F483245

General Info

Members Datasets Scaffolds Average Seq Length
845 274 1690 80

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100949094|Ga0068862_1009490941
Length 82
Sequence MFRKLLYTGQIEVDGRVFVAHYFEQKTARGGRRFSCEVVLDAGDRIILDDDSVTSLQAKIDRLAPATIYSRALASKSPSVAA

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 4.5
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 17.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100949094 3300005844 Bacteria 848
2 JGI24751J29686_10014920 3300002459 Unclassified 1603
3 JGI24751J29686_10100396 3300002459 Unclassified 604
4 Ga0058859_11823942 3300004798 Bacteria 721
5 Ga0058860_10039531 3300004801 Bacteria 906
6 Ga0058860_10040067 3300004801 Bacteria 898
7 Ga0058860_11931717 3300004801 Bacteria 593
8 Ga0058860_12225062 3300004801 Bacteria 1095
9 Ga0065704_10706095 3300005289 Bacteria 559
10 Ga0065712_10039047 3300005290 Bacteria 670
11 Ga0065712_10125594 3300005290 Bacteria 1612
12 Ga0065712_10590520 3300005290 Bacteria 596
13 Ga0065712_10822440 3300005290 Bacteria 505
14 Ga0065715_10207038 3300005293 Bacteria 1332
15 Ga0065715_10467841 3300005293 Bacteria 809
16 Ga0065715_10742062 3300005293 Bacteria 619
17 Ga0065707_10055109 3300005295 Bacteria 871
18 Ga0065707_10115467 3300005295 Bacteria 2260
19 Ga0070658_10321665 3300005327 Bacteria 1321
20 Ga0070676_10182443 3300005328 Bacteria 1365
21 Ga0070676_10225125 3300005328 Bacteria 1241
22 Ga0070683_100531524 3300005329 Bacteria 1124
23 Ga0070690_100001838 3300005330 Bacteria 11253
24 Ga0070690_100137424 3300005330 Unclassified 1656
25 Ga0070690_100434742 3300005330 Bacteria 970
26 Ga0070670_100044597 3300005331 Bacteria 3812
27 Ga0070670_100047753 3300005331 Bacteria 3684
28 Ga0070670_101784933 3300005331 Unclassified 566
29 Ga0068869_100221513 3300005334 Bacteria 1500
30 Ga0068869_100224031 3300005334 Bacteria 1492
31 Ga0068869_100440914 3300005334 Bacteria 1078
32 Ga0068869_100536517 3300005334 Bacteria 981
33 Ga0068869_100636841 3300005334 Unclassified 904
34 Ga0068869_101003690 3300005334 Bacteria 727
35 Ga0068869_101400410 3300005334 Bacteria 619
36 Ga0070666_10059340 3300005335 Bacteria 2588
37 Ga0070666_10114158 3300005335 Unclassified 1870
38 Ga0070666_10305476 3300005335 Bacteria 1133
39 Ga0070666_10963392 3300005335 Bacteria 632
40 Ga0070680_100162547 3300005336 Bacteria 1877
41 Ga0068868_100027748 3300005338 Bacteria 4320
42 Ga0068868_100112653 3300005338 Bacteria 2212
43 Ga0068868_100225404 3300005338 Bacteria 1570
44 Ga0068868_100848322 3300005338 Unclassified 827
45 Ga0070660_100013121 3300005339 Bacteria 5934
46 Ga0070689_100537141 3300005340 Unclassified 1006
47 Ga0070689_101692021 3300005340 Bacteria 576
48 Ga0070689_101921751 3300005340 Bacteria 541
49 Ga0070687_100056208 3300005343 Bacteria 2059
50 Ga0070687_100285276 3300005343 Bacteria 1041
51 Ga0070661_100403715 3300005344 Bacteria 1081
52 Ga0070661_100524770 3300005344 Bacteria 950
53 Ga0070661_101395658 3300005344 Unclassified 589
54 Ga0070692_10531767 3300005345 Bacteria 767
55 Ga0070692_11426524 3300005345 Bacteria 501
56 Ga0070668_100036133 3300005347 Bacteria 3770
57 Ga0070668_100622837 3300005347 Bacteria 946
58 Ga0070668_101477711 3300005347 Unclassified 621
59 Ga0070669_100052905 3300005353 Bacteria 2971
60 Ga0070669_100295112 3300005353 Bacteria 1302
61 Ga0070669_100325048 3300005353 Bacteria 1243
62 Ga0070669_100624497 3300005353 Bacteria 904
63 Ga0070675_100172664 3300005354 Unclassified 1865
64 Ga0070675_100329793 3300005354 Bacteria 1350
65 Ga0070675_101038837 3300005354 Bacteria 753
66 Ga0070675_101103390 3300005354 Bacteria 730
67 Ga0070671_100015986 3300005355 Bacteria 6062
68 Ga0070671_101222739 3300005355 Bacteria 661
69 Ga0070674_100000632 3300005356 Bacteria 17707
70 Ga0070674_100137676 3300005356 Bacteria 1828
71 Ga0070674_100192016 3300005356 Unclassified 1572
72 Ga0070674_100360429 3300005356 Bacteria 1177
73 Ga0070674_100575292 3300005356 Bacteria 948
74 Ga0070674_100886976 3300005356 Bacteria 776
75 Ga0070674_101983397 3300005356 Unclassified 530
76 Ga0070673_100078719 3300005364 Unclassified 2667
77 Ga0070673_100215033 3300005364 Bacteria 1661
78 Ga0070673_102002635 3300005364 Bacteria 550
79 Ga0070673_102121944 3300005364 Unclassified 534
80 Ga0070673_102392281 3300005364 Unclassified 502
81 Ga0070688_100077590 3300005365 Bacteria 2140
82 Ga0070688_100245138 3300005365 Bacteria 1274
83 Ga0070688_100556316 3300005365 Bacteria 873
84 Ga0070688_100791015 3300005365 Unclassified 741
85 Ga0070659_100116196 3300005366 Bacteria 2163
86 Ga0070659_100353076 3300005366 Bacteria 1234
87 Ga0070659_100586531 3300005366 Bacteria 957
88 Ga0070667_100099481 3300005367 Bacteria 2510
89 Ga0070667_101877047 3300005367 Unclassified 564
90 Ga0070709_10339070 3300005434 Bacteria 1108
91 Ga0070701_11160868 3300005438 Bacteria 546
92 Ga0070705_100251093 3300005440 Unclassified 1242
93 Ga0070705_100919514 3300005440 Bacteria 705
94 Ga0070705_101863412 3300005440 Bacteria 511
95 Ga0070700_100302729 3300005441 Bacteria 1168
96 Ga0070700_100840230 3300005441 Bacteria 743
97 Ga0070700_100927694 3300005441 Bacteria 711
98 Ga0070700_101596885 3300005441 Unclassified 557
99 Ga0070694_100010746 3300005444 Bacteria 5661
100 Ga0070694_100150790 3300005444 Bacteria 1698
101 Ga0070694_101610068 3300005444 Bacteria 551
102 Ga0070708_100032674 3300005445 Bacteria 4516
103 Ga0070708_100222074 3300005445 Bacteria 1772
104 Ga0070708_100404845 3300005445 Bacteria 1287
105 Ga0070708_100665548 3300005445 Bacteria 981
106 Ga0070663_101841034 3300005455 Bacteria 543
107 Ga0070678_101467980 3300005456 Bacteria 638
108 Ga0070662_100254190 3300005457 Bacteria 1414
109 Ga0070662_100648402 3300005457 Bacteria 891
110 Ga0070662_100813172 3300005457 Bacteria 795
111 Ga0070662_101555247 3300005457 Unclassified 571
112 Ga0070681_10107262 3300005458 Bacteria 2734
113 Ga0068867_100118885 3300005459 Bacteria 2040
114 Ga0068867_100164593 3300005459 Unclassified 1752
115 Ga0068867_100165967 3300005459 Bacteria 1745
116 Ga0068867_100282332 3300005459 Bacteria 1362
117 Ga0068867_100304228 3300005459 Bacteria 1315
118 Ga0068867_100592041 3300005459 Bacteria 966
119 Ga0068867_100892051 3300005459 Bacteria 799
120 Ga0068867_101076853 3300005459 Bacteria 733
121 Ga0068867_101634215 3300005459 Bacteria 603
122 Ga0068867_101639676 3300005459 Bacteria 602
123 Ga0068867_102320255 3300005459 Unclassified 510
124 Ga0070706_100492158 3300005467 Bacteria 1141
125 Ga0070706_100636913 3300005467 Unclassified 990
126 Ga0070706_100879916 3300005467 Bacteria 828
127 Ga0070706_101252229 3300005467 Bacteria 681
128 Ga0070706_101840964 3300005467 Unclassified 550
129 Ga0070707_100018149 3300005468 Bacteria 6621
130 Ga0070707_100079894 3300005468 Bacteria 3157
131 Ga0070707_100097221 3300005468 Bacteria 2852
132 Ga0070707_100200349 3300005468 Bacteria 1946
133 Ga0070707_100234053 3300005468 Bacteria 1788
134 Ga0070707_100443439 3300005468 Bacteria 1259
135 Ga0070707_100810510 3300005468 Bacteria 900
136 Ga0070707_100853444 3300005468 Unclassified 875
137 Ga0070707_101659867 3300005468 Bacteria 606
138 Ga0070698_100355107 3300005471 Bacteria 1397
139 Ga0070698_100410675 3300005471 Bacteria 1288
140 Ga0070698_100522793 3300005471 Bacteria 1125
141 Ga0070698_100838937 3300005471 Bacteria 864
142 Ga0070698_100890267 3300005471 Bacteria 836
143 Ga0070698_101200537 3300005471 Unclassified 708
144 Ga0070698_101676312 3300005471 Bacteria 588
145 Ga0070699_100062353 3300005518 Unclassified 3231
146 Ga0070699_100211434 3300005518 Bacteria 1727
147 Ga0070699_100564418 3300005518 Bacteria 1037
148 Ga0070699_100791271 3300005518 Bacteria 868
149 Ga0070699_100950931 3300005518 Bacteria 787
150 Ga0070699_101042503 3300005518 Unclassified 750
151 Ga0070679_100073428 3300005530 Bacteria 3412
152 Ga0070684_100071803 3300005535 Unclassified 3046
153 Ga0070684_100262562 3300005535 Bacteria 1580
154 Ga0070684_100925092 3300005535 Unclassified 817
155 Ga0070684_102044486 3300005535 Unclassified 541
156 Ga0070697_100152561 3300005536 Unclassified 1948
157 Ga0070697_100329153 3300005536 Bacteria 1317
158 Ga0070697_100418850 3300005536 Bacteria 1164
159 Ga0070697_100731732 3300005536 Unclassified 874
160 Ga0070697_100808263 3300005536 Bacteria 830
161 Ga0070697_101625351 3300005536 Unclassified 578
162 Ga0068853_100923900 3300005539 Bacteria 838
163 Ga0068853_101352656 3300005539 Bacteria 688
164 Ga0070672_100007154 3300005543 Bacteria 7550
165 Ga0070672_100177460 3300005543 Bacteria 1774
166 Ga0070672_100351977 3300005543 Bacteria 1256
167 Ga0070672_101823563 3300005543 Unclassified 547
168 Ga0070686_100002526 3300005544 Bacteria 10077
169 Ga0070686_100074852 3300005544 Bacteria 2226
170 Ga0070686_100282123 3300005544 Bacteria 1225
171 Ga0070686_101720257 3300005544 Unclassified 533
172 Ga0070686_101787230 3300005544 Bacteria 523
173 Ga0070695_100547070 3300005545 Unclassified 902
174 Ga0070695_100774943 3300005545 Unclassified 767
175 Ga0070696_100213709 3300005546 Unclassified 1445
176 Ga0070696_100395555 3300005546 Bacteria 1080
177 Ga0070696_100613150 3300005546 Bacteria 879
178 Ga0070696_101172741 3300005546 Bacteria 648
179 Ga0070696_101188101 3300005546 Bacteria 644
180 Ga0070696_101414523 3300005546 Unclassified 593
181 Ga0070693_100444950 3300005547 Bacteria 908
182 Ga0070693_100505271 3300005547 Bacteria 858
183 Ga0070665_100006941 3300005548 Bacteria 11513
184 Ga0070665_100018991 3300005548 Bacteria 6895
185 Ga0070665_100460371 3300005548 Bacteria 1282
186 Ga0070704_100085841 3300005549 Bacteria 2330
187 Ga0070704_100109869 3300005549 Bacteria 2096
188 Ga0070704_100957155 3300005549 Bacteria 773
189 Ga0068855_100031521 3300005563 Bacteria 6330
190 Ga0068855_100676781 3300005563 Bacteria 1106
191 Ga0068855_100863429 3300005563 Unclassified 958
192 Ga0070664_100793208 3300005564 Unclassified 885
193 Ga0070664_102254778 3300005564 Unclassified 517
194 Ga0068857_100069583 3300005577 Bacteria 3134
195 Ga0068854_100104001 3300005578 Bacteria 2133
196 Ga0068854_100172321 3300005578 Bacteria 1685
197 Ga0068854_100275947 3300005578 Bacteria 1351
198 Ga0068854_101007435 3300005578 Bacteria 738
199 Ga0068854_101552236 3300005578 Bacteria 602
200 Ga0068854_102008779 3300005578 Unclassified 533
201 Ga0070702_100128681 3300005615 Bacteria 1596
202 Ga0070702_100844655 3300005615 Bacteria 712
203 Ga0070702_101053641 3300005615 Bacteria 647
204 Ga0070702_101796066 3300005615 Unclassified 512
205 Ga0068852_100473737 3300005616 Bacteria 1243
206 Ga0068852_100953305 3300005616 Bacteria 876
207 Ga0068852_101505303 3300005616 Unclassified 695
208 Ga0068852_101789000 3300005616 Bacteria 637
209 Ga0068859_100012897 3300005617 Bacteria 8395
210 Ga0068859_100182160 3300005617 Bacteria 2183
211 Ga0068859_100601221 3300005617 Bacteria 1193
212 Ga0068859_101140368 3300005617 Bacteria 858
213 Ga0068859_101452690 3300005617 Bacteria 757
214 Ga0068859_101502161 3300005617 Bacteria 743
215 Ga0068859_102340496 3300005617 Bacteria 589
216 Ga0068864_100003828 3300005618 Bacteria 12403
217 Ga0068864_100048859 3300005618 Bacteria 3638
218 Ga0068864_100181650 3300005618 Bacteria 1924
219 Ga0068864_100210278 3300005618 Bacteria 1791
220 Ga0068864_100765015 3300005618 Bacteria 947
221 Ga0068864_100789480 3300005618 Bacteria 932
222 Ga0068866_10043239 3300005718 Bacteria 2247
223 Ga0068866_10052145 3300005718 Unclassified 2086
224 Ga0068866_10107241 3300005718 Bacteria 1552
225 Ga0068866_10139315 3300005718 Bacteria 1390
226 Ga0068866_10270887 3300005718 Bacteria 1048
227 Ga0068861_100083352 3300005719 Unclassified 2508
228 Ga0068861_100138576 3300005719 Bacteria 1983
229 Ga0068861_100286143 3300005719 Bacteria 1421
230 Ga0068861_100354072 3300005719 Bacteria 1289
231 Ga0068861_100812349 3300005719 Bacteria 878
232 Ga0068861_100868991 3300005719 Unclassified 852
233 Ga0068861_101161909 3300005719 Unclassified 745
234 Ga0068861_101632598 3300005719 Bacteria 636
235 Ga0068861_102710063 3300005719 Unclassified 500
236 Ga0068851_10177551 3300005834 Unclassified 1178
237 Ga0068851_10848212 3300005834 Unclassified 570
238 Ga0068870_10525490 3300005840 Bacteria 793
239 Ga0068870_10567764 3300005840 Unclassified 766
240 Ga0068863_100017124 3300005841 Bacteria 6951
241 Ga0068863_100251011 3300005841 Bacteria 1709
242 Ga0068863_100668939 3300005841 Bacteria 1030
243 Ga0068863_101143197 3300005841 Unclassified 784
244 Ga0068863_101983050 3300005841 Bacteria 592
245 Ga0068858_100009602 3300005842 Bacteria 9226
246 Ga0068858_100059840 3300005842 Unclassified 3521
247 Ga0068858_100087204 3300005842 Unclassified 2903
248 Ga0068858_100199922 3300005842 Bacteria 1890
249 Ga0068858_100374504 3300005842 Bacteria 1366
250 Ga0068858_100379338 3300005842 Bacteria 1357
251 Ga0068858_100584029 3300005842 Bacteria 1083
252 Ga0068858_100749027 3300005842 Bacteria 952
253 Ga0068858_101611879 3300005842 Bacteria 641
254 Ga0068858_101723989 3300005842 Bacteria 619
255 Ga0068860_100120185 3300005843 Bacteria 2515
256 Ga0068860_100359346 3300005843 Bacteria 1434
257 Ga0068860_100487677 3300005843 Bacteria 1229
258 Ga0068860_100514851 3300005843 Bacteria 1196
259 Ga0068860_101197772 3300005843 Unclassified 780
260 Ga0068860_101686268 3300005843 Bacteria 656
261 Ga0068860_101744059 3300005843 Bacteria 644
262 Ga0068860_102567792 3300005843 Unclassified 529
263 Ga0068860_102724312 3300005843 Bacteria 513
264 Ga0068862_100014119 3300005844 Bacteria 6623
265 Ga0068862_100207659 3300005844 Bacteria 1768
266 Ga0068862_100566548 3300005844 Bacteria 1086
267 Ga0068862_101895900 3300005844 Bacteria 606
268 Ga0068862_102116069 3300005844 Bacteria 574
269 Ga0081455_10012494 3300005937 Bacteria 8473
270 Ga0081455_10688582 3300005937 Bacteria 653
271 Ga0070716_101172071 3300006173 Bacteria 616
272 Ga0097621_100013239 3300006237 Bacteria 6141
273 Ga0097621_100021246 3300006237 Bacteria 5017
274 Ga0097621_100072996 3300006237 Bacteria 2839
275 Ga0097621_100090335 3300006237 Unclassified 2562
276 Ga0068871_100015841 3300006358 Bacteria 5659
277 Ga0068871_100023035 3300006358 Bacteria 4809
278 Ga0068871_100023910 3300006358 Bacteria 4734
279 Ga0068871_100040240 3300006358 Bacteria 3744
280 Ga0068871_100072749 3300006358 Bacteria 2832
281 Ga0068871_100635845 3300006358 Unclassified 973
282 Ga0068871_100750724 3300006358 Bacteria 897
283 Ga0068871_102257418 3300006358 Bacteria 519
284 Ga0075430_100740827 3300006846 Unclassified 810
285 Ga0075433_10003764 3300006852 Bacteria 11737
286 Ga0075433_10071290 3300006852 Bacteria 3054
287 Ga0075433_10404326 3300006852 Bacteria 1205
288 Ga0075433_11039739 3300006852 Bacteria 713
289 Ga0075434_100002064 3300006871 Bacteria 17458
290 Ga0075434_100064990 3300006871 Bacteria 3633
291 Ga0075434_100090337 3300006871 Bacteria 3064
292 Ga0075434_100189693 3300006871 Bacteria 2076
293 Ga0075434_101028257 3300006871 Bacteria 838
294 Ga0075434_101106405 3300006871 Bacteria 805
295 Ga0075434_102276298 3300006871 Bacteria 545
296 Ga0075429_100584973 3300006880 Bacteria 978
297 Ga0075429_101084222 3300006880 Bacteria 700
298 Ga0068865_100019991 3300006881 Bacteria 4340
299 Ga0068865_100181011 3300006881 Bacteria 1623
300 Ga0068865_101338265 3300006881 Bacteria 638
301 Ga0068865_101584574 3300006881 Bacteria 588
302 Ga0075436_100007597 3300006914 Bacteria 7407
303 Ga0075436_100024867 3300006914 Bacteria 4118
304 Ga0075436_100034469 3300006914 Bacteria 3490
305 Ga0075436_100053948 3300006914 Bacteria 2775
306 Ga0075436_100097476 3300006914 Bacteria 2045
307 Ga0075436_100117608 3300006914 Unclassified 1858
308 Ga0075436_100202653 3300006914 Bacteria 1405
309 Ga0097620_100012897 3300006931 Bacteria 8395
310 Ga0097620_100182168 3300006931 Bacteria 2183
311 Ga0097620_100601201 3300006931 Bacteria 1193
312 Ga0097620_101140273 3300006931 Bacteria 858
313 Ga0097620_101452554 3300006931 Bacteria 757
314 Ga0097620_101502211 3300006931 Bacteria 743
315 Ga0097620_102340788 3300006931 Bacteria 589
316 Ga0075435_100000505 3300007076 Bacteria 23796
317 Ga0075435_100000715 3300007076 Bacteria 20589
318 Ga0075435_100003794 3300007076 Bacteria 10303
319 Ga0075435_100053847 3300007076 Bacteria 3246
320 Ga0075435_100480033 3300007076 Bacteria 1074
321 Ga0075435_101266375 3300007076 Bacteria 646
322 Ga0075435_101529980 3300007076 Unclassified 585
323 Ga0099794_10088836 3300007265 Bacteria 1532
324 Ga0099794_10106213 3300007265 Bacteria 1404
325 Ga0105250_10105649 3300009092 Unclassified 1151
326 Ga0105240_10345442 3300009093 Bacteria 1689
327 Ga0105240_10429671 3300009093 Bacteria 1482
328 Ga0105240_10463349 3300009093 Unclassified 1416
329 Ga0105240_11186968 3300009093 Bacteria 809
330 Ga0105240_12419342 3300009093 Bacteria 543
331 Ga0111539_10399357 3300009094 Bacteria 1601
332 Ga0105245_10053457 3300009098 Bacteria 3625
333 Ga0105245_10087783 3300009098 Bacteria 2855
334 Ga0105245_10231436 3300009098 Bacteria 1788
335 Ga0105245_10333480 3300009098 Bacteria 1498
336 Ga0105245_10442960 3300009098 Bacteria 1306
337 Ga0105245_10684144 3300009098 Bacteria 1058
338 Ga0105245_10707738 3300009098 Bacteria 1041
339 Ga0105245_11173339 3300009098 Unclassified 815
340 Ga0105245_12674910 3300009098 Bacteria 552
341 Ga0105247_10005658 3300009101 Bacteria 7832
342 Ga0105247_10176911 3300009101 Bacteria 1422
343 Ga0105247_10518432 3300009101 Unclassified 871
344 Ga0105247_10757368 3300009101 Bacteria 737
345 Ga0114129_10011661 3300009147 Bacteria 12508
346 Ga0114129_10025528 3300009147 Bacteria 8372
347 Ga0114129_10063340 3300009147 Bacteria 5163
348 Ga0114129_10081465 3300009147 Bacteria 4499
349 Ga0114129_10084188 3300009147 Unclassified 4416
350 Ga0114129_11358914 3300009147 Bacteria 878
351 Ga0114129_12422103 3300009147 Bacteria 628
352 Ga0114129_13465443 3300009147 Unclassified 505
353 Ga0105243_10023543 3300009148 Bacteria 4692
354 Ga0105243_11164089 3300009148 Bacteria 782
355 Ga0105243_12064576 3300009148 Unclassified 605
356 Ga0105243_12157220 3300009148 Bacteria 593
357 Ga0105243_12664768 3300009148 Bacteria 540
358 Ga0105241_10013522 3300009174 Bacteria 5980
359 Ga0105241_10766717 3300009174 Bacteria 886
360 Ga0105241_10850703 3300009174 Bacteria 844
361 Ga0105242_10000877 3300009176 Bacteria 23362
362 Ga0105242_10086370 3300009176 Bacteria 2632
363 Ga0105242_10227175 3300009176 Unclassified 1671
364 Ga0105242_10463141 3300009176 Bacteria 1198
365 Ga0105242_10753337 3300009176 Bacteria 959
366 Ga0105242_10986027 3300009176 Bacteria 849
367 Ga0105242_11267288 3300009176 Bacteria 759
368 Ga0105242_11302169 3300009176 Bacteria 750
369 Ga0105248_10003787 3300009177 Bacteria 16756
370 Ga0105248_10008617 3300009177 Bacteria 11201
371 Ga0105248_10008818 3300009177 Bacteria 11077
372 Ga0105248_10054413 3300009177 Bacteria 4488
373 Ga0105248_10054434 3300009177 Bacteria 4487
374 Ga0105248_10064994 3300009177 Unclassified 4095
375 Ga0105248_10179948 3300009177 Bacteria 2382
376 Ga0105248_10293003 3300009177 Bacteria 1832
377 Ga0105248_10297601 3300009177 Bacteria 1817
378 Ga0105248_10382977 3300009177 Bacteria 1584
379 Ga0105248_10702313 3300009177 Bacteria 1141
380 Ga0105248_10971443 3300009177 Bacteria 959
381 Ga0105248_11383500 3300009177 Bacteria 796
382 Ga0105248_11620525 3300009177 Bacteria 733
383 Ga0105248_12172996 3300009177 Unclassified 631
384 Ga0105248_13133701 3300009177 Bacteria 526
385 Ga0105237_11522718 3300009545 Bacteria 676
386 Ga0105238_10129790 3300009551 Bacteria 2498
387 Ga0105238_10278006 3300009551 Bacteria 1655
388 Ga0105238_10314373 3300009551 Bacteria 1551
389 Ga0105238_11425215 3300009551 Bacteria 720
390 Ga0105249_10374626 3300009553 Bacteria 1448
391 Ga0105249_10467709 3300009553 Bacteria 1302
392 Ga0105249_10499926 3300009553 Unclassified 1261
393 Ga0105249_11025596 3300009553 Bacteria 894
394 Ga0105249_11063829 3300009553 Bacteria 879
395 Ga0105249_12221770 3300009553 Unclassified 621
396 Ga0105249_12775023 3300009553 Unclassified 562
397 Ga0105249_13541040 3300009553 Bacteria 503
398 Ga0105239_11759922 3300010375 Bacteria 718
399 Ga0105239_12516262 3300010375 Bacteria 600
400 Ga0105246_10032232 3300011119 Bacteria 3474
401 Ga0105246_11988407 3300011119 Unclassified 560
402 Ga0105246_12127050 3300011119 Bacteria 544
403 Ga0157374_10081560 3300013296 Unclassified 3069
404 Ga0157374_11710184 3300013296 Unclassified 654
405 Ga0157374_12209809 3300013296 Unclassified 577
406 Ga0157378_10270251 3300013297 Bacteria 1635
407 Ga0157378_10402279 3300013297 Bacteria 1349
408 Ga0157378_11371539 3300013297 Bacteria 749
409 Ga0157378_11391567 3300013297 Bacteria 744
410 Ga0157378_11393436 3300013297 Bacteria 744
411 Ga0163162_10156230 3300013306 Unclassified 2401
412 Ga0163162_10285798 3300013306 Bacteria 1781
413 Ga0163162_10406340 3300013306 Bacteria 1494
414 Ga0163162_11263597 3300013306 Bacteria 838
415 Ga0163162_11612814 3300013306 Bacteria 740
416 Ga0163162_11856698 3300013306 Unclassified 689
417 Ga0157375_10369082 3300013308 Unclassified 1601
418 Ga0157375_10513038 3300013308 Bacteria 1362
419 Ga0157375_10984016 3300013308 Bacteria 984
420 Ga0157375_11622648 3300013308 Bacteria 765
421 Ga0163163_10004146 3300014325 Bacteria 12344
422 Ga0163163_10131273 3300014325 Bacteria 2545
423 Ga0163163_10593651 3300014325 Bacteria 1171
424 Ga0163163_10610325 3300014325 Unclassified 1154
425 Ga0163163_10790057 3300014325 Bacteria 1012
426 Ga0157380_10036447 3300014326 Bacteria 3805
427 Ga0157380_10152819 3300014326 Unclassified 1997
428 Ga0157380_10226930 3300014326 Bacteria 1674
429 Ga0157380_10468086 3300014326 Bacteria 1215
430 Ga0157380_10990837 3300014326 Bacteria 873
431 Ga0157380_12760826 3300014326 Unclassified 558
432 Ga0157380_12969105 3300014326 Bacteria 540
433 Ga0157377_10172096 3300014745 Unclassified 1355
434 Ga0157377_10458632 3300014745 Bacteria 881
435 Ga0157379_10010968 3300014968 Bacteria 7903
436 Ga0157379_10020104 3300014968 Bacteria 5901
437 Ga0157379_10036609 3300014968 Bacteria 4375
438 Ga0157379_10193778 3300014968 Bacteria 1837
439 Ga0157379_10301809 3300014968 Bacteria 1459
440 Ga0157376_10023196 3300014969 Bacteria 4854
441 Ga0157376_10029588 3300014969 Bacteria 4363
442 Ga0157376_10067169 3300014969 Unclassified 3032
443 Ga0157376_10083033 3300014969 Bacteria 2755
444 Ga0157376_10210832 3300014969 Bacteria 1793
445 Ga0157376_12003990 3300014969 Bacteria 617
446 Ga0157376_13021515 3300014969 Unclassified 509
447 Ga0182007_10050564 3300015262 Bacteria 1372
448 Ga0163161_10323049 3300017792 Bacteria 1221
449 Ga0163161_10561790 3300017792 Bacteria 936
450 Ga0207697_10061702 3300025315 Bacteria 1560
451 Ga0207682_10090265 3300025893 Bacteria 1327
452 Ga0207642_10021998 3300025899 Unclassified 2521
453 Ga0207642_10089216 3300025899 Bacteria 1519
454 Ga0207642_10114721 3300025899 Bacteria 1378
455 Ga0207642_10253369 3300025899 Bacteria 1000
456 Ga0207710_10255190 3300025900 Bacteria 877
457 Ga0207710_10325682 3300025900 Bacteria 780
458 Ga0207688_10418487 3300025901 Bacteria 832
459 Ga0207680_10085583 3300025903 Bacteria 1992
460 Ga0207680_10190396 3300025903 Unclassified 1392
461 Ga0207680_10364007 3300025903 Bacteria 1017
462 Ga0207680_10719722 3300025903 Bacteria 715
463 Ga0207680_10950978 3300025903 Bacteria 616
464 Ga0207699_10808729 3300025906 Bacteria 689
465 Ga0207645_10214501 3300025907 Bacteria 1268
466 Ga0207645_10440107 3300025907 Bacteria 879
467 Ga0207643_10279323 3300025908 Bacteria 1035
468 Ga0207643_11094969 3300025908 Bacteria 514
469 Ga0207705_10298902 3300025909 Bacteria 1234
470 Ga0207684_10402733 3300025910 Bacteria 1176
471 Ga0207684_10481060 3300025910 Bacteria 1065
472 Ga0207684_10889279 3300025910 Unclassified 749
473 Ga0207654_10084891 3300025911 Bacteria 1915
474 Ga0207654_10283292 3300025911 Bacteria 1122
475 Ga0207654_10956022 3300025911 Bacteria 622
476 Ga0207707_10021042 3300025912 Bacteria 5698
477 Ga0207695_10339858 3300025913 Bacteria 1389
478 Ga0207695_10672619 3300025913 Bacteria 916
479 Ga0207695_10843210 3300025913 Bacteria 796
480 Ga0207695_10985515 3300025913 Bacteria 722
481 Ga0207695_11549352 3300025913 Bacteria 543
482 Ga0207660_10098152 3300025917 Bacteria 2184
483 Ga0207662_10096035 3300025918 Bacteria 1830
484 Ga0207657_10011433 3300025919 Bacteria 8812
485 Ga0207649_10168911 3300025920 Bacteria 1522
486 Ga0207649_10357511 3300025920 Bacteria 1083
487 Ga0207652_10214789 3300025921 Bacteria 1732
488 Ga0207646_10020547 3300025922 Bacteria 6116
489 Ga0207646_10056275 3300025922 Bacteria 3516
490 Ga0207646_10109566 3300025922 Bacteria 2477
491 Ga0207646_10540338 3300025922 Bacteria 1048
492 Ga0207646_10642503 3300025922 Unclassified 951
493 Ga0207646_10654350 3300025922 Bacteria 941
494 Ga0207646_10910383 3300025922 Bacteria 780
495 Ga0207681_10114905 3300025923 Bacteria 1964
496 Ga0207681_10131103 3300025923 Bacteria 1853
497 Ga0207681_10278546 3300025923 Bacteria 1316
498 Ga0207694_10080190 3300025924 Bacteria 2561
499 Ga0207694_10247829 3300025924 Bacteria 1457
500 Ga0207650_10114891 3300025925 Bacteria 2088
501 Ga0207650_10373602 3300025925 Bacteria 1176
502 Ga0207659_10381902 3300025926 Bacteria 1175
503 Ga0207659_10407126 3300025926 Bacteria 1139
504 Ga0207659_10548192 3300025926 Bacteria 983
505 Ga0207659_10699748 3300025926 Bacteria 868
506 Ga0207687_10030706 3300025927 Bacteria 3625
507 Ga0207687_10053795 3300025927 Bacteria 2814
508 Ga0207687_10123135 3300025927 Bacteria 1942
509 Ga0207687_10503356 3300025927 Bacteria 1011
510 Ga0207687_11591337 3300025927 Bacteria 561
511 Ga0207687_11624279 3300025927 Unclassified 555
512 Ga0207644_10016786 3300025931 Bacteria 4930
513 Ga0207690_10110540 3300025932 Bacteria 1979
514 Ga0207690_11605619 3300025932 Unclassified 543
515 Ga0207706_10029965 3300025933 Unclassified 4856
516 Ga0207706_10230683 3300025933 Bacteria 1620
517 Ga0207706_10587067 3300025933 Bacteria 958
518 Ga0207706_10639578 3300025933 Bacteria 912
519 Ga0207706_11044774 3300025933 Bacteria 685
520 Ga0207686_10003883 3300025934 Bacteria 8016
521 Ga0207686_10013171 3300025934 Bacteria 4570
522 Ga0207686_10503625 3300025934 Unclassified 940
523 Ga0207709_10051113 3300025935 Bacteria 2532
524 Ga0207709_10280953 3300025935 Bacteria 1229
525 Ga0207709_10469994 3300025935 Unclassified 976
526 Ga0207709_10628227 3300025935 Bacteria 853
527 Ga0207670_10312317 3300025936 Bacteria 1234
528 Ga0207670_10348696 3300025936 Bacteria 1172
529 Ga0207670_11539477 3300025936 Bacteria 565
530 Ga0207669_10061110 3300025937 Bacteria 2313
531 Ga0207669_10071942 3300025937 Bacteria 2175
532 Ga0207669_10406873 3300025937 Bacteria 1067
533 Ga0207669_10721173 3300025937 Bacteria 821
534 Ga0207669_11440574 3300025937 Bacteria 587
535 Ga0207669_11613846 3300025937 Bacteria 554
536 Ga0207704_10040299 3300025938 Bacteria 2728
537 Ga0207704_10090975 3300025938 Bacteria 2004
538 Ga0207704_10183278 3300025938 Bacteria 1515
539 Ga0207704_10571833 3300025938 Bacteria 921
540 Ga0207704_10751120 3300025938 Bacteria 811
541 Ga0207704_10918537 3300025938 Bacteria 737
542 Ga0207665_10762164 3300025939 Bacteria 763
543 Ga0207691_10005213 3300025940 Bacteria 12548
544 Ga0207691_10129866 3300025940 Bacteria 2226
545 Ga0207691_10143000 3300025940 Bacteria 2107
546 Ga0207711_10049199 3300025941 Bacteria 3609
547 Ga0207711_10067434 3300025941 Bacteria 3097
548 Ga0207711_10074060 3300025941 Unclassified 2961
549 Ga0207711_10104881 3300025941 Unclassified 2506
550 Ga0207711_10133174 3300025941 Bacteria 2230
551 Ga0207711_10161842 3300025941 Bacteria 2027
552 Ga0207711_10166186 3300025941 Bacteria 2000
553 Ga0207711_10201200 3300025941 Unclassified 1817
554 Ga0207711_10547460 3300025941 Bacteria 1079
555 Ga0207711_11009451 3300025941 Bacteria 772
556 Ga0207689_10021192 3300025942 Bacteria 5464
557 Ga0207689_10087644 3300025942 Bacteria 2557
558 Ga0207689_10132863 3300025942 Bacteria 2049
559 Ga0207689_10182944 3300025942 Bacteria 1728
560 Ga0207689_10783710 3300025942 Unclassified 805
561 Ga0207689_11164504 3300025942 Bacteria 649
562 Ga0207661_10475397 3300025944 Bacteria 1140
563 Ga0207667_10303405 3300025949 Bacteria 1631
564 Ga0207667_10539802 3300025949 Bacteria 1180
565 Ga0207651_10011352 3300025960 Bacteria 4985
566 Ga0207651_10140904 3300025960 Bacteria 1862
567 Ga0207651_10580943 3300025960 Bacteria 977
568 Ga0207651_10583942 3300025960 Bacteria 975
569 Ga0207651_10879308 3300025960 Unclassified 797
570 Ga0207651_11587016 3300025960 Bacteria 589
571 Ga0207712_10047144 3300025961 Bacteria 2990
572 Ga0207712_10284044 3300025961 Bacteria 1351
573 Ga0207712_10487919 3300025961 Bacteria 1051
574 Ga0207712_10565128 3300025961 Unclassified 980
575 Ga0207712_11672249 3300025961 Bacteria 571
576 Ga0207712_11830285 3300025961 Unclassified 544
577 Ga0207712_12107085 3300025961 Bacteria 504
578 Ga0207668_10298594 3300025972 Bacteria 1328
579 Ga0207668_10480110 3300025972 Bacteria 1066
580 Ga0207668_10813614 3300025972 Bacteria 828
581 Ga0207640_10036329 3300025981 Bacteria 3092
582 Ga0207640_10265496 3300025981 Bacteria 1340
583 Ga0207640_10270077 3300025981 Bacteria 1330
584 Ga0207658_10180780 3300025986 Bacteria 1745
585 Ga0207658_10626609 3300025986 Bacteria 968
586 Ga0207658_11651091 3300025986 Bacteria 586
587 Ga0207677_10071539 3300026023 Unclassified 2448
588 Ga0207677_10384839 3300026023 Bacteria 1185
589 Ga0207677_10683847 3300026023 Bacteria 909
590 Ga0207677_10782129 3300026023 Bacteria 853
591 Ga0207677_10888461 3300026023 Unclassified 803
592 Ga0207677_11449194 3300026023 Bacteria 633
593 Ga0207703_10024471 3300026035 Bacteria 4750
594 Ga0207703_10042263 3300026035 Bacteria 3656
595 Ga0207703_10087466 3300026035 Unclassified 2613
596 Ga0207703_10113769 3300026035 Unclassified 2313
597 Ga0207703_10231277 3300026035 Bacteria 1657
598 Ga0207703_10406756 3300026035 Bacteria 1264
599 Ga0207703_10665652 3300026035 Bacteria 988
600 Ga0207703_11032471 3300026035 Bacteria 789
601 Ga0207703_11612966 3300026035 Unclassified 624
602 Ga0207703_11621613 3300026035 Unclassified 622
603 Ga0207639_10298697 3300026041 Bacteria 1423
604 Ga0207708_10509272 3300026075 Bacteria 1010
605 Ga0207708_10753759 3300026075 Bacteria 836
606 Ga0207708_10810872 3300026075 Bacteria 806
607 Ga0207708_10869046 3300026075 Bacteria 779
608 Ga0207702_11117612 3300026078 Bacteria 782
609 Ga0207641_10001024 3300026088 Bacteria 28379
610 Ga0207641_10210023 3300026088 Bacteria 1800
611 Ga0207641_10216394 3300026088 Bacteria 1774
612 Ga0207641_10682715 3300026088 Bacteria 1010
613 Ga0207641_11022443 3300026088 Bacteria 823
614 Ga0207641_11867763 3300026088 Bacteria 602
615 Ga0207648_10038920 3300026089 Bacteria 4183
616 Ga0207648_10065326 3300026089 Bacteria 3172
617 Ga0207648_10104213 3300026089 Bacteria 2487
618 Ga0207648_10324200 3300026089 Unclassified 1385
619 Ga0207648_10574448 3300026089 Bacteria 1037
620 Ga0207648_10728597 3300026089 Bacteria 920
621 Ga0207648_10803165 3300026089 Bacteria 876
622 Ga0207648_10808568 3300026089 Bacteria 873
623 Ga0207648_10936938 3300026089 Bacteria 810
624 Ga0207648_12223372 3300026089 Bacteria 509
625 Ga0207676_10008467 3300026095 Bacteria 7312
626 Ga0207676_10072343 3300026095 Bacteria 2771
627 Ga0207676_10083168 3300026095 Bacteria 2606
628 Ga0207676_10432195 3300026095 Bacteria 1237
629 Ga0207676_10641226 3300026095 Bacteria 1024
630 Ga0207676_11054307 3300026095 Unclassified 802
631 Ga0207676_11625046 3300026095 Unclassified 644
632 Ga0207674_10047386 3300026116 Bacteria 4407
633 Ga0207675_100026411 3300026118 Bacteria 5406
634 Ga0207675_100081841 3300026118 Unclassified 3028
635 Ga0207675_100119513 3300026118 Bacteria 2493
636 Ga0207675_100183512 3300026118 Bacteria 2005
637 Ga0207675_100272522 3300026118 Bacteria 1643
638 Ga0207675_100330867 3300026118 Bacteria 1489
639 Ga0207675_101141021 3300026118 Bacteria 799
640 Ga0207675_101944827 3300026118 Unclassified 606
641 Ga0207683_10103054 3300026121 Bacteria 2549
642 Ga0207683_11355206 3300026121 Bacteria 658
643 Ga0207698_11293378 3300026142 Bacteria 744
644 Ga0207698_11605818 3300026142 Bacteria 666
645 Ga0207698_11614364 3300026142 Unclassified 664
646 Ga0207698_11793139 3300026142 Bacteria 629
647 Ga0268266_10010113 3300028379 Bacteria 8271
648 Ga0268266_10291258 3300028379 Bacteria 1520
649 Ga0268266_10595583 3300028379 Bacteria 1062
650 Ga0268265_10013664 3300028380 Bacteria 5523
651 Ga0268265_10060235 3300028380 Bacteria 2908
652 Ga0268265_10175296 3300028380 Bacteria 1837
653 Ga0268265_10306311 3300028380 Bacteria 1432
654 Ga0268265_10679270 3300028380 Bacteria 993
655 Ga0268264_10080561 3300028381 Unclassified 2780
656 Ga0268264_10279444 3300028381 Bacteria 1563
657 Ga0268264_10298038 3300028381 Bacteria 1517
658 Ga0268264_10452855 3300028381 Bacteria 1244
659 Ga0268264_10672291 3300028381 Bacteria 1026
660 Ga0268264_10783909 3300028381 Bacteria 951
661 Ga0268264_10951044 3300028381 Unclassified 864
662 Ga0268264_10974231 3300028381 Unclassified 854
663 Ga0268264_11063623 3300028381 Unclassified 817
664 Ga0268264_11436495 3300028381 Unclassified 700
665 Ga0307408_100403615 3300031548 Unclassified 1174
666 Ga0307406_10993381 3300031901 Unclassified 720
667 Ga0373930_0000351 3300034816 Bacteria 5998
668 Ga0373948_0000434 3300034817 Bacteria 5174
669 Ga0373948_0059039 3300034817 Bacteria 839
670 Ga0373958_0001232 3300034819 Bacteria 3425
671 Ga0373958_0065540 3300034819 Bacteria 796
672 Ga0373938_0000370 3300034957 Bacteria 7215
673 Ga0373928_0001385 3300035084 Bacteria 4732
674 Ga0373929_0000309 3300035085 Bacteria 9081
675 Ga0373940_0001507 3300035088 Bacteria 4238
676 Ga0373940_0039725 3300035088 Bacteria 1289
677 Ga0373940_0182031 3300035088 Bacteria 683
678 Ga0373944_0024922 3300035089 Bacteria 1758
679 Ga0373949_0002097 3300035090 Bacteria 5257
680 Ga0373951_0003078 3300035091 Bacteria 4115
681 Ga0373952_0002232 3300035092 Bacteria 3490
682 Ga0373932_0000435 3300035112 Bacteria 12757
683 Ga0373936_0208028 3300035113 Bacteria 865
684 Ga0373939_0001501 3300035114 Bacteria 5656
685 Ga0373939_0066860 3300035114 Bacteria 1160
686 Ga0373941_0000480 3300035115 Bacteria 7973
687 Ga0373941_0031918 3300035115 Bacteria 1573
688 Ga0373945_0070297 3300035116 Bacteria 1324
689 Ga0373953_0180905 3300035117 Unclassified 909
690 Ga0373954_0234721 3300035118 Bacteria 903
691 Ga0373956_0198864 3300035119 Unclassified 950
692 Ga0373957_0141843 3300035120 Bacteria 983
693 Ga0373960_0013223 3300035121 Bacteria 2066
694 Ga0373946_0209483 3300035171 Bacteria 937
695 Ga0373955_0070998 3300035172 Unclassified 1947
696 Ga0373942_0001153 3300035207 Bacteria 7014
697 Ga0373961_0000482 3300035241 Bacteria 15557
698 Ga0373961_0035881 3300035241 Bacteria 1409
699 Ga0373962_0000900 3300035242 Bacteria 6795
700 Ga0373962_0237831 3300035242 Bacteria 628
701 Ga0373924_0026623 3300035410 Bacteria 2295
702 Ga0373931_0003635 3300035691 Bacteria 6964
703 Ga0373931_0182318 3300035691 Bacteria 1244
704 Ga0373935_0123223 3300035692 Bacteria 1734
705 Ga0373935_0197505 3300035692 Bacteria 1389
706 Ga0373935_1445413 3300035692 Unclassified 514
707 Ga0373933_0471296 3300035724 Bacteria 822
708 Ga0373947_0078526 3300035725 Bacteria 2038
709 Ga0373947_0803087 3300035725 Bacteria 642
710 Ga0373947_0892906 3300035725 Unclassified 607
711 Ga0373937_0056273 3300036401 Bacteria 3612
712 Ga0373937_0240733 3300036401 Bacteria 1705
713 Ga0373937_0672907 3300036401 Bacteria 981
714 Ga0373937_1245161 3300036401 Unclassified 692
715 Ga0373925_0076824 3300037068 Bacteria 2534
716 Ga0373925_0628354 3300037068 Bacteria 885
717 Ga0436365_1653332 3300039437 Bacteria 559
718 Ga0436363_0895321 3300039450 Bacteria 603
719 Ga0451800_1001610 3300041459 Unclassified 620
720 Ga0451841_1351648 3300041498 Unclassified 738
721 Ga0451855_1295889 3300041511 Bacteria 609
722 Ga0466961_0404871 3300044693 Bacteria 828
723 Ga0466963_0135605 3300044694 Bacteria 1703
724 Ga0466963_0258040 3300044694 Bacteria 1224
725 Ga0451576_0014477 3300045051 Bacteria 8777
726 Ga0451576_1331443 3300045051 Bacteria 748
727 Ga0466967_1522461 3300045976 Bacteria 666
728 Ga0495592_0232140 3300046454 Bacteria 1228
729 Ga0495603_0417420 3300046455 Bacteria 769
730 Ga0495629_0043282 3300046459 Unclassified 3162
731 Ga0495629_0189619 3300046459 Bacteria 1423
732 Ga0495651_0346228 3300046462 Bacteria 983
733 Ga0495580_0247411 3300046472 Bacteria 1221
734 Ga0495582_0062098 3300046473 Bacteria 2064
735 Ga0495582_0806474 3300046473 Bacteria 543
736 Ga0495639_0098835 3300046475 Bacteria 1376
737 Ga0495664_0665576 3300046477 Bacteria 616
738 Ga0495608_0491719 3300046511 Unclassified 744
739 Ga0495628_0382282 3300046516 Unclassified 1031
740 Ga0495663_0039080 3300046525 Bacteria 1437
741 Ga0495666_0415269 3300046526 Bacteria 604
742 Ga0495642_0149853 3300046528 Bacteria 1009
743 Ga0495640_0057714 3300046533 Unclassified 2649
744 Ga0495586_0185593 3300046535 Unclassified 1177
745 Ga0495587_0163579 3300046536 Bacteria 1266
746 Ga0495621_0175545 3300046539 Bacteria 853
747 Ga0495645_0019308 3300046543 Bacteria 4907
748 Ga0495634_0650617 3300046642 Bacteria 609
749 Ga0495635_0459783 3300046663 Bacteria 841
750 Ga0495635_0587364 3300046663 Bacteria 728
751 Ga0495659_0153836 3300046664 Bacteria 925
752 Ga0495647_0107249 3300046681 Bacteria 1162
753 Ga0495658_0026673 3300046683 Unclassified 3099
754 Ga0495658_0184445 3300046683 Bacteria 1295
755 Ga0495658_0330182 3300046683 Unclassified 968
756 Ga0495669_0308608 3300046684 Bacteria 763
757 Ga0495669_0623990 3300046684 Bacteria 524
758 Ga0495613_0112944 3300046689 Bacteria 1956
759 Ga0495600_0034383 3300046809 Bacteria 3290
760 Ga0495674_0127878 3300047319 Bacteria 2142
761 Ga0495674_0839990 3300047319 Bacteria 712
762 Ga0495684_0167080 3300047471 Bacteria 1638
763 Ga0496101_0928989 3300048904 Bacteria 685
764 Ga0496101_1292905 3300048904 Bacteria 570
765 Ga0496102_0111032 3300048905 Bacteria 2556
766 Ga0496102_0179630 3300048905 Bacteria 1994
767 Ga0496103_0223282 3300048906 Bacteria 1212
768 Ga0496103_0691690 3300048906 Bacteria 647
769 Ga0496104_0085410 3300048907 Archaea 3012
770 Ga0496104_0132773 3300048907 Bacteria 2392
771 Ga0496105_0150962 3300048908 Unclassified 1910
772 Ga0496106_0181305 3300048909 Bacteria 1672
773 Ga0496106_0230055 3300048909 Bacteria 1480
774 Ga0496106_0794951 3300048909 Bacteria 751
775 Ga0496107_0107618 3300048910 Bacteria 2048
776 Ga0496107_0256339 3300048910 Bacteria 1302
777 Ga0496107_0571243 3300048910 Bacteria 837
778 Ga0496108_0094802 3300048911 Bacteria 2540
779 Ga0496109_0105687 3300048912 Bacteria 2615
780 Ga0496109_1089390 3300048912 Bacteria 736
781 Ga0496109_1199202 3300048912 Bacteria 696
782 Ga0496110_0149253 3300048913 Bacteria 2116
783 Ga0496111_0189483 3300048914 Bacteria 1529
784 Ga0496112_0062686 3300048915 Bacteria 3668
785 Ga0496112_0088310 3300048915 Bacteria 3068
786 Ga0496112_0093746 3300048915 Bacteria 2972
787 Ga0496112_0283375 3300048915 Bacteria 1604
788 Ga0496112_0410194 3300048915 Bacteria 1294
789 Ga0496112_0919958 3300048915 Bacteria 796
790 Ga0496112_1114374 3300048915 Bacteria 707
791 Ga0496112_1140489 3300048915 Unclassified 697
792 Ga0496112_1329959 3300048915 Bacteria 634
793 Ga0496113_0011566 3300048916 Bacteria 5896
794 Ga0496113_0917283 3300048916 Bacteria 692
795 Ga0496113_1112804 3300048916 Bacteria 619
796 Ga0496114_0093011 3300048917 Bacteria 2563
797 Ga0496114_0129727 3300048917 Bacteria 2176
798 Ga0496114_0597455 3300048917 Bacteria 973
799 Ga0496115_0062875 3300048918 Unclassified 2995
800 Ga0495682_0196947 3300049460 Bacteria 715
801 Ga0501079_0484389 3300049741 Bacteria 972
802 nmdc:mga05p37_133309_c1 3300050507 Bacteria 3048
803 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
804 nmdc:mga05p37_536941_c1 3300050507 Bacteria 1334
805 nmdc:mga05p37_614267_c1 3300050507 Bacteria 1225
806 nmdc:mga05p37_7621_c1 3300050507 Bacteria 12776
807 nmdc:mga05p37_89689_c1 3300050507 Unclassified 3789
808 nmdc:mga09592_272474_c1 3300050508 Bacteria 1468
809 nmdc:mga09592_563167_c1 3300050508 Bacteria 978
810 nmdc:mga0qj67_677418_c1 3300050509 Unclassified 821
811 nmdc:mga08y16_126998_c1 3300050511 Unclassified 2653
812 nmdc:mga08y16_1519328_c1 3300050511 Bacteria 630
813 nmdc:mga0n895_101089_c1 3300050512 Bacteria 2893
814 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
815 nmdc:mga0n895_1307031_c1 3300050512 Bacteria 696
816 nmdc:mga0n895_1324616_c1 3300050512 Bacteria 690
817 nmdc:mga0n895_2018047_c1 3300050512 Bacteria 534
818 nmdc:mga0n895_74470_c1 3300050512 Bacteria 3373
819 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
820 nmdc:mga0rr50_44298_c1 3300050513 Bacteria 3263
821 nmdc:mga0rr50_553_c1 3300050513 Bacteria 20105
822 nmdc:mga0rr50_796937_c1 3300050513 Unclassified 806
823 nmdc:mga0rr50_799844_c1 3300050513 Bacteria 804
824 nmdc:mga08x19_1056419_c1 3300050514 Bacteria 577
825 nmdc:mga08x19_128990_c1 3300050514 Unclassified 1700
826 nmdc:mga08x19_214_c1 3300050514 Bacteria 44063
827 nmdc:mga08x19_30522_c1 3300050514 Bacteria 3387
828 nmdc:mga08x19_31511_c1 3300050514 Bacteria 3335
829 nmdc:mga08x19_32982_c1 3300050514 Bacteria 3267
830 nmdc:mga08x19_357930_c1 3300050514 Bacteria 1020
831 nmdc:mga0a205_1578166_c1 3300050515 Bacteria 505
832 nmdc:mga0a205_174749_c1 3300050515 Bacteria 1394
833 nmdc:mga0a205_192395_c1 3300050515 Unclassified 1932
834 nmdc:mga0a205_202123_c1 3300050515 Bacteria 1877
835 nmdc:mga0a205_53787_c1 3300050515 Bacteria 3886
836 Ga0495601_0074791 3300053077 Bacteria 2168
837 Ga0495655_0024762 3300053083 Bacteria 1397
838 Ga0495595_0005420 3300053084 Bacteria 5166
839 Ga0495619_0042206 3300053085 Unclassified 2986
840 Ga0495619_0363079 3300053085 Bacteria 1001
841 Ga0500658_0514112 3300053134 Bacteria 541
842 Ga0501084_0151809 3300054114 Bacteria 1953
843 Ga0501084_1341093 3300054114 Bacteria 599
844 Ga0501082_0747383 3300060353 Bacteria 856
845 Ga0501082_0978310 3300060353 Bacteria 740
846 Ga0068862_100949094
847 JGI24751J29686_10014920
848 JGI24751J29686_10100396
849 Ga0058859_11823942
850 Ga0058860_10039531
851 Ga0058860_10040067
852 Ga0058860_11931717
853 Ga0058860_12225062
854 Ga0065704_10706095
855 Ga0065712_10039047
856 Ga0065712_10125594
857 Ga0065712_10590520
858 Ga0065712_10822440
859 Ga0065715_10207038
860 Ga0065715_10467841
861 Ga0065715_10742062
862 Ga0065707_10055109
863 Ga0065707_10115467
864 Ga0070658_10321665
865 Ga0070676_10182443
866 Ga0070676_10225125
867 Ga0070683_100531524
868 Ga0070690_100001838
869 Ga0070690_100137424
870 Ga0070690_100434742
871 Ga0070670_100044597
872 Ga0070670_100047753
873 Ga0070670_101784933
874 Ga0068869_100221513
875 Ga0068869_100224031
876 Ga0068869_100440914
877 Ga0068869_100536517
878 Ga0068869_100636841
879 Ga0068869_101003690
880 Ga0068869_101400410
881 Ga0070666_10059340
882 Ga0070666_10114158
883 Ga0070666_10305476
884 Ga0070666_10963392
885 Ga0070680_100162547
886 Ga0068868_100027748
887 Ga0068868_100112653
888 Ga0068868_100225404
889 Ga0068868_100848322
890 Ga0070660_100013121
891 Ga0070689_100537141
892 Ga0070689_101692021
893 Ga0070689_101921751
894 Ga0070687_100056208
895 Ga0070687_100285276
896 Ga0070661_100403715
897 Ga0070661_100524770
898 Ga0070661_101395658
899 Ga0070692_10531767
900 Ga0070692_11426524
901 Ga0070668_100036133
902 Ga0070668_100622837
903 Ga0070668_101477711
904 Ga0070669_100052905
905 Ga0070669_100295112
906 Ga0070669_100325048
907 Ga0070669_100624497
908 Ga0070675_100172664
909 Ga0070675_100329793
910 Ga0070675_101038837
911 Ga0070675_101103390
912 Ga0070671_100015986
913 Ga0070671_101222739
914 Ga0070674_100000632
915 Ga0070674_100137676
916 Ga0070674_100192016
917 Ga0070674_100360429
918 Ga0070674_100575292
919 Ga0070674_100886976
920 Ga0070674_101983397
921 Ga0070673_100078719
922 Ga0070673_100215033
923 Ga0070673_102002635
924 Ga0070673_102121944
925 Ga0070673_102392281
926 Ga0070688_100077590
927 Ga0070688_100245138
928 Ga0070688_100556316
929 Ga0070688_100791015
930 Ga0070659_100116196
931 Ga0070659_100353076
932 Ga0070659_100586531
933 Ga0070667_100099481
934 Ga0070667_101877047
935 Ga0070709_10339070
936 Ga0070701_11160868
937 Ga0070705_100251093
938 Ga0070705_100919514
939 Ga0070705_101863412
940 Ga0070700_100302729
941 Ga0070700_100840230
942 Ga0070700_100927694
943 Ga0070700_101596885
944 Ga0070694_100010746
945 Ga0070694_100150790
946 Ga0070694_101610068
947 Ga0070708_100032674
948 Ga0070708_100222074
949 Ga0070708_100404845
950 Ga0070708_100665548
951 Ga0070663_101841034
952 Ga0070678_101467980
953 Ga0070662_100254190
954 Ga0070662_100648402
955 Ga0070662_100813172
956 Ga0070662_101555247
957 Ga0070681_10107262
958 Ga0068867_100118885
959 Ga0068867_100164593
960 Ga0068867_100165967
961 Ga0068867_100282332
962 Ga0068867_100304228
963 Ga0068867_100592041
964 Ga0068867_100892051
965 Ga0068867_101076853
966 Ga0068867_101634215
967 Ga0068867_101639676
968 Ga0068867_102320255
969 Ga0070706_100492158
970 Ga0070706_100636913
971 Ga0070706_100879916
972 Ga0070706_101252229
973 Ga0070706_101840964
974 Ga0070707_100018149
975 Ga0070707_100079894
976 Ga0070707_100097221
977 Ga0070707_100200349
978 Ga0070707_100234053
979 Ga0070707_100443439
980 Ga0070707_100810510
981 Ga0070707_100853444
982 Ga0070707_101659867
983 Ga0070698_100355107
984 Ga0070698_100410675
985 Ga0070698_100522793
986 Ga0070698_100838937
987 Ga0070698_100890267
988 Ga0070698_101200537
989 Ga0070698_101676312
990 Ga0070699_100062353
991 Ga0070699_100211434
992 Ga0070699_100564418
993 Ga0070699_100791271
994 Ga0070699_100950931
995 Ga0070699_101042503
996 Ga0070679_100073428
997 Ga0070684_100071803
998 Ga0070684_100262562
999 Ga0070684_100925092
1000 Ga0070684_102044486
1001 Ga0070697_100152561
1002 Ga0070697_100329153
1003 Ga0070697_100418850
1004 Ga0070697_100731732
1005 Ga0070697_100808263
1006 Ga0070697_101625351
1007 Ga0068853_100923900
1008 Ga0068853_101352656
1009 Ga0070672_100007154
1010 Ga0070672_100177460
1011 Ga0070672_100351977
1012 Ga0070672_101823563
1013 Ga0070686_100002526
1014 Ga0070686_100074852
1015 Ga0070686_100282123
1016 Ga0070686_101720257
1017 Ga0070686_101787230
1018 Ga0070695_100547070
1019 Ga0070695_100774943
1020 Ga0070696_100213709
1021 Ga0070696_100395555
1022 Ga0070696_100613150
1023 Ga0070696_101172741
1024 Ga0070696_101188101
1025 Ga0070696_101414523
1026 Ga0070693_100444950
1027 Ga0070693_100505271
1028 Ga0070665_100006941
1029 Ga0070665_100018991
1030 Ga0070665_100460371
1031 Ga0070704_100085841
1032 Ga0070704_100109869
1033 Ga0070704_100957155
1034 Ga0068855_100031521
1035 Ga0068855_100676781
1036 Ga0068855_100863429
1037 Ga0070664_100793208
1038 Ga0070664_102254778
1039 Ga0068857_100069583
1040 Ga0068854_100104001
1041 Ga0068854_100172321
1042 Ga0068854_100275947
1043 Ga0068854_101007435
1044 Ga0068854_101552236
1045 Ga0068854_102008779
1046 Ga0070702_100128681
1047 Ga0070702_100844655
1048 Ga0070702_101053641
1049 Ga0070702_101796066
1050 Ga0068852_100473737
1051 Ga0068852_100953305
1052 Ga0068852_101505303
1053 Ga0068852_101789000
1054 Ga0068859_100012897
1055 Ga0068859_100182160
1056 Ga0068859_100601221
1057 Ga0068859_101140368
1058 Ga0068859_101452690
1059 Ga0068859_101502161
1060 Ga0068859_102340496
1061 Ga0068864_100003828
1062 Ga0068864_100048859
1063 Ga0068864_100181650
1064 Ga0068864_100210278
1065 Ga0068864_100765015
1066 Ga0068864_100789480
1067 Ga0068866_10043239
1068 Ga0068866_10052145
1069 Ga0068866_10107241
1070 Ga0068866_10139315
1071 Ga0068866_10270887
1072 Ga0068861_100083352
1073 Ga0068861_100138576
1074 Ga0068861_100286143
1075 Ga0068861_100354072
1076 Ga0068861_100812349
1077 Ga0068861_100868991
1078 Ga0068861_101161909
1079 Ga0068861_101632598
1080 Ga0068861_102710063
1081 Ga0068851_10177551
1082 Ga0068851_10848212
1083 Ga0068870_10525490
1084 Ga0068870_10567764
1085 Ga0068863_100017124
1086 Ga0068863_100251011
1087 Ga0068863_100668939
1088 Ga0068863_101143197
1089 Ga0068863_101983050
1090 Ga0068858_100009602
1091 Ga0068858_100059840
1092 Ga0068858_100087204
1093 Ga0068858_100199922
1094 Ga0068858_100374504
1095 Ga0068858_100379338
1096 Ga0068858_100584029
1097 Ga0068858_100749027
1098 Ga0068858_101611879
1099 Ga0068858_101723989
1100 Ga0068860_100120185
1101 Ga0068860_100359346
1102 Ga0068860_100487677
1103 Ga0068860_100514851
1104 Ga0068860_101197772
1105 Ga0068860_101686268
1106 Ga0068860_101744059
1107 Ga0068860_102567792
1108 Ga0068860_102724312
1109 Ga0068862_100014119
1110 Ga0068862_100207659
1111 Ga0068862_100566548
1112 Ga0068862_101895900
1113 Ga0068862_102116069
1114 Ga0081455_10012494
1115 Ga0081455_10688582
1116 Ga0070716_101172071
1117 Ga0097621_100013239
1118 Ga0097621_100021246
1119 Ga0097621_100072996
1120 Ga0097621_100090335
1121 Ga0068871_100015841
1122 Ga0068871_100023035
1123 Ga0068871_100023910
1124 Ga0068871_100040240
1125 Ga0068871_100072749
1126 Ga0068871_100635845
1127 Ga0068871_100750724
1128 Ga0068871_102257418
1129 Ga0075430_100740827
1130 Ga0075433_10003764
1131 Ga0075433_10071290
1132 Ga0075433_10404326
1133 Ga0075433_11039739
1134 Ga0075434_100002064
1135 Ga0075434_100064990
1136 Ga0075434_100090337
1137 Ga0075434_100189693
1138 Ga0075434_101028257
1139 Ga0075434_101106405
1140 Ga0075434_102276298
1141 Ga0075429_100584973
1142 Ga0075429_101084222
1143 Ga0068865_100019991
1144 Ga0068865_100181011
1145 Ga0068865_101338265
1146 Ga0068865_101584574
1147 Ga0075436_100007597
1148 Ga0075436_100024867
1149 Ga0075436_100034469
1150 Ga0075436_100053948
1151 Ga0075436_100097476
1152 Ga0075436_100117608
1153 Ga0075436_100202653
1154 Ga0097620_100012897
1155 Ga0097620_100182168
1156 Ga0097620_100601201
1157 Ga0097620_101140273
1158 Ga0097620_101452554
1159 Ga0097620_101502211
1160 Ga0097620_102340788
1161 Ga0075435_100000505
1162 Ga0075435_100000715
1163 Ga0075435_100003794
1164 Ga0075435_100053847
1165 Ga0075435_100480033
1166 Ga0075435_101266375
1167 Ga0075435_101529980
1168 Ga0099794_10088836
1169 Ga0099794_10106213
1170 Ga0105250_10105649
1171 Ga0105240_10345442
1172 Ga0105240_10429671
1173 Ga0105240_10463349
1174 Ga0105240_11186968
1175 Ga0105240_12419342
1176 Ga0111539_10399357
1177 Ga0105245_10053457
1178 Ga0105245_10087783
1179 Ga0105245_10231436
1180 Ga0105245_10333480
1181 Ga0105245_10442960
1182 Ga0105245_10684144
1183 Ga0105245_10707738
1184 Ga0105245_11173339
1185 Ga0105245_12674910
1186 Ga0105247_10005658
1187 Ga0105247_10176911
1188 Ga0105247_10518432
1189 Ga0105247_10757368
1190 Ga0114129_10011661
1191 Ga0114129_10025528
1192 Ga0114129_10063340
1193 Ga0114129_10081465
1194 Ga0114129_10084188
1195 Ga0114129_11358914
1196 Ga0114129_12422103
1197 Ga0114129_13465443
1198 Ga0105243_10023543
1199 Ga0105243_11164089
1200 Ga0105243_12064576
1201 Ga0105243_12157220
1202 Ga0105243_12664768
1203 Ga0105241_10013522
1204 Ga0105241_10766717
1205 Ga0105241_10850703
1206 Ga0105242_10000877
1207 Ga0105242_10086370
1208 Ga0105242_10227175
1209 Ga0105242_10463141
1210 Ga0105242_10753337
1211 Ga0105242_10986027
1212 Ga0105242_11267288
1213 Ga0105242_11302169
1214 Ga0105248_10003787
1215 Ga0105248_10008617
1216 Ga0105248_10008818
1217 Ga0105248_10054413
1218 Ga0105248_10054434
1219 Ga0105248_10064994
1220 Ga0105248_10179948
1221 Ga0105248_10293003
1222 Ga0105248_10297601
1223 Ga0105248_10382977
1224 Ga0105248_10702313
1225 Ga0105248_10971443
1226 Ga0105248_11383500
1227 Ga0105248_11620525
1228 Ga0105248_12172996
1229 Ga0105248_13133701
1230 Ga0105237_11522718
1231 Ga0105238_10129790
1232 Ga0105238_10278006
1233 Ga0105238_10314373
1234 Ga0105238_11425215
1235 Ga0105249_10374626
1236 Ga0105249_10467709
1237 Ga0105249_10499926
1238 Ga0105249_11025596
1239 Ga0105249_11063829
1240 Ga0105249_12221770
1241 Ga0105249_12775023
1242 Ga0105249_13541040
1243 Ga0105239_11759922
1244 Ga0105239_12516262
1245 Ga0105246_10032232
1246 Ga0105246_11988407
1247 Ga0105246_12127050
1248 Ga0157374_10081560
1249 Ga0157374_11710184
1250 Ga0157374_12209809
1251 Ga0157378_10270251
1252 Ga0157378_10402279
1253 Ga0157378_11371539
1254 Ga0157378_11391567
1255 Ga0157378_11393436
1256 Ga0163162_10156230
1257 Ga0163162_10285798
1258 Ga0163162_10406340
1259 Ga0163162_11263597
1260 Ga0163162_11612814
1261 Ga0163162_11856698
1262 Ga0157375_10369082
1263 Ga0157375_10513038
1264 Ga0157375_10984016
1265 Ga0157375_11622648
1266 Ga0163163_10004146
1267 Ga0163163_10131273
1268 Ga0163163_10593651
1269 Ga0163163_10610325
1270 Ga0163163_10790057
1271 Ga0157380_10036447
1272 Ga0157380_10152819
1273 Ga0157380_10226930
1274 Ga0157380_10468086
1275 Ga0157380_10990837
1276 Ga0157380_12760826
1277 Ga0157380_12969105
1278 Ga0157377_10172096
1279 Ga0157377_10458632
1280 Ga0157379_10010968
1281 Ga0157379_10020104
1282 Ga0157379_10036609
1283 Ga0157379_10193778
1284 Ga0157379_10301809
1285 Ga0157376_10023196
1286 Ga0157376_10029588
1287 Ga0157376_10067169
1288 Ga0157376_10083033
1289 Ga0157376_10210832
1290 Ga0157376_12003990
1291 Ga0157376_13021515
1292 Ga0182007_10050564
1293 Ga0163161_10323049
1294 Ga0163161_10561790
1295 Ga0207697_10061702
1296 Ga0207682_10090265
1297 Ga0207642_10021998
1298 Ga0207642_10089216
1299 Ga0207642_10114721
1300 Ga0207642_10253369
1301 Ga0207710_10255190
1302 Ga0207710_10325682
1303 Ga0207688_10418487
1304 Ga0207680_10085583
1305 Ga0207680_10190396
1306 Ga0207680_10364007
1307 Ga0207680_10719722
1308 Ga0207680_10950978
1309 Ga0207699_10808729
1310 Ga0207645_10214501
1311 Ga0207645_10440107
1312 Ga0207643_10279323
1313 Ga0207643_11094969
1314 Ga0207705_10298902
1315 Ga0207684_10402733
1316 Ga0207684_10481060
1317 Ga0207684_10889279
1318 Ga0207654_10084891
1319 Ga0207654_10283292
1320 Ga0207654_10956022
1321 Ga0207707_10021042
1322 Ga0207695_10339858
1323 Ga0207695_10672619
1324 Ga0207695_10843210
1325 Ga0207695_10985515
1326 Ga0207695_11549352
1327 Ga0207660_10098152
1328 Ga0207662_10096035
1329 Ga0207657_10011433
1330 Ga0207649_10168911
1331 Ga0207649_10357511
1332 Ga0207652_10214789
1333 Ga0207646_10020547
1334 Ga0207646_10056275
1335 Ga0207646_10109566
1336 Ga0207646_10540338
1337 Ga0207646_10642503
1338 Ga0207646_10654350
1339 Ga0207646_10910383
1340 Ga0207681_10114905
1341 Ga0207681_10131103
1342 Ga0207681_10278546
1343 Ga0207694_10080190
1344 Ga0207694_10247829
1345 Ga0207650_10114891
1346 Ga0207650_10373602
1347 Ga0207659_10381902
1348 Ga0207659_10407126
1349 Ga0207659_10548192
1350 Ga0207659_10699748
1351 Ga0207687_10030706
1352 Ga0207687_10053795
1353 Ga0207687_10123135
1354 Ga0207687_10503356
1355 Ga0207687_11591337
1356 Ga0207687_11624279
1357 Ga0207644_10016786
1358 Ga0207690_10110540
1359 Ga0207690_11605619
1360 Ga0207706_10029965
1361 Ga0207706_10230683
1362 Ga0207706_10587067
1363 Ga0207706_10639578
1364 Ga0207706_11044774
1365 Ga0207686_10003883
1366 Ga0207686_10013171
1367 Ga0207686_10503625
1368 Ga0207709_10051113
1369 Ga0207709_10280953
1370 Ga0207709_10469994
1371 Ga0207709_10628227
1372 Ga0207670_10312317
1373 Ga0207670_10348696
1374 Ga0207670_11539477
1375 Ga0207669_10061110
1376 Ga0207669_10071942
1377 Ga0207669_10406873
1378 Ga0207669_10721173
1379 Ga0207669_11440574
1380 Ga0207669_11613846
1381 Ga0207704_10040299
1382 Ga0207704_10090975
1383 Ga0207704_10183278
1384 Ga0207704_10571833
1385 Ga0207704_10751120
1386 Ga0207704_10918537
1387 Ga0207665_10762164
1388 Ga0207691_10005213
1389 Ga0207691_10129866
1390 Ga0207691_10143000
1391 Ga0207711_10049199
1392 Ga0207711_10067434
1393 Ga0207711_10074060
1394 Ga0207711_10104881
1395 Ga0207711_10133174
1396 Ga0207711_10161842
1397 Ga0207711_10166186
1398 Ga0207711_10201200
1399 Ga0207711_10547460
1400 Ga0207711_11009451
1401 Ga0207689_10021192
1402 Ga0207689_10087644
1403 Ga0207689_10132863
1404 Ga0207689_10182944
1405 Ga0207689_10783710
1406 Ga0207689_11164504
1407 Ga0207661_10475397
1408 Ga0207667_10303405
1409 Ga0207667_10539802
1410 Ga0207651_10011352
1411 Ga0207651_10140904
1412 Ga0207651_10580943
1413 Ga0207651_10583942
1414 Ga0207651_10879308
1415 Ga0207651_11587016
1416 Ga0207712_10047144
1417 Ga0207712_10284044
1418 Ga0207712_10487919
1419 Ga0207712_10565128
1420 Ga0207712_11672249
1421 Ga0207712_11830285
1422 Ga0207712_12107085
1423 Ga0207668_10298594
1424 Ga0207668_10480110
1425 Ga0207668_10813614
1426 Ga0207640_10036329
1427 Ga0207640_10265496
1428 Ga0207640_10270077
1429 Ga0207658_10180780
1430 Ga0207658_10626609
1431 Ga0207658_11651091
1432 Ga0207677_10071539
1433 Ga0207677_10384839
1434 Ga0207677_10683847
1435 Ga0207677_10782129
1436 Ga0207677_10888461
1437 Ga0207677_11449194
1438 Ga0207703_10024471
1439 Ga0207703_10042263
1440 Ga0207703_10087466
1441 Ga0207703_10113769
1442 Ga0207703_10231277
1443 Ga0207703_10406756
1444 Ga0207703_10665652
1445 Ga0207703_11032471
1446 Ga0207703_11612966
1447 Ga0207703_11621613
1448 Ga0207639_10298697
1449 Ga0207708_10509272
1450 Ga0207708_10753759
1451 Ga0207708_10810872
1452 Ga0207708_10869046
1453 Ga0207702_11117612
1454 Ga0207641_10001024
1455 Ga0207641_10210023
1456 Ga0207641_10216394
1457 Ga0207641_10682715
1458 Ga0207641_11022443
1459 Ga0207641_11867763
1460 Ga0207648_10038920
1461 Ga0207648_10065326
1462 Ga0207648_10104213
1463 Ga0207648_10324200
1464 Ga0207648_10574448
1465 Ga0207648_10728597
1466 Ga0207648_10803165
1467 Ga0207648_10808568
1468 Ga0207648_10936938
1469 Ga0207648_12223372
1470 Ga0207676_10008467
1471 Ga0207676_10072343
1472 Ga0207676_10083168
1473 Ga0207676_10432195
1474 Ga0207676_10641226
1475 Ga0207676_11054307
1476 Ga0207676_11625046
1477 Ga0207674_10047386
1478 Ga0207675_100026411
1479 Ga0207675_100081841
1480 Ga0207675_100119513
1481 Ga0207675_100183512
1482 Ga0207675_100272522
1483 Ga0207675_100330867
1484 Ga0207675_101141021
1485 Ga0207675_101944827
1486 Ga0207683_10103054
1487 Ga0207683_11355206
1488 Ga0207698_11293378
1489 Ga0207698_11605818
1490 Ga0207698_11614364
1491 Ga0207698_11793139
1492 Ga0268266_10010113
1493 Ga0268266_10291258
1494 Ga0268266_10595583
1495 Ga0268265_10013664
1496 Ga0268265_10060235
1497 Ga0268265_10175296
1498 Ga0268265_10306311
1499 Ga0268265_10679270
1500 Ga0268264_10080561
1501 Ga0268264_10279444
1502 Ga0268264_10298038
1503 Ga0268264_10452855
1504 Ga0268264_10672291
1505 Ga0268264_10783909
1506 Ga0268264_10951044
1507 Ga0268264_10974231
1508 Ga0268264_11063623
1509 Ga0268264_11436495
1510 Ga0307408_100403615
1511 Ga0307406_10993381
1512 Ga0373930_0000351
1513 Ga0373948_0000434
1514 Ga0373948_0059039
1515 Ga0373958_0001232
1516 Ga0373958_0065540
1517 Ga0373938_0000370
1518 Ga0373928_0001385
1519 Ga0373929_0000309
1520 Ga0373940_0001507
1521 Ga0373940_0039725
1522 Ga0373940_0182031
1523 Ga0373944_0024922
1524 Ga0373949_0002097
1525 Ga0373951_0003078
1526 Ga0373952_0002232
1527 Ga0373932_0000435
1528 Ga0373936_0208028
1529 Ga0373939_0001501
1530 Ga0373939_0066860
1531 Ga0373941_0000480
1532 Ga0373941_0031918
1533 Ga0373945_0070297
1534 Ga0373953_0180905
1535 Ga0373954_0234721
1536 Ga0373956_0198864
1537 Ga0373957_0141843
1538 Ga0373960_0013223
1539 Ga0373946_0209483
1540 Ga0373955_0070998
1541 Ga0373942_0001153
1542 Ga0373961_0000482
1543 Ga0373961_0035881
1544 Ga0373962_0000900
1545 Ga0373962_0237831
1546 Ga0373924_0026623
1547 Ga0373931_0003635
1548 Ga0373931_0182318
1549 Ga0373935_0123223
1550 Ga0373935_0197505
1551 Ga0373935_1445413
1552 Ga0373933_0471296
1553 Ga0373947_0078526
1554 Ga0373947_0803087
1555 Ga0373947_0892906
1556 Ga0373937_0056273
1557 Ga0373937_0240733
1558 Ga0373937_0672907
1559 Ga0373937_1245161
1560 Ga0373925_0076824
1561 Ga0373925_0628354
1562 Ga0436365_1653332
1563 Ga0436363_0895321
1564 Ga0451800_1001610
1565 Ga0451841_1351648
1566 Ga0451855_1295889
1567 Ga0466961_0404871
1568 Ga0466963_0135605
1569 Ga0466963_0258040
1570 Ga0451576_0014477
1571 Ga0451576_1331443
1572 Ga0466967_1522461
1573 Ga0495592_0232140
1574 Ga0495603_0417420
1575 Ga0495629_0043282
1576 Ga0495629_0189619
1577 Ga0495651_0346228
1578 Ga0495580_0247411
1579 Ga0495582_0062098
1580 Ga0495582_0806474
1581 Ga0495639_0098835
1582 Ga0495664_0665576
1583 Ga0495608_0491719
1584 Ga0495628_0382282
1585 Ga0495663_0039080
1586 Ga0495666_0415269
1587 Ga0495642_0149853
1588 Ga0495640_0057714
1589 Ga0495586_0185593
1590 Ga0495587_0163579
1591 Ga0495621_0175545
1592 Ga0495645_0019308
1593 Ga0495634_0650617
1594 Ga0495635_0459783
1595 Ga0495635_0587364
1596 Ga0495659_0153836
1597 Ga0495647_0107249
1598 Ga0495658_0026673
1599 Ga0495658_0184445
1600 Ga0495658_0330182
1601 Ga0495669_0308608
1602 Ga0495669_0623990
1603 Ga0495613_0112944
1604 Ga0495600_0034383
1605 Ga0495674_0127878
1606 Ga0495674_0839990
1607 Ga0495684_0167080
1608 Ga0496101_0928989
1609 Ga0496101_1292905
1610 Ga0496102_0111032
1611 Ga0496102_0179630
1612 Ga0496103_0223282
1613 Ga0496103_0691690
1614 Ga0496104_0085410
1615 Ga0496104_0132773
1616 Ga0496105_0150962
1617 Ga0496106_0181305
1618 Ga0496106_0230055
1619 Ga0496106_0794951
1620 Ga0496107_0107618
1621 Ga0496107_0256339
1622 Ga0496107_0571243
1623 Ga0496108_0094802
1624 Ga0496109_0105687
1625 Ga0496109_1089390
1626 Ga0496109_1199202
1627 Ga0496110_0149253
1628 Ga0496111_0189483
1629 Ga0496112_0062686
1630 Ga0496112_0088310
1631 Ga0496112_0093746
1632 Ga0496112_0283375
1633 Ga0496112_0410194
1634 Ga0496112_0919958
1635 Ga0496112_1114374
1636 Ga0496112_1140489
1637 Ga0496112_1329959
1638 Ga0496113_0011566
1639 Ga0496113_0917283
1640 Ga0496113_1112804
1641 Ga0496114_0093011
1642 Ga0496114_0129727
1643 Ga0496114_0597455
1644 Ga0496115_0062875
1645 Ga0495682_0196947
1646 Ga0501079_0484389
1647 nmdc:mga05p37_133309_c1
1648 nmdc:mga05p37_2382_c1
1649 nmdc:mga05p37_536941_c1
1650 nmdc:mga05p37_614267_c1
1651 nmdc:mga05p37_7621_c1
1652 nmdc:mga05p37_89689_c1
1653 nmdc:mga09592_272474_c1
1654 nmdc:mga09592_563167_c1
1655 nmdc:mga0qj67_677418_c1
1656 nmdc:mga08y16_126998_c1
1657 nmdc:mga08y16_1519328_c1
1658 nmdc:mga0n895_101089_c1
1659 nmdc:mga0n895_10_c1
1660 nmdc:mga0n895_1307031_c1
1661 nmdc:mga0n895_1324616_c1
1662 nmdc:mga0n895_2018047_c1
1663 nmdc:mga0n895_74470_c1
1664 nmdc:mga0rr50_20_c1
1665 nmdc:mga0rr50_44298_c1
1666 nmdc:mga0rr50_553_c1
1667 nmdc:mga0rr50_796937_c1
1668 nmdc:mga0rr50_799844_c1
1669 nmdc:mga08x19_1056419_c1
1670 nmdc:mga08x19_128990_c1
1671 nmdc:mga08x19_214_c1
1672 nmdc:mga08x19_30522_c1
1673 nmdc:mga08x19_31511_c1
1674 nmdc:mga08x19_32982_c1
1675 nmdc:mga08x19_357930_c1
1676 nmdc:mga0a205_1578166_c1
1677 nmdc:mga0a205_174749_c1
1678 nmdc:mga0a205_192395_c1
1679 nmdc:mga0a205_202123_c1
1680 nmdc:mga0a205_53787_c1
1681 Ga0495601_0074791
1682 Ga0495655_0024762
1683 Ga0495595_0005420
1684 Ga0495619_0042206
1685 Ga0495619_0363079
1686 Ga0500658_0514112
1687 Ga0501084_0151809
1688 Ga0501084_1341093
1689 Ga0501082_0747383
1690 Ga0501082_0978310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l2m-assembly1.cif.gz_A solution structure of the second dsrbd of hyl1 0.7965 20 69
4z1y-assembly1.cif.gz_B thermostable enolase from chloroflexus aurantiacus with substrate 2-phosphoglycerate 0.7381 20 50
3cfi-assembly1.cif.gz_A nanobody-aided structure determination of the epsi:epsj pseudopilin heterdimer from vibrio vulnificus 0.7356 4 50
4yws-assembly1.cif.gz_B thermostable enolase from chloroflexus aurantiacus 0.7232 20 52
6j36-assembly1.cif.gz_A crystal structure of mycoplasma hyopneumoniae enolase 0.7171 20 49
ID Description Score Start End Superfamily
af_P45760_32_124_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.8891 7 50 3.30.1300.30
af_Q4DVP9_45_172_3.30.450.200 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin module 0.8688 22 52 3.30.450.200
af_A0A1D8PQ79_4_223_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8672 3 38 3.30.530.20
af_O16743_266_348_3.10.50.10 Alpha Beta;Roll;Chitinase A; domain 3; 0.8577 21 50 3.10.50.10
af_Q4D1V7_160_283_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.8563 5 49 3.10.110.10
ID Description Score Start End GO Terms
AF-A0A2V8FES5-F1-model_v4 Uncharacterized protein 0.9818 3 76
AF-A0A432HYL2-F1-model_v4 Uncharacterized protein 0.9475 1 76
AF-A0A3M1R853-F1-model_v4 Uncharacterized protein 0.9364 3 76
AF-A0A2V8FES5-F1-model_v4 Uncharacterized protein 0.9323 3 76
AF-A0A432HYL2-F1-model_v4 Uncharacterized protein 0.9244 1 76

Map