300025297 Ga0209758_1008905 Ga0209758_10089054 330
149 3300025299 Ga0209256_1000602 Ga0209256_100060238 330
150 3300025299 Ga0209256_1001890 Ga0209256_100189013 330
151 3300025303 Ga0209051_1016101 Ga0209051_10161012 330
152 3300025303 Ga0209051_1018820 Ga0209051_10188201 330
153 3300025904 Ga0207647_10052444 Ga0207647_100524442 330
154 3300025909 Ga0207705_10000223 Ga0207705_1000022313 330
155 3300025911 Ga0207654_10035446 Ga0207654_100354463 330
156 3300025919 Ga0207657_10026304 Ga0207657_100263047 330
157 3300025919 Ga0207657_10200028 Ga0207657_102000281 330
158 3300025932 Ga0207690_10352918 Ga0207690_103529182 330
159 3300025933 Ga0207706_10063890 Ga0207706_100638902 330
160 3300025933 Ga0207706_10093265 Ga0207706_100932652 330
161 3300025938 Ga0207704_10214941 Ga0207704_102149412 330
162 3300025945 Ga0207679_10084716 Ga0207679_100847162 330
163 3300025949 Ga0207667_10032546 Ga0207667_100325466 330
164 3300037312 Ga0395899_0001188 Ga0395899_0001188_6035_7042 330
165 3300037312 Ga0395899_0075159 Ga0395899_0075159_293_1300 330
166 3300037418 Ga0395900_0000497 Ga0395900_0000497_28534_29541 330
167 3300037418 Ga0395900_0027237 Ga0395900_0027237_3953_4960 330
168 3300037418 Ga0395900_0098421 Ga0395900_0098421_467_1474 330
169 3300037418 Ga0395900_0203525 Ga0395900_0203525_143_1165 330
170 3300037418 Ga0395900_0521185 Ga0395900_0521185_86_1093 330
171 3300037466 Ga0395898_0005084 Ga0395898_0005084_7736_8743 330
172 3300037466 Ga0395898_0116731 Ga0395898_0116731_1428_2435 330
173 3300037466 Ga0395898_0120157 Ga0395898_0120157_1199_2206 330
174 3300037471 Ga0395905_0016771 Ga0395905_0016771_4419_5426 330
175 3300037471 Ga0395905_0087515 Ga0395905_0087515_1638_2645 330
176 3300038443 Ga0395901_0016576 Ga0395901_0016576_4793_5800 330
177 3300042134 Ga0450898_009738 Ga0450898_009738_337_1344 330
178 3300044656 Ga0466969_0040944 Ga0466969_0040944_671_1678 330
179 3300044658 Ga0466972_0057401 Ga0466972_0057401_540_1547 330
180 3300044683 Ga0466965_0011432 Ga0466965_0011432_2248_3255 330
181 3300044683 Ga0466965_0020839 Ga0466965_0020839_945_1952 330
182 3300044684 Ga0466966_0160128 Ga0466966_0160128_130_1137 330
183 3300044693 Ga0466961_0035934 Ga0466961_0035934_837_1856 330
184 3300044735 Ga0466968_0020072 Ga0466968_0020072_1442_2449 330
185 3300044765 Ga0466970_0060533 Ga0466970_0060533_818_1837 330
186 3300044842 Ga0466957_0000005 Ga0466957_0000005_43284_44291 330
187 3300045836 Ga0466958_0017206 Ga0466958_0017206_1989_2996 330
188 3300046457 Ga0495590_0003678 Ga0495590_0003678_2333_3355 330
189 3300046457 Ga0495590_0034983 Ga0495590_0034983_193_1200 330
190 3300046459 Ga0495629_0037348 Ga0495629_0037348_1410_2432 330
191 3300046463 Ga0495653_0001244 Ga0495653_0001244_585_1607 330
192 3300046474 Ga0495605_0000262 Ga0495605_0000262_7766_8773 330
193 3300046474 Ga0495605_0007936 Ga0495605_0007936_3104_4111 330
194 3300046474 Ga0495605_0061276 Ga0495605_0061276_631_1653 330
195 3300046474 Ga0495605_0077002 Ga0495605_0077002_351_1358 330
196 3300046491 Ga0495584_0000075 Ga0495584_0000075_65565_66572 330
197 3300046491 Ga0495584_0020139 Ga0495584_0020139_1650_2657 330
198 3300046491 Ga0495584_0073824 Ga0495584_0073824_441_1463 330
199 3300046500 Ga0495596_0001540 Ga0495596_0001540_1099_2106 330
200 3300046501 Ga0495607_0001693 Ga0495607_0001693_3918_4925 330
201 3300046501 Ga0495607_0002147 Ga0495607_0002147_1769_2776 330
202 3300046501 Ga0495607_0002797 Ga0495607_0002797_3976_4983 330
203 3300046506 Ga0495583_0000134 Ga0495583_0000134_94287_95291 330
204 3300046506 Ga0495583_0004563 Ga0495583_0004563_2770_3774 330
205 3300046506 Ga0495583_0114397 Ga0495583_0114397_57_1064 330
206 3300046507 Ga0495606_0000755 Ga0495606_0000755_20176_21183 330
207 3300046513 Ga0495616_0000796 Ga0495616_0000796_8865_9872 330
208 3300046513 Ga0495616_0012282 Ga0495616_0012282_3229_4236 330
209 3300046518 Ga0495631_0033643 Ga0495631_0033643_221_1228 330
210 3300046520 Ga0495637_0048937 Ga0495637_0048937_561_1568 330
211 3300046522 Ga0495643_0000829 Ga0495643_0000829_7766_8773 330
212 3300046522 Ga0495643_0001229 Ga0495643_0001229_12926_13933 330
213 3300046522 Ga0495643_0009176 Ga0495643_0009176_4729_5739 330
214 3300046528 Ga0495642_0000124 Ga0495642_0000124_13259_14266 330
215 3300046529 Ga0495652_0019824 Ga0495652_0019824_1346_2368 330
216 3300046530 Ga0495654_0013403 Ga0495654_0013403_1567_2574 330
217 3300046535 Ga0495586_0079556 Ga0495586_0079556_105_1127 330
218 3300046536 Ga0495587_0030350 Ga0495587_0030350_54_1076 330
219 3300046538 Ga0495609_0000001 Ga0495609_0000001_1004277_1005284 330
220 3300046538 Ga0495609_0005357 Ga0495609_0005357_1288_2295 330
221 3300046542 Ga0495597_0003217 Ga0495597_0003217_1910_2932 330
222 3300046557 Ga0495622_0039060 Ga0495622_0039060_980_1987 330
223 3300046615 Ga0495656_0007265 Ga0495656_0007265_702_1709 330
224 3300046615 Ga0495656_0010496 Ga0495656_0010496_1371_2378 330
225 3300046616 Ga0495668_0014693 Ga0495668_0014693_1771_2778 330
226 3300046648 Ga0495611_0038144 Ga0495611_0038144_182_1189 330
227 3300046665 Ga0495661_0000063 Ga0495661_0000063_76220_77227 330
228 3300046665 Ga0495661_0001664 Ga0495661_0001664_7777_8784 330
229 3300046665 Ga0495661_0027647 Ga0495661_0027647_730_1752 330
230 3300046665 Ga0495661_0049022 Ga0495661_0049022_639_1646 330
231 3300046665 Ga0495661_0124766 Ga0495661_0124766_73_1080 330
232 3300046674 Ga0495588_0000052 Ga0495588_0000052_88815_89822 330
233 3300046674 Ga0495588_0058293 Ga0495588_0058293_380_1387 330
234 3300046680 Ga0495646_0072232 Ga0495646_0072232_489_1511 330
235 3300046684 Ga0495669_0056936 Ga0495669_0056936_249_1271 330
236 3300046694 Ga0495649_0000880 Ga0495649_0000880_21575_22585 330
237 3300046794 Ga0495589_0000015 Ga0495589_0000015_35994_37001 330
238 3300046794 Ga0495589_0000116 Ga0495589_0000116_66857_67864 330
239 3300046794 Ga0495589_0045557 Ga0495589_0045557_577_1584 330
240 3300046809 Ga0495600_0063140 Ga0495600_0063140_958_1980 330
241 3300046810 Ga0495660_0000145 Ga0495660_0000145_7777_8784 330
242 3300046810 Ga0495660_0004796 Ga0495660_0004796_2815_3816 330
243 3300046810 Ga0495660_0091016 Ga0495660_0091016_157_1164 330
244 3300047317 Ga0495604_0001690 Ga0495604_0001690_16967_17989 330
245 3300047318 Ga0495636_0001565 Ga0495636_0001565_5467_6471 330
246 3300047318 Ga0495636_0016350 Ga0495636_0016350_1329_2339 330
247 3300047320 Ga0495672_0015756 Ga0495672_0015756_3673_4680 330
248 3300047323 Ga0495683_0005694 Ga0495683_0005694_5587_6609 330
249 3300047323 Ga0495683_0006362 Ga0495683_0006362_1391_2398 330
250 3300047323 Ga0495683_0071817 Ga0495683_0071817_358_1365 330
251 3300047443 Ga0495687_000003 Ga0495687_000003_495517_496524 330
252 3300047443 Ga0495687_000073 Ga0495687_000073_66148_67155 330
253 3300047443 Ga0495687_000635 Ga0495687_000635_7777_8784 330
254 3300047444 Ga0495675_0018177 Ga0495675_0018177_2315_3337 330
255 3300047445 Ga0495677_0000001 Ga0495677_0000001_662630_663637 330
256 3300047445 Ga0495677_0000847 Ga0495677_0000847_6161_7168 330
257 3300047469 Ga0495673_0013175 Ga0495673_0013175_744_1751 330
258 3300047472 Ga0495686_0000051 Ga0495686_0000051_18755_19762 330
259 3300047673 Ga0495593_0002192 Ga0495593_0002192_7521_8543 330
260 3300048088 Ga0495602_0002837 Ga0495602_0002837_9717_10739 330
261 3300048091 Ga0495626_0000020 Ga0495626_0000020_180082_181092 330
262 3300048091 Ga0495626_0000128 Ga0495626_0000128_32140_33147 330
263 3300048091 Ga0495626_0000171 Ga0495626_0000171_7777_8784 330
264 3300048091 Ga0495626_0006950 Ga0495626_0006950_3631_4638 330
265 3300048091 Ga0495626_0012053 Ga0495626_0012053_1242_2252 330
266 3300048904 Ga0496101_0003169 Ga0496101_0003169_6761_7783 330
267 3300048904 Ga0496101_0174772 Ga0496101_0174772_519_1541 330
268 3300048905 Ga0496102_0111792 Ga0496102_0111792_254_1261 330
269 3300048905 Ga0496102_0262564 Ga0496102_0262564_600_1607 330
270 3300048906 Ga0496103_0004666 Ga0496103_0004666_152_1174 330
271 3300048908 Ga0496105_0119419 Ga0496105_0119419_931_1953 330
272 3300048913 Ga0496110_0008599 Ga0496110_0008599_5741_6763 330
273 3300048914 Ga0496111_0001836 Ga0496111_0001836_6938_7960 330
274 3300048915 Ga0496112_0016434 Ga0496112_0016434_4031_5053 330
275 3300048919 Ga0496116_0003171 Ga0496116_0003171_8646_9668 330
276 3300048921 Ga0496118_0068631 Ga0496118_0068631_236_1258 330
277 3300048924 Ga0496121_0011238 Ga0496121_0011238_5884_6906 330
278 3300048925 Ga0496122_0018858 Ga0496122_0018858_4678_5685 330
279 3300048925 Ga0496122_0044505 Ga0496122_0044505_55_1077 330
280 3300048927 Ga0496124_0063624 Ga0496124_0063624_1522_2544 330
281 3300048928 Ga0496125_0027872 Ga0496125_0027872_732_1754 330
282 3300048928 Ga0496125_0119617 Ga0496125_0119617_265_1287 330
283 3300048929 Ga0496126_0194142 Ga0496126_0194142_390_1412 330
284 3300049571 Ga0501034_0000129 Ga0501034_0000129_24253_25263 330
285 3300049662 Ga0501222_008685 Ga0501222_008685_175_1182 330
286 iso_pu_bacteria 2548876994 2550696747 330
287 iso_pu_bacteria 2818991445 2819594413 330
288 iso_pu_bacteria 2884811622 2884815320 330
289 iso_pu_bacteria 2884836552 2884840836 330
290 iso_pu_bacteria 2884852848 2884857568 330
291 iso_pu_bacteria 2896154374 2896158508 330
292 3300003771 Ga0055526_1000289 Ga0055526_10002895 331
293 3300005262 Ga0065165_1001419 Ga0065165_10014196 331
294 3300005335 Ga0070666_10234942 Ga0070666_102349421 331
295 3300006946 Ga0079104_1004008 Ga0079104_10040085 331
296 3300009177 Ga0105248_10182322 Ga0105248_101823222 331
297 3300013306 Ga0163162_10007880 Ga0163162_100078804 331
298 3300013308 Ga0157375_10018197 Ga0157375_100181975 331
299 3300025295 Ga0209564_1000006 Ga0209564_1000006788 331
300 3300026067 Ga0207678_10064508 Ga0207678_100645082 331
301 3300037466 Ga0395898_0230158 Ga0395898_0230158_274_1287 331
302 3300037471 Ga0395905_0054981 Ga0395905_0054981_1661_2674 331
303 3300039447 Ga0436361_0082685 Ga0436361_0082685_1196_2197 331
304 3300046452 Ga0495617_000001 Ga0495617_000001_430363_431373 331
305 3300046453 Ga0495627_000026 Ga0495627_000026_58399_59409 331
306 3300046453 Ga0495627_000065 Ga0495627_000065_101209_102216 331
307 3300046457 Ga0495590_0000023 Ga0495590_0000023_63637_64638 331
308 3300046457 Ga0495590_0000083 Ga0495590_0000083_11843_12859 331
309 3300046457 Ga0495590_0001408 Ga0495590_0001408_2322_3341 331
310 3300046458 Ga0495591_000038 Ga0495591_000038_62804_63829 331
311 3300046474 Ga0495605_0000004 Ga0495605_0000004_80235_81245 331
312 3300046474 Ga0495605_0016154 Ga0495605_0016154_940_1965 331
313 3300046474 Ga0495605_0018303 Ga0495605_0018303_279_1292 331
314 3300046491 Ga0495584_0000234 Ga0495584_0000234_12285_13310 331
315 3300046491 Ga0495584_0012819 Ga0495584_0012819_2083_3096 331
316 3300046491 Ga0495584_0092552 Ga0495584_0092552_392_1405 331
317 3300046492 Ga0495585_0000521 Ga0495585_0000521_12562_13575 331
318 3300046492 Ga0495585_0002143 Ga0495585_0002143_5216_6229 331
319 3300046492 Ga0495585_0102178 Ga0495585_0102178_190_1203 331
320 3300046500 Ga0495596_0000353 Ga0495596_0000353_28642_29661 331
321 3300046500 Ga0495596_0001910 Ga0495596_0001910_8653_9666 331
322 3300046500 Ga0495596_0006189 Ga0495596_0006189_3007_4017 331
323 3300046500 Ga0495596_0006673 Ga0495596_0006673_4046_5059 331
324 3300046501 Ga0495607_0000272 Ga0495607_0000272_42981_43991 331
325 3300046501 Ga0495607_0009775 Ga0495607_0009775_5294_6319 331
326 3300046506 Ga0495583_0000345 Ga0495583_0000345_62546_63571 331
327 3300046506 Ga0495583_0008005 Ga0495583_0008005_1281_2300 331
328 3300046506 Ga0495583_0012287 Ga0495583_0012287_3252_4271 331
329 3300046506 Ga0495583_0028120 Ga0495583_0028120_1612_2631 331
330 3300046506 Ga0495583_0074465 Ga0495583_0074465_412_1431 331
331 3300046507 Ga0495606_0030185 Ga0495606_0030185_1661_2680 331
332 3300046512 Ga0495610_0004953 Ga0495610_0004953_158_1183 331
333 3300046512 Ga0495610_0018789 Ga0495610_0018789_2689_3696 331
334 3300046513 Ga0495616_0001609 Ga0495616_0001609_10554_11564 331
335 3300046513 Ga0495616_0020294 Ga0495616_0020294_126_1145 331
336 3300046513 Ga0495616_0045258 Ga0495616_0045258_830_1849 331
337 3300046518 Ga0495631_0000438 Ga0495631_0000438_26101_27126 331
338 3300046518 Ga0495631_0000980 Ga0495631_0000980_3347_4360 331
339 3300046518 Ga0495631_0001103 Ga0495631_0001103_5703_6722 331
340 3300046518 Ga0495631_0009591 Ga0495631_0009591_402_1412 331
341 3300046518 Ga0495631_0010803 Ga0495631_0010803_801_1820 331
342 3300046518 Ga0495631_0066757 Ga0495631_0066757_484_1497 331
343 3300046519 Ga0495632_0000024 Ga0495632_0000024_99618_100628 331
344 3300046519 Ga0495632_0000028 Ga0495632_0000028_168794_169813 331
345 3300046519 Ga0495632_0000043 Ga0495632_0000043_102984_104003 331
346 3300046519 Ga0495632_0012261 Ga0495632_0012261_156_1181 331
347 3300046520 Ga0495637_0000002 Ga0495637_0000002_94052_95077 331
348 3300046520 Ga0495637_0003770 Ga0495637_0003770_3599_4606 331
349 3300046520 Ga0495637_0038480 Ga0495637_0038480_987_1991 331
350 3300046522 Ga0495643_0000138 Ga0495643_0000138_34820_35827 331
351 3300046522 Ga0495643_0002875 Ga0495643_0002875_9787_10812 331
352 3300046522 Ga0495643_0008722 Ga0495643_0008722_2155_3156 331
353 3300046522 Ga0495643_0089697 Ga0495643_0089697_353_1390 331
354 3300046523 Ga0495644_0005637 Ga0495644_0005637_2381_3406 331
355 3300046523 Ga0495644_0012939 Ga0495644_0012939_1949_2956 331
356 3300046524 Ga0495648_0000022 Ga0495648_0000022_224751_225761 331
357 3300046524 Ga0495648_0010741 Ga0495648_0010741_889_1908 331
358 3300046524 Ga0495648_0041114 Ga0495648_0041114_1864_2877 331
359 3300046528 Ga0495642_0000001 Ga0495642_0000001_171146_172156 331
360 3300046528 Ga0495642_0000041 Ga0495642_0000041_197_1207 331
361 3300046528 Ga0495642_0007249 Ga0495642_0007249_538_1551 331
362 3300046528 Ga0495642_0008755 Ga0495642_0008755_221_1234 331
363 3300046528 Ga0495642_0019716 Ga0495642_0019716_1293_2306 331
364 3300046530 Ga0495654_0004648 Ga0495654_0004648_5990_7009 331
365 3300046530 Ga0495654_0029866 Ga0495654_0029866_1382_2392 331
366 3300046538 Ga0495609_0004066 Ga0495609_0004066_2368_3375 331
367 3300046538 Ga0495609_0005788 Ga0495609_0005788_2177_3214 331
368 3300046538 Ga0495609_0018521 Ga0495609_0018521_1877_2890 331
369 3300046538 Ga0495609_0032516 Ga0495609_0032516_543_1556 331
370 3300046542 Ga0495597_0000189 Ga0495597_0000189_13031_14050 331
371 3300046542 Ga0495597_0002006 Ga0495597_0002006_5782_6795 331
372 3300046542 Ga0495597_0004354 Ga0495597_0004354_3112_4113 331
373 3300046558 Ga0495633_0001372 Ga0495633_0001372_9082_10107 331
374 3300046558 Ga0495633_0001858 Ga0495633_0001858_9361_10374 331
375 3300046558 Ga0495633_0005278 Ga0495633_0005278_3119_4126 331
376 3300046615 Ga0495656_0098344 Ga0495656_0098344_147_1157 331
377 3300046616 Ga0495668_0000036 Ga0495668_0000036_169920_170933 331
378 3300046616 Ga0495668_0000280 Ga0495668_0000280_10823_11833 331
379 3300046616 Ga0495668_0000304 Ga0495668_0000304_3339_4340 331
380 3300046616 Ga0495668_0004592 Ga0495668_0004592_1866_2879 331
381 3300046616 Ga0495668_0010138 Ga0495668_0010138_4001_5020 331
382 3300046616 Ga0495668_0070733 Ga0495668_0070733_478_1491 331
383 3300046616 Ga0495668_0173282 Ga0495668_0173282_111_1172 331
384 3300046648 Ga0495611_0000191 Ga0495611_0000191_21126_22151 331
385 3300046648 Ga0495611_0016700 Ga0495611_0016700_364_1377 331
386 3300046660 Ga0495625_0022425 Ga0495625_0022425_2824_3843 331
387 3300046665 Ga0495661_0001045 Ga0495661_0001045_15156_16169 331
388 3300046665 Ga0495661_0002785 Ga0495661_0002785_6109_7119 331
389 3300046665 Ga0495661_0009113 Ga0495661_0009113_1826_2845 331
390 3300046665 Ga0495661_0017937 Ga0495661_0017937_1449_2462 331
391 3300046665 Ga0495661_0029380 Ga0495661_0029380_626_1639 331
392 3300046665 Ga0495661_0040087 Ga0495661_0040087_437_1450 331
393 3300046674 Ga0495588_0164185 Ga0495588_0164185_69_1082 331
394 3300046684 Ga0495669_0000013 Ga0495669_0000013_131271_132284 331
395 3300046684 Ga0495669_0000818 Ga0495669_0000818_8419_9432 331
396 3300046684 Ga0495669_0000834 Ga0495669_0000834_5169_6179 331
397 3300046684 Ga0495669_0018538 Ga0495669_0018538_1340_2350 331
398 3300046691 Ga0495670_0000052 Ga0495670_0000052_6942_7955 331
399 3300046692 Ga0495671_0000313 Ga0495671_0000313_4758_5768 331
400 3300046692 Ga0495671_0009433 Ga0495671_0009433_2281_3300 331
401 3300046692 Ga0495671_0026510 Ga0495671_0026510_1792_2799 331
402 3300046694 Ga0495649_0000085 Ga0495649_0000085_28342_29367 331
403 3300046794 Ga0495589_0000227 Ga0495589_0000227_40654_41673 331
404 3300046794 Ga0495589_0005507 Ga0495589_0005507_776_1786 331
405 3300046794 Ga0495589_0019142 Ga0495589_0019142_795_1808 331
406 3300046794 Ga0495589_0103993 Ga0495589_0103993_192_1217 331
407 3300046810 Ga0495660_0008371 Ga0495660_0008371_2102_3109 331
408 3300046810 Ga0495660_0011577 Ga0495660_0011577_1846_2847 331
409 3300047320 Ga0495672_0000065 Ga0495672_0000065_9661_10686 331
410 3300047320 Ga0495672_0002150 Ga0495672_0002150_11327_12334 331
411 3300047320 Ga0495672_0036059 Ga0495672_0036059_78_1091 331
412 3300047320 Ga0495672_0037417 Ga0495672_0037417_1029_2042 331
413 3300047320 Ga0495672_0040711 Ga0495672_0040711_1521_2540 331
414 3300047321 Ga0495676_0000029 Ga0495676_0000029_123069_124082 331
415 3300047323 Ga0495683_0000012 Ga0495683_0000012_152634_153659 331
416 3300047323 Ga0495683_0020718 Ga0495683_0020718_1159_2178 331
417 3300047443 Ga0495687_000002 Ga0495687_000002_231294_232307 331
418 3300047443 Ga0495687_000007 Ga0495687_000007_314415_315434 331
419 3300047443 Ga0495687_000445 Ga0495687_000445_34940_35959 331
420 3300047443 Ga0495687_000827 Ga0495687_000827_16870_17871 331
421 3300047443 Ga0495687_003439 Ga0495687_003439_3286_4287 331
422 3300047445 Ga0495677_0001330 Ga0495677_0001330_3490_4515 331
423 3300047445 Ga0495677_0006184 Ga0495677_0006184_2892_3905 331
424 3300047445 Ga0495677_0008510 Ga0495677_0008510_1829_2839 331
425 3300047445 Ga0495677_0054801 Ga0495677_0054801_358_1371 331
426 3300047446 Ga0495679_004825 Ga0495679_004825_4398_5417 331
427 3300047447 Ga0495685_002660 Ga0495685_002660_1218_2237 331
428 3300047470 Ga0495681_0001808 Ga0495681_0001808_2645_3658 331
429 3300047470 Ga0495681_0050794 Ga0495681_0050794_404_1423 331
430 3300047472 Ga0495686_0022171 Ga0495686_0022171_2179_3204 331
431 3300048091 Ga0495626_0002911 Ga0495626_0002911_1533_2546 331
432 3300048091 Ga0495626_0027661 Ga0495626_0027661_729_1748 331
433 3300048091 Ga0495626_0032073 Ga0495626_0032073_174_1193 331
434 3300048091 Ga0495626_0053463 Ga0495626_0053463_660_1685 331
435 3300048905 Ga0496102_0000033 Ga0496102_0000033_193949_194959 331
436 3300048906 Ga0496103_0001739 Ga0496103_0001739_7969_8976 331
437 3300048906 Ga0496103_0111529 Ga0496103_0111529_645_1706 331
438 3300048907 Ga0496104_0158567 Ga0496104_0158567_624_1685 331
439 3300048913 Ga0496110_0021223 Ga0496110_0021223_4132_5151 331
440 3300048929 Ga0496126_0023069 Ga0496126_0023069_1688_2707 331
441 3300049459 Ga0495678_000001 Ga0495678_000001_959994_961001 331
442 3300049459 Ga0495678_000015 Ga0495678_000015_187837_188862 331
443 3300049459 Ga0495678_000022 Ga0495678_000022_102619_103638 331
444 3300049459 Ga0495678_000229 Ga0495678_000229_61317_62336 331
445 3300049459 Ga0495678_004103 Ga0495678_004103_3812_4819 331
446 3300049459 Ga0495678_005612 Ga0495678_005612_752_1771 331
447 3300049459 Ga0495678_009379 Ga0495678_009379_1781_2782 331
448 3300053145 Ga0500586_000583 Ga0500586_000583_3773_4780 331
449 iso_pu_bacteria 2511231003 2511252219 331
450 3300046460 Ga0495638_0000067 Ga0495638_0000067_103152_104165 332
451 3300046471 Ga0495650_0008218 Ga0495650_0008218_2210_3223 332
452 3300046475 Ga0495639_0027630 Ga0495639_0027630_14_1027 332
453 3300046506 Ga0495583_0000162 Ga0495583_0000162_10754_11767 332
454 3300046524 Ga0495648_0000008 Ga0495648_0000008_130632_131645 332
455 3300046528 Ga0495642_0003464 Ga0495642_0003464_2285_3298 332
456 3300046557 Ga0495622_0000407 Ga0495622_0000407_25748_26761 332
457 3300046558 Ga0495633_0000075 Ga0495633_0000075_48804_49817 332
458 3300046660 Ga0495625_0010510 Ga0495625_0010510_3154_4167 332
459 3300047469 Ga0495673_0000034 Ga0495673_0000034_101894_102907 332
460 3300048919 Ga0496116_0153613 Ga0496116_0153613_100_1116 332
461 3300048920 Ga0496117_0143230 Ga0496117_0143230_181_1245 332
462 3300048927 Ga0496124_0039254 Ga0496124_0039254_377_1399 332
463 iso_pu_bacteria 2599185214 2599620811 332
464 iso_pu_bacteria 2599185226 2599674110 332
465 iso_pu_bacteria 2599185227 2599678573 332
466 iso_pu_bacteria 2599185229 2599690322 332
467 iso_pu_bacteria 2643221683 2644465941 332
468 iso_pu_bacteria 2738541277 2738720661 332
469 iso_pu_bacteria 2738543013 2739248406 332
470 iso_pu_bacteria 2738543019 2739279860 332
471 iso_pu_bacteria 2818991446 2819601344 332
472 iso_pu_bacteria 2831265667 2831269765 332
473 iso_pu_bacteria 2838054893 2838055217 332
474 iso_pu_bacteria 2842698319 2842701545 332
475 iso_pu_bacteria 2842733646 2842736478 332
476 iso_pu_bacteria 2842747753 2842747755 332
477 iso_pu_bacteria 2881412998 2881416695 332
478 iso_pu_bacteria 2885198086 2885201696 332
479 iso_pu_bacteria 2885211737 2885215593 332
480 iso_pu_bacteria 2899924645 2899927307 332
481 iso_pu_bacteria 2904541872 2904549206 332
482 iso_pu_bacteria 2928037797 2928042779 332
483 iso_pu_bacteria 2928044640 2928048794 332
484 iso_pu_bacteria 2928051484 2928055126 332
485 iso_pu_bacteria 2928064002 2928068552 332
486 iso_pu_bacteria 2928070936 2928073539 332
487 iso_pu_bacteria 2928084124 2928089758 332
488 iso_pu_bacteria 2928115317 2928119521 332
489 iso_pu_bacteria 2929160207 2929161383 332
490 iso_pu_bacteria 2945909444 2945914158 332
491 iso_pu_bacteria 2945984333 2945990458 332
492 3300031250 Ga0265331_10000850 Ga0265331_100008506 333
493 3300031251 Ga0265327_10001272 Ga0265327_1000127210 333
494 3300041498 Ga0451841_1002159 Ga0451841_1002159_101_1111 333
495 3300048913 Ga0496110_0000007 Ga0496110_0000007_57637_58668 333
496 iso_pu_bacteria 2738541307 2738886249 333
497 iso_pu_bacteria 2834641062 2834644450 333
498 3300002704 JGI25155J39150_1000278 JGI25155J39150_100027812 334
499 3300002705 JGI25156J39149_1000603 JGI25156J39149_100060313 334
500 3300002737 JGI25162J39368_1004886 JGI25162J39368_10048862 334
501 3300002738 JGI25154J39366_1000546 JGI25154J39366_100054612 334
502 3300002741 JGI25157J39369_1000507 JGI25157J39369_100050712 334
503 3300003320 rootH2_10144172 rootH2_101441722 334
504 3300003758 Ga0055532_1000089 Ga0055532_100008968 334
505 3300003761 Ga0055535_1007254 Ga0055535_10072541 334
506 3300003775 Ga0055524_1000203 Ga0055524_100020337 334
507 3300003791 Ga0055530_10002316 Ga0055530_100023169 334
508 3300003792 Ga0055540_1000119 Ga0055540_100011954 334
509 3300005331 Ga0070670_100019932 Ga0070670_1000199323 334
510 3300005563 Ga0068855_100083619 Ga0068855_1000836193 334
511 3300005614 Ga0068856_100005665 Ga0068856_1000056655 334
512 3300005616 Ga0068852_100025954 Ga0068852_1000259544 334
513 3300006946 Ga0079104_1000019 Ga0079104_1000019115 334
514 3300009093 Ga0105240_10017286 Ga0105240_100172866 334
515 3300009177 Ga0105248_10117010 Ga0105248_101170102 334
516 3300009551 Ga0105238_10250395 Ga0105238_102503952 334
517 3300013306 Ga0163162_10012287 Ga0163162_100122873 334
518 3300016635 Ga0183361_10008 Ga0183361_10008206 334
519 3300025206 Ga0209435_100088 Ga0209435_10008833 334
520 3300025229 Ga0209147_100060 Ga0209147_100060132 334
521 3300025233 Ga0209437_100442 Ga0209437_1004424 334
522 3300025242 Ga0209258_100141 Ga0209258_100141104 334
523 3300025246 Ga0209646_1000101 Ga0209646_1000101122 334
524 3300025250 Ga0209026_1000264 Ga0209026_100026433 334
525 3300025256 Ga0209759_1000264 Ga0209759_100026448 334
526 3300025291 Ga0209675_1011912 Ga0209675_10119123 334
527 3300025298 Ga0209050_1000478 Ga0209050_100047821 334
528 3300025298 Ga0209050_1003977 Ga0209050_10039777 334
529 3300025299 Ga0209256_1000024 Ga0209256_1000024117 334
530 3300025303 Ga0209051_1000063 Ga0209051_100006354 334
531 3300025304 Ga0209257_1000118 Ga0209257_1000118153 334
532 3300025735 Ga0207713_1036865 Ga0207713_10368652 334
533 3300025913 Ga0207695_10002329 Ga0207695_1000232921 334
534 3300025913 Ga0207695_10063866 Ga0207695_100638662 334
535 3300025924 Ga0207694_10045712 Ga0207694_100457122 334
536 3300025925 Ga0207650_10004198 Ga0207650_100041982 334
537 3300025941 Ga0207711_10329710 Ga0207711_103297101 334
538 3300025949 Ga0207667_10013354 Ga0207667_100133546 334
539 3300026078 Ga0207702_10048467 Ga0207702_100484672 334
540 3300026142 Ga0207698_10113843 Ga0207698_101138431 334
541 3300027111 Ga0209281_1000160 Ga0209281_1000160115 334
542 3300028800 Ga0265338_10000045 Ga0265338_1000004537 334
543 3300042125 Ga0450923_021396 Ga0450923_021396_190_1212 334
544 3300042531 Ga0450918_000093 Ga0450918_000093_14554_15576 334
545 3300046516 Ga0495628_0032728 Ga0495628_0032728_1961_3070 334
546 3300046660 Ga0495625_0013764 Ga0495625_0013764_1882_2898 334
547 3300047320 Ga0495672_0043617 Ga0495672_0043617_478_1539 334
548 3300047469 Ga0495673_0019688 Ga0495673_0019688_766_1827 334
549 3300047472 Ga0495686_0000021 Ga0495686_0000021_103176_104285 334
550 3300048909 Ga0496106_0000032 Ga0496106_0000032_91441_92496 334
551 3300048921 Ga0496118_0054990 Ga0496118_0054990_326_1381 334
552 3300048924 Ga0496121_0086377 Ga0496121_0086377_1215_2270 334
553 3300048925 Ga0496122_0000146 Ga0496122_0000146_100347_101363 334
554 3300048926 Ga0496123_0000894 Ga0496123_0000894_7695_8711 334
555 3300048928 Ga0496125_0002050 Ga0496125_0002050_5436_6452 334
556 3300048929 Ga0496126_0000421 Ga0496126_0000421_58158_59213 334
557 3300048929 Ga0496126_0019373 Ga0496126_0019373_104_1141 334
558 iso_pu_bacteria 2808606384 2808967615 334
559 iso_pu_bacteria 2808606390 2809002446 334
560 iso_pu_bacteria 2808606391 2809009724 334
561 iso_pu_bacteria 2857357740 2857365612 334
562 iso_pu_bacteria 2904479285 2904481599 334
563 iso_pu_bacteria 8039098773 8039099939 334
564 3300002704 JGI25155J39150_1000435 JGI25155J39150_10004355 335
565 3300002738 JGI25154J39366_1000296 JGI25154J39366_10002968 335
566 3300005577 Ga0068857_100120080 Ga0068857_1001200802 335
567 3300005578 Ga0068854_100037948 Ga0068854_1000379482 335
568 3300006948 Ga0099826_10000074 Ga0099826_1000007430 335
569 3300009545 Ga0105237_10010237 Ga0105237_100102374 335
570 3300009551 Ga0105238_10000125 Ga0105238_1000012570 335
571 3300010375 Ga0105239_10003165 Ga0105239_100031654 335
572 3300013105 Ga0157369_10031722 Ga0157369_100317223 335
573 3300015261 Ga0182006_1017245 Ga0182006_10172453 335
574 3300021361 Ga0213872_10000043 Ga0213872_1000004324 335
575 3300021361 Ga0213872_10000086 Ga0213872_1000008686 335
576 3300021361 Ga0213872_10026701 Ga0213872_100267013 335
577 3300025206 Ga0209435_100155 Ga0209435_10015519 335
578 3300025246 Ga0209646_1000176 Ga0209646_100017647 335
579 3300025250 Ga0209026_1001144 Ga0209026_10011446 335
580 3300025256 Ga0209759_1000296 Ga0209759_100029615 335
581 3300025913 Ga0207695_10003770 Ga0207695_1000377013 335
582 3300025914 Ga0207671_10002331 Ga0207671_1000233113 335
583 3300025924 Ga0207694_10001397 Ga0207694_1000139716 335
584 3300025981 Ga0207640_10044059 Ga0207640_100440592 335
585 3300026116 Ga0207674_10101251 Ga0207674_101012512 335
586 3300027666 Ga0209282_1000113 Ga0209282_100011317 335
587 3300033180 Ga0307510_10000462 Ga0307510_1000046220 335
588 3300039447 Ga0436361_0493011 Ga0436361_0493011_1330_2343 335
589 3300039447 Ga0436361_0943694 Ga0436361_0943694_86926_87939 335
590 3300039447 Ga0436361_1133215 Ga0436361_1133215_53874_54887 335
591 3300039447 Ga0436361_1136892 Ga0436361_1136892_1675_2685 335
592 3300044683 Ga0466965_0034922 Ga0466965_0034922_511_1572 335
593 3300046455 Ga0495603_0001852 Ga0495603_0001852_11005_12054 335
594 3300046459 Ga0495629_0000088 Ga0495629_0000088_18942_19991 335
595 3300046462 Ga0495651_0113752 Ga0495651_0113752_182_1225 335
596 3300046471 Ga0495650_0001305 Ga0495650_0001305_13637_14686 335
597 3300046472 Ga0495580_0000056 Ga0495580_0000056_2629_3681 335
598 3300046472 Ga0495580_0010163 Ga0495580_0010163_368_1417 335
599 3300046473 Ga0495582_0066393 Ga0495582_0066393_587_1636 335
600 3300046500 Ga0495596_0008428 Ga0495596_0008428_1465_2514 335
601 3300046516 Ga0495628_0020955 Ga0495628_0020955_949_2001 335
602 3300046517 Ga0495630_0014034 Ga0495630_0014034_4738_5790 335
603 3300046526 Ga0495666_0003483 Ga0495666_0003483_3082_4134 335
604 3300046543 Ga0495645_0000452 Ga0495645_0000452_17961_19010 335
605 3300046678 Ga0495599_0013941 Ga0495599_0013941_1738_2790 335
606 3300046689 Ga0495613_0014673 Ga0495613_0014673_2181_3230 335
607 3300046690 Ga0495624_0001726 Ga0495624_0001726_13432_14484 335
608 3300046694 Ga0495649_0084399 Ga0495649_0084399_249_1292 335
609 3300046809 Ga0495600_0046096 Ga0495600_0046096_421_1470 335
610 3300047317 Ga0495604_0021007 Ga0495604_0021007_2327_3379 335
611 3300047320 Ga0495672_0117484 Ga0495672_0117484_88_1140 335
612 3300047322 Ga0495680_0043744 Ga0495680_0043744_918_1970 335
613 3300048903 Ga0496100_0072005 Ga0496100_0072005_907_1956 335
614 3300048904 Ga0496101_0061325 Ga0496101_0061325_1088_2137 335
615 3300048905 Ga0496102_0136988 Ga0496102_0136988_608_1654 335
616 3300048908 Ga0496105_0031194 Ga0496105_0031194_1715_2764 335
617 3300048917 Ga0496114_0003502 Ga0496114_0003502_417_1478 335
618 3300048920 Ga0496117_0000392 Ga0496117_0000392_62830_63876 335
619 3300048921 Ga0496118_0003657 Ga0496118_0003657_16104_17150 335
620 3300048924 Ga0496121_0000672 Ga0496121_0000672_7230_8282 335
621 3300048929 Ga0496126_0000426 Ga0496126_0000426_43391_44437 335
622 3300048929 Ga0496126_0000915 Ga0496126_0000915_2930_3982 335
623 3300048929 Ga0496126_0011309 Ga0496126_0011309_698_1750 335
624 iso_pu_bacteria 2643221569 2643861802 335
625 iso_pu_bacteria 2643221594 2643983169 335
626 iso_pu_bacteria 2643221621 2644123430 335
627 iso_pu_bacteria 2808606395 2809033307 335
628 iso_pu_bacteria 2818991449 2819618525 335
629 iso_pu_bacteria 2857537821 2857538201 335
630 iso_pu_bacteria 2858950400 2858952017 335
631 iso_pu_bacteria 2904439833 2904444238 335
632 iso_pu_bacteria 2904530477 2904533843 335
633 iso_pu_bacteria 2904584206 2904589321 335
634 iso_pu_bacteria 2904589729 2904595023 335
635 iso_pu_bacteria 2904601388 2904606496 335
636 iso_pu_bacteria 2919079590 2919084554 335
637 iso_pu_bacteria 2923510766 2923514645 335
638 iso_pu_bacteria 2928130867 2928135449 335
639 iso_pu_bacteria 2941479691 2941482439 335
640 iso_pu_bacteria 8003400568 8003404142 335
641 3300002773 JGI25152J39213_1009578 JGI25152J39213_10095782 336
642 3300002774 JGI25150J39212_1007157 JGI25150J39212_10071571 336
643 3300002987 JGI25159J45721_1023305 JGI25159J45721_10233051 336
644 3300003187 JGI25151J46595_10004463 JGI25151J46595_100044635 336
645 3300003187 JGI25151J46595_10022671 JGI25151J46595_100226712 336
646 3300003215 JGI25153J46596_10021175 JGI25153J46596_100211752 336
647 3300003751 Ga0055538_1000053 Ga0055538_100005364 336
648 3300003752 Ga0055539_1000078 Ga0055539_100007864 336
649 3300003756 Ga0055533_1000084 Ga0055533_100008464 336
650 3300003759 Ga0055525_1000112 Ga0055525_100011258 336
651 3300003761 Ga0055535_1004789 Ga0055535_10047892 336
652 3300003762 Ga0055542_1000084 Ga0055542_10000842 336
653 3300003775 Ga0055524_1006315 Ga0055524_10063152 336
654 3300003781 Ga0055536_1001919 Ga0055536_100191913 336
655 3300003781 Ga0055536_1035560 Ga0055536_10355602 336
656 3300003784 Ga0055534_1000873 Ga0055534_100087310 336
657 3300003791 Ga0055530_10001195 Ga0055530_100011952 336
658 3300003792 Ga0055540_1004031 Ga0055540_10040312 336
659 3300003792 Ga0055540_1009042 Ga0055540_10090423 336
660 3300003792 Ga0055540_1012930 Ga0055540_10129302 336
661 3300003794 Ga0055531_10003661 Ga0055531_1000366110 336
662 3300003794 Ga0055531_10023250 Ga0055531_100232502 336
663 3300003841 Ga0055541_1000055 Ga0055541_100005558 336
664 3300005327 Ga0070658_10146196 Ga0070658_101461962 336
665 3300005364 Ga0070673_100188926 Ga0070673_1001889262 336
666 3300005457 Ga0070662_100097260 Ga0070662_1000972602 336
667 3300005564 Ga0070664_100023285 Ga0070664_1000232852 336
668 3300005577 Ga0068857_100029509 Ga0068857_1000295093 336
669 3300005834 Ga0068851_10006805 Ga0068851_100068052 336
670 3300005844 Ga0068862_100192029 Ga0068862_1001920292 336
671 3300006051 Ga0075364_10167379 Ga0075364_101673791 336
672 3300006353 Ga0075370_10002922 Ga0075370_100029228 336
673 3300006353 Ga0075370_10005862 Ga0075370_100058627 336
674 3300009036 Ga0105244_10005858 Ga0105244_1000585810 336
675 3300009148 Ga0105243_10003150 Ga0105243_1000315015 336
676 3300009148 Ga0105243_10006289 Ga0105243_1000628910 336
677 3300009148 Ga0105243_10021336 Ga0105243_100213363 336
678 3300009545 Ga0105237_10389383 Ga0105237_103893831 336
679 3300009551 Ga0105238_10351303 Ga0105238_103513032 336
680 3300009551 Ga0105238_10380894 Ga0105238_103808942 336
681 3300010375 Ga0105239_10432678 Ga0105239_104326782 336
682 3300011119 Ga0105246_10041696 Ga0105246_100416962 336
683 3300013102 Ga0157371_10032343 Ga0157371_100323432 336
684 3300013104 Ga0157370_10249487 Ga0157370_102494872 336
685 3300013306 Ga0163162_10190964 Ga0163162_101909642 336
686 3300013307 Ga0157372_10064239 Ga0157372_100642393 336
687 3300014497 Ga0182008_10000579 Ga0182008_100005792 336
688 3300014497 Ga0182008_10003531 Ga0182008_1000353110 336
689 3300015261 Ga0182006_1000912 Ga0182006_100091220 336
690 3300015262 Ga0182007_10003417 Ga0182007_100034172 336
691 3300017792 Ga0163161_10001053 Ga0163161_100010532 336
692 3300017792 Ga0163161_10066144 Ga0163161_100661442 336
693 3300017792 Ga0163161_10223794 Ga0163161_102237942 336
694 3300021361 Ga0213872_10005011 Ga0213872_100050113 336
695 3300025208 Ga0209436_105353 Ga0209436_1053531 336
696 3300025224 Ga0209784_100035 Ga0209784_10003558 336
697 3300025225 Ga0209566_100040 Ga0209566_10004058 336
698 3300025226 Ga0209674_100057 Ga0209674_10005758 336
699 3300025228 Ga0209672_100776 Ga0209672_1007763 336
700 3300025229 Ga0209147_101867 Ga0209147_1018673 336
701 3300025230 Ga0209563_100059 Ga0209563_10005958 336
702 3300025242 Ga0209258_100790 Ga0209258_1007902 336
703 3300025245 Ga0207425_1000552 Ga0207425_10005522 336
704 3300025253 Ga0209677_100036 Ga0209677_10003658 336
705 3300025254 Ga0209148_1000007 Ga0209148_10000071185 336
706 3300025258 Ga0209129_1000147 Ga0209129_100014772 336
707 3300025258 Ga0209129_1002420 Ga0209129_10024205 336
708 3300025258 Ga0209129_1010367 Ga0209129_10103672 336
709 3300025263 Ga0209565_1000282 Ga0209565_100028222 336
710 3300025263 Ga0209565_1003395 Ga0209565_10033956 336
711 3300025273 Ga0209673_1001256 Ga0209673_10012565 336
712 3300025273 Ga0209673_1001287 Ga0209673_100128722 336
713 3300025284 Ga0209130_1001468 Ga0209130_10014685 336
714 3300025284 Ga0209130_1001869 Ga0209130_10018699 336
715 3300025291 Ga0209675_1000745 Ga0209675_10007452 336
716 3300025291 Ga0209675_1001335 Ga0209675_100133512 336
717 3300025291 Ga0209675_1004919 Ga0209675_10049192 336
718 3300025292 Ga0209676_1000028 Ga0209676_1000028491 336
719 3300025292 Ga0209676_1000216 Ga0209676_100021628 336
720 3300025292 Ga0209676_1000486 Ga0209676_100048614 336
721 3300025292 Ga0209676_1008584 Ga0209676_10085842 336
722 3300025294 Ga0209025_1000375 Ga0209025_100037575 336
723 3300025294 Ga0209025_1000503 Ga0209025_10005032 336
724 3300025294 Ga0209025_1001127 Ga0209025_100112711 336
725 3300025294 Ga0209025_1004317 Ga0209025_10043172 336
726 3300025295 Ga0209564_1000220 Ga0209564_100022029 336
727 3300025295 Ga0209564_1000327 Ga0209564_100032753 336
728 3300025297 Ga0209758_1000199 Ga0209758_100019919 336
729 3300025298 Ga0209050_1000072 Ga0209050_1000072248 336
730 3300025298 Ga0209050_1000133 Ga0209050_100013319 336
731 3300025298 Ga0209050_1025015 Ga0209050_10250152 336
732 3300025299 Ga0209256_1000117 Ga0209256_100011729 336
733 3300025299 Ga0209256_1000206 Ga0209256_100020676 336
734 3300025302 Ga0207426_1000049 Ga0207426_1000049212 336
735 3300025302 Ga0207426_1000166 Ga0207426_100016629 336
736 3300025303 Ga0209051_1000015 Ga0209051_1000015420 336
737 3300025303 Ga0209051_1000255 Ga0209051_100025566 336
738 3300025303 Ga0209051_1000440 Ga0209051_100044022 336
739 3300025303 Ga0209051_1006243 Ga0209051_10062438 336
740 3300025303 Ga0209051_1010689 Ga0209051_10106894 336
741 3300025304 Ga0209257_1000037 Ga0209257_1000037325 336
742 3300025304 Ga0209257_1003603 Ga0209257_10036032 336
743 3300025304 Ga0209257_1006169 Ga0209257_10061693 336
744 3300025321 Ga0207656_10047471 Ga0207656_100474712 336
745 3300025728 Ga0207655_1000689 Ga0207655_100068917 336
746 3300025914 Ga0207671_10156929 Ga0207671_101569291 336
747 3300025933 Ga0207706_10163822 Ga0207706_101638222 336
748 3300025935 Ga0207709_10001078 Ga0207709_1000107820 336
749 3300025935 Ga0207709_10003894 Ga0207709_100038946 336
750 3300025935 Ga0207709_10008677 Ga0207709_100086775 336
751 3300025945 Ga0207679_10008799 Ga0207679_100087998 336
752 3300025960 Ga0207651_10162383 Ga0207651_101623832 336
753 3300026041 Ga0207639_10401445 Ga0207639_104014452 336
754 3300026116 Ga0207674_10034062 Ga0207674_100340622 336
755 3300026121 Ga0207683_10302047 Ga0207683_103020472 336
756 3300026142 Ga0207698_10287080 Ga0207698_102870802 336
757 3300028380 Ga0268265_10089327 Ga0268265_100893272 336
758 3300028794 Ga0307515_10000215 Ga0307515_1000021536 336
759 3300028794 Ga0307515_10000267 Ga0307515_1000026710 336
760 3300031251 Ga0265327_10007497 Ga0265327_100074975 336
761 3300031456 Ga0307513_10014657 Ga0307513_100146573 336
762 3300031649 Ga0307514_10000806 Ga0307514_1000080640 336
763 3300031731 Ga0307405_10058007 Ga0307405_100580072 336
764 3300031731 Ga0307405_10058723 Ga0307405_100587232 336
765 3300031911 Ga0307412_10000120 Ga0307412_1000012045 336
766 3300031911 Ga0307412_10081052 Ga0307412_100810521 336
767 3300032002 Ga0307416_100207257 Ga0307416_1002072572 336
768 3300032002 Ga0307416_100298625 Ga0307416_1002986252 336
769 3300032002 Ga0307416_100315814 Ga0307416_1003158142 336
770 3300039447 Ga0436361_0442878 Ga0436361_0442878_2034_3074 336
771 3300042115 Ga0450911_000086 Ga0450911_000086_8740_9750 336
772 3300046460 Ga0495638_0062390 Ga0495638_0062390_412_1422 336
773 3300046512 Ga0495610_0059988 Ga0495610_0059988_89_1099 336
774 3300046513 Ga0495616_0002314 Ga0495616_0002314_1388_2398 336
775 3300046515 Ga0495620_0071760 Ga0495620_0071760_369_1379 336
776 3300046518 Ga0495631_0000007 Ga0495631_0000007_15045_16055 336
777 3300046520 Ga0495637_0001478 Ga0495637_0001478_7991_9001 336
778 3300046530 Ga0495654_0009711 Ga0495654_0009711_564_1574 336
779 3300046535 Ga0495586_0187961 Ga0495586_0187961_108_1118 336
780 3300046615 Ga0495656_0000306 Ga0495656_0000306_3448_4458 336
781 3300046660 Ga0495625_0009663 Ga0495625_0009663_5978_6988 336
782 3300046660 Ga0495625_0132954 Ga0495625_0132954_329_1339 336
783 3300047673 Ga0495593_0019591 Ga0495593_0019591_515_1525 336
784 3300048089 Ga0495614_0059770 Ga0495614_0059770_42_1052 336
785 3300048904 Ga0496101_0109160 Ga0496101_0109160_503_1513 336
786 3300048907 Ga0496104_0015936 Ga0496104_0015936_277_1287 336
787 3300048908 Ga0496105_0000920 Ga0496105_0000920_1386_2396 336
788 3300048909 Ga0496106_0036283 Ga0496106_0036283_1058_2068 336
789 3300048913 Ga0496110_0039713 Ga0496110_0039713_2938_3948 336
790 3300048914 Ga0496111_0042384 Ga0496111_0042384_30_1040 336
791 3300048914 Ga0496111_0092460 Ga0496111_0092460_245_1255 336
792 3300048919 Ga0496116_0056363 Ga0496116_0056363_1469_2479 336
793 3300048919 Ga0496116_0147132 Ga0496116_0147132_116_1126 336
794 3300048920 Ga0496117_0051388 Ga0496117_0051388_732_1742 336
795 3300048924 Ga0496121_0076246 Ga0496121_0076246_727_1737 336
796 3300048925 Ga0496122_0001985 Ga0496122_0001985_18259_19269 336
797 3300048926 Ga0496123_0000108 Ga0496123_0000108_4097_5107 336
798 3300048928 Ga0496125_0008706 Ga0496125_0008706_9124_10134 336
799 3300050491 nmdc:mga00v17_22831_c1 nmdc:mga00v17_22831_c1_1809_2867 336
800 3300050496 nmdc:mga07m45_13078_c1 nmdc:mga07m45_13078_c1_800_1810 336
801 3300053079 Ga0500610_0020896 Ga0500610_0020896_968_1978 336
802 3300053087 Ga0500643_016204 Ga0500643_016204_31_1041 336
803 3300053093 Ga0500651_0000305 Ga0500651_0000305_8466_9476 336
804 3300053110 Ga0500571_004833 Ga0500571_004833_135_1145 336
805 3300053116 Ga0500592_003231 Ga0500592_003231_428_1438 336
806 3300053117 Ga0500593_027001 Ga0500593_027001_542_1552 336
807 3300053118 Ga0500594_0002897 Ga0500594_0002897_2600_3610 336
808 3300053121 Ga0500607_000744 Ga0500607_000744_17943_18953 336
809 3300053122 Ga0500608_027954 Ga0500608_027954_1060_2070 336
810 3300053125 Ga0500618_001391 Ga0500618_001391_8578_9630 336
811 3300053136 Ga0500559_0004612 Ga0500559_0004612_2946_3956 336
812 3300053139 Ga0500568_0000934 Ga0500568_0000934_18625_19635 336
813 3300053153 Ga0500616_0028639 Ga0500616_0028639_823_1833 336
814 3300053158 Ga0500627_0000537 Ga0500627_0000537_1201_2211 336
815 iso_pu_bacteria 2511231026 2511386711 336
816 iso_pu_bacteria 2738543012 2739241799 336
817 iso_pu_bacteria 2765235838 2765567248 336
818 iso_pu_bacteria 2808606386 2808984135 336
819 iso_pu_bacteria 2808606415 2809131939 336
820 iso_pu_bacteria 2808606419 2809151562 336
821 iso_pu_bacteria 2816332133 2816470896 336
822 iso_pu_bacteria 2839094727 2839095190 336
823 iso_pu_bacteria 2852618963 2852622979 336
824 iso_pu_bacteria 2855730933 2855732684 336
825 iso_pu_bacteria 2855767633 2855771436 336
826 iso_pu_bacteria 2919046199 2919051158 336
827 3300001979 JGI24740J21852_10021376 JGI24740J21852_100213761 337
828 3300025294 Ga0209025_1030131 Ga0209025_10301312 337
829 3300028800 Ga0265338_10001261 Ga0265338_1000126137 337
830 3300048919 Ga0496116_0053964 Ga0496116_0053964_489_1511 337
831 3300048920 Ga0496117_0062360 Ga0496117_0062360_235_1257 337
832 3300048921 Ga0496118_0007943 Ga0496118_0007943_9450_10463 337
833 3300053125 Ga0500618_005834 Ga0500618_005834_620_1696 337
834 iso_pu_bacteria 2547132374 2548499414 337
835 iso_pu_bacteria 2643221609 2644057527 337
836 iso_pu_bacteria 2643221611 2644072384 337
837 iso_pu_bacteria 2643221717 2644648073 337
838 iso_pu_bacteria 2643221733 2644730739 337
839 iso_pu_bacteria 2841760612 2841766372 337
840 iso_pu_bacteria 2841911363 2841916347 337
841 iso_pu_bacteria 2841917233 2841920984 337
842 iso_pu_bacteria 2844104063 2844106139 337
843 iso_pu_bacteria 2851182111 2851186640 337
844 iso_pu_bacteria 2851246043 2851246495 337
845 iso_pu_bacteria 2974320154 2974320762 337
846 iso_pu_bacteria 643348564 643600396 337
847 iso_pu_bacteria 8057529695 8057531298 337

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7998 26 325
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.785 26 325
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.779 30 327
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.7627 30 327
3qsl-assembly1.cif.gz_A structure of cae31940 from bordetella bronchiseptica rb50 0.7585 29 289
ID Description Score Start End Superfamily
3t66A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8659 66 90 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7657 30 323 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7627 30 329 3.40.190.10
4h65B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7618 27 297 3.40.190.10
4nmyB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7351 30 329 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A226X8Y2-F1-model_v4 Taurine-binding periplasmic protein TauA 0.993 40 337
AF-A0A226X8Y2-F1-model_v4 Taurine-binding periplasmic protein TauA 0.9864 40 337
AF-A0A3M2ZRZ6-F1-model_v4 ABC transporter periplasmic substrate-binding protein 0.984 97 337
AF-A0A3M2W264-F1-model_v4 deleted 0.983 67 302
AF-A0A4V2BIW2-F1-model_v4 deleted 0.9827 179 337

Feature Viewer

pLDDT pTM Quality
91.7 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map