F483184

General Info

Members Datasets Scaffolds Average Seq Length
843 642 365 384

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10061749|Ga0307515_100617494
Length 380
Sequence MKPLTRWLLLISLMQPIPVAIAQNAPPPVTVAKPVVRDVVDSDDFVGRFEAVDQVEIRARVGGYLQEIHFTDGALVKKGDLLFVIDQRPYSIALAEANAQLEVAKASQTYTEAQYKRAESLVNTGGQSVAGLDEKRRDWISAQANVRAAQATADRAALDLEYTKITAPISGRIDRRLISQGNLIQADQSVLTTIVSLDPIDFYFDVDERRLLNFAKTARGKGSDLQLGGLVTISDANEKPFKGKLDFAENRVDNETGTMRVRARFDNPKLILQPGLFGRVKVEASNSYRAVLVPDEAIGSDQNQRVVYIVGADGTISTKAVRPGPRLYGYRVIREGMDGTETIVVNGLMRARPGAKITPQMIELPKQRDDMPPDTAELAQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
36 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
37 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
38 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
39 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
40 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
41 2519899620 Rhizobium sp. Pop5 Isolate Nodule
42 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
43 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
46 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
47 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
48 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
49 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
50 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
51 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
52 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
53 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
54 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
55 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
56 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
57 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
58 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
59 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
60 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
61 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
62 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
63 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
64 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
65 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
66 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
67 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
68 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
69 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
70 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
71 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
72 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
73 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
74 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
75 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
76 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
77 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
78 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
79 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
80 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
81 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
82 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
83 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
84 2643221557 Ensifer sp. Root558 Isolate Unclassified
85 2643221599 Rhizobium sp. Root708 Isolate Unclassified
86 2643221607 Rhizobium sp. Root73 Isolate Unclassified
87 2643221610 Ensifer sp. Root74 Isolate Unclassified
88 2643221618 Ensifer sp. Root231 Isolate Unclassified
89 2643221626 Ensifer sp. Root31 Isolate Unclassified
90 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
91 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
92 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
93 2643221655 Ensifer sp. Root1252 Isolate Unclassified
94 2643221659 Ensifer sp. Root127 Isolate Unclassified
95 2643221668 Ensifer sp. Root423 Isolate Unclassified
96 2643221675 Ensifer sp. Root1298 Isolate Unclassified
97 2643221680 Ensifer sp. Root1312 Isolate Unclassified
98 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
99 2643221688 Rhizobium sp. Root482 Isolate Unclassified
100 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
101 2643221698 Ensifer sp. Root142 Isolate Unclassified
102 2643221712 Ensifer sp. Root258 Isolate Unclassified
103 2643221723 Ensifer sp. Root278 Isolate Unclassified
104 2643221726 Ensifer sp. Root954 Isolate Unclassified
105 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
106 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
107 2718217882 Rhizobium sp. N741 Isolate Nodule
108 2718217927 Rhizobium sp. N324 Isolate Nodule
109 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
110 2718218009 Rhizobium sp. N561 Isolate Nodule
111 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
112 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
113 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
114 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
115 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
116 2718218363 Rhizobium sp. N113 Isolate Nodule
117 2718218365 Rhizobium sp. N731 Isolate Nodule
118 2718218366 Rhizobium sp. N621 Isolate Nodule
119 2718218423 Rhizobium sp. N941 Isolate Nodule
120 2721755514 Rhizobium sp. N6212 Isolate Nodule
121 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
122 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
123 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
124 2721755809 Rhizobium sp. N541 Isolate Nodule
125 2721755810 Rhizobium sp. N871 Isolate Nodule
126 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
127 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
128 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
129 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
130 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
131 2728369365 Rhizobium sp. N1341 Isolate Nodule
132 2728369397 Rhizobium sp. N1314 Isolate Nodule
133 2738541293 Rhizobium sp. GV031 Isolate Unclassified
134 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
135 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
136 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
137 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
138 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
139 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
140 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
141 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
142 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
143 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
144 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
145 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
146 2791355256 Rhizobium sp. M10 Isolate Nodule
147 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
148 2791355260 Rhizobium sp. L9 Isolate Nodule
149 2791355261 Rhizobium sp. J15 Isolate Nodule
150 2791355262 Rhizobium sp. M1 Isolate Nodule
151 2791355263 Rhizobium chutanense C5 Isolate Nodule
152 2791355264 Rhizobium sp. S9 Isolate Nodule
153 2791355265 Rhizobium sp. H4 Isolate Nodule
154 2791355266 Rhizobium sp. L43 Isolate Nodule
155 2791355267 Rhizobium sp. L18 Isolate Nodule
156 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
157 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
158 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
159 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
160 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
161 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
162 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
163 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
164 2802429633 Rhizobium anhuiense J3 Isolate Nodule
165 2802429634 Rhizobium anhuiense S10 Isolate Nodule
166 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
167 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
168 2802429637 Rhizobium anhuiense C15 Isolate Nodule
169 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
170 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
171 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
172 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
173 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
174 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
175 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
176 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
177 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
178 2838048938 Rhizobium pisi 27/80 Isolate Nodule
179 2838061910 Rhizobium phaseoli L15 Isolate Nodule
180 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
181 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
182 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
183 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
184 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
187 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
188 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
189 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
190 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
191 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
192 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
193 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
194 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
195 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
196 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
197 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
198 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
199 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
200 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
201 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
202 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
203 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
204 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
205 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
206 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
207 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
208 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
209 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
210 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
211 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
212 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
213 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
214 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
215 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
216 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
217 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
218 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
219 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
220 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
221 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
222 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
223 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
224 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
225 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
226 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
227 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
228 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
229 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
230 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
231 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
232 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
233 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
234 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
235 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
236 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
237 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
238 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
239 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
240 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
241 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
242 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
243 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
244 2844163670 Ensifer sp. 1H6 Isolate Unclassified
245 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
246 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
247 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
248 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
249 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
250 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
251 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
252 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
253 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
254 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
255 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
256 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
257 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
258 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
259 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
260 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
261 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
262 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
263 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
264 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
265 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
266 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
267 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
268 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
269 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
270 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
271 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
272 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
273 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
274 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
275 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
276 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
277 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
278 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
279 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
280 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
281 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
282 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
283 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
284 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
285 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
286 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
287 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
288 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
289 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
290 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
291 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
292 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
293 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
294 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
295 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
296 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
297 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
298 2933599457 Rhizobium phaseoli M3 Isolate Nodule
299 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
300 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
301 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
302 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
303 2936381700 Rhizobium chutanense C16 Isolate Unclassified
304 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
305 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
306 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
307 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
308 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
309 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
310 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
311 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
312 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
313 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
314 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
315 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
316 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
317 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
318 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
319 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
320 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
321 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
322 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
323 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
324 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
325 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
326 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
327 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
328 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
329 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
330 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
331 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
332 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
333 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
334 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
335 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
336 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
337 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
338 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
339 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
340 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
341 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
342 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
343 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
344 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
345 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
346 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
347 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
348 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
349 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
350 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
351 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
352 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
353 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
354 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
355 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
356 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
357 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
358 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
359 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
360 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
361 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
362 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
363 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
364 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
365 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
366 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
367 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
368 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
369 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
370 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
371 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
372 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
373 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
374 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
375 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
376 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
377 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
378 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
379 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
380 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
381 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
382 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
383 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
384 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
385 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
386 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
387 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
388 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
389 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
390 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
391 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
392 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
393 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
394 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
395 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
396 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
397 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
398 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
399 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
400 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
401 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
402 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
403 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
404 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
405 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
406 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
407 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
408 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
409 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
410 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
411 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
412 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
413 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
414 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
415 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
416 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
417 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
418 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
419 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
420 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
421 2996887358 Rhizobium sp. R711 Isolate Nodule
422 2996893221 Rhizobium sp. R635 Isolate Nodule
423 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
424 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
425 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
426 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
427 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
428 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
429 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
430 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
431 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
432 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
433 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
434 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
435 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
436 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
437 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
438 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
439 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
440 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
441 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
442 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
443 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
444 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
445 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
446 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
447 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
448 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
449 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
450 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
451 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
452 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
453 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
454 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
455 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
456 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
457 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
458 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
459 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
460 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
461 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
462 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
463 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
464 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
465 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
466 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
467 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
468 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
469 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
470 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
471 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
472 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
473 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
474 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
475 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
476 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
477 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
478 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
479 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
480 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
481 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
482 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
483 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
484 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
485 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
486 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
487 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
488 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
489 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
490 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
491 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
492 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
499 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
500 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
501 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
503 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
504 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
505 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
506 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
507 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
508 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
509 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
510 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
511 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
512 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
513 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
514 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
515 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
516 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
517 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
518 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
519 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
520 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
521 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
522 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
523 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
524 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
525 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
526 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
527 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
528 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
529 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
530 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
531 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
532 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
533 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
534 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
535 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
536 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
537 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
538 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
539 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
540 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
541 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
542 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
543 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
544 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
545 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
546 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
547 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
548 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
549 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
550 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
551 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
552 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
553 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
554 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
555 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
556 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
557 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
558 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
559 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
560 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
561 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
562 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
563 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
564 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
565 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
566 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
567 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
568 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
569 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
570 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
571 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
572 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
573 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
574 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
575 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
576 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
577 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
580 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
581 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
582 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
583 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
584 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
585 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
586 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
587 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
588 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
589 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
590 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
591 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
592 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
593 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
594 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
595 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
596 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
597 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
598 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
599 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
600 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
601 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
602 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
603 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
604 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
605 8005258706 Rhizobium sp. R693 Isolate Nodule
606 8005275841 Rhizobium sp. N4311 Isolate Nodule
607 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
608 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
609 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
610 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
611 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
612 8005321885 Rhizobium sp. R72 Isolate Nodule
613 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
614 8005382845 Rhizobium sp. R634 Isolate Nodule
615 8005395548 Rhizobium sp. R339 Isolate Nodule
616 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
617 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
618 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
619 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
620 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
621 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
622 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
623 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
624 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
625 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
626 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
627 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
628 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
629 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
630 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
631 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
632 8018176218 Rhizobium sp. N122 Isolate Nodule
633 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
634 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
635 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
636 8024501048 Rhizobium sp. H4 Isolate Nodule
637 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
638 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
639 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
640 8056382006 Rhizobium croatiense 13T Isolate Nodule
641 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
642 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.3
Metatranscriptomes 0
Isolates 56.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.4
Nodule 46.03
Rhizoplane 1.3
Rhizosphere 16.49
Stem 0
Stem Tuber 0
Unclassified 15.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000004 3300002704 Bacteria 269098
2 JGI25156J39149_1000014 3300002705 Bacteria 189257
3 JGI25156J39149_1000015 3300002705 Bacteria 181949
4 JGI25162J39368_1000789 3300002737 Bacteria 21250
5 JGI25154J39366_1000026 3300002738 Bacteria 200613
6 JGI25158J39367_1000069 3300002739 Bacteria 23219
7 JGI25158J39367_1003652 3300002739 Bacteria 2358
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25152J39213_1002897 3300002773 Bacteria 6124
10 JGI25152J39213_1003318 3300002773 Bacteria 5550
11 JGI25152J39213_1006343 3300002773 Bacteria 3247
12 JGI25150J39212_1000024 3300002774 Bacteria 129646
13 JGI25150J39212_1001062 3300002774 Bacteria 8353
14 JGI25159J45721_1000018 3300002987 Bacteria 132603
15 JGI25159J45721_1001373 3300002987 Bacteria 10145
16 JGI25151J46595_10000027 3300003187 Bacteria 208739
17 JGI25151J46595_10003623 3300003187 Bacteria 8444
18 JGI25151J46595_10005118 3300003187 Bacteria 6809
19 JGI25151J46595_10030990 3300003187 Bacteria 2094
20 JGI25165J46597_1000642 3300003214 Bacteria 28950
21 JGI25153J46596_10000517 3300003215 Bacteria 24352
22 JGI25153J46596_10004960 3300003215 Bacteria 7069
23 JGI25153J46596_10006185 3300003215 Bacteria 6124
24 JGI25153J46596_10006193 3300003215 Bacteria 6120
25 JGI25153J46596_10006795 3300003215 Bacteria 5730
26 JGI25160J50197_1000009 3300003354 Bacteria 282862
27 JGI25160J50197_1000022 3300003354 Bacteria 201071
28 JGI25160J50197_1001479 3300003354 Bacteria 11690
29 JGI25161J50226_1000024 3300003374 Bacteria 152176
30 JGI25161J50226_1000079 3300003374 Bacteria 83375
31 JGI25161J50226_1000243 3300003374 Bacteria 32857
32 JGI25161J50226_1002334 3300003374 Bacteria 4925
33 Ga0055526_1000401 3300003771 Bacteria 35018
34 Ga0055526_1005379 3300003771 Bacteria 7375
35 Ga0055526_1006602 3300003771 Bacteria 6251
36 Ga0055524_1001018 3300003775 Bacteria 17359
37 Ga0055524_1004222 3300003775 Bacteria 6684
38 Ga0055524_1005365 3300003775 Bacteria 5734
39 Ga0055524_1005905 3300003775 Bacteria 5394
40 Ga0055536_1000168 3300003781 Bacteria 54941
41 Ga0055528_1000039 3300003790 Bacteria 112899
42 Ga0055528_1000151 3300003790 Bacteria 57434
43 Ga0055528_1000525 3300003790 Bacteria 29704
44 Ga0055528_1000864 3300003790 Bacteria 20538
45 Ga0055528_1002356 3300003790 Bacteria 10222
46 Ga0055528_1006763 3300003790 Bacteria 5159
47 Ga0055528_1021271 3300003790 Bacteria 2065
48 Ga0055540_1000215 3300003792 Bacteria 54511
49 Ga0055540_1006007 3300003792 Bacteria 4920
50 Ga0055540_1024427 3300003792 Bacteria 1499
51 Ga0055531_10025723 3300003794 Bacteria 2126
52 Ga0055543_1000025 3300004625 Bacteria 137886
53 Ga0055543_1000090 3300004625 Bacteria 79635
54 Ga0055543_1000419 3300004625 Bacteria 26802
55 Ga0055543_1000646 3300004625 Bacteria 18584
56 Ga0065165_1000020 3300005262 Bacteria 265570
57 Ga0065165_1000200 3300005262 Bacteria 103564
58 Ga0065165_1009279 3300005262 Bacteria 4435
59 Ga0065165_1013822 3300005262 Bacteria 3177
60 Ga0070668_100053210 3300005347 Bacteria 3122
61 Ga0070667_100234831 3300005367 Bacteria 1636
62 Ga0070665_100093027 3300005548 Bacteria 3020
63 Ga0068854_100084398 3300005578 Bacteria 2350
64 Ga0075365_10018612 3300006038 Bacteria 4274
65 Ga0075362_10000300 3300006177 Bacteria 14031
66 Ga0075367_10000594 3300006178 Bacteria 13895
67 Ga0075367_10002247 3300006178 Bacteria 8731
68 Ga0075367_10032705 3300006178 Bacteria 2995
69 Ga0075369_10001098 3300006186 Bacteria 9081
70 Ga0075369_10001617 3300006186 Bacteria 7749
71 Ga0075366_10008362 3300006195 Bacteria 5749
72 Ga0105251_10008240 3300009011 Bacteria 6299
73 Ga0105240_10000013 3300009093 Bacteria 483458
74 Ga0105237_10000949 3300009545 Bacteria 38978
75 Ga0123341_1000011 3300009765 Bacteria 108023
76 Ga0123342_1020455 3300009766 Bacteria 4832
77 Ga0123342_1034329 3300009766 Bacteria 2240
78 Ga0105239_10000768 3300010375 Bacteria 45353
79 Ga0157370_10001544 3300013104 Bacteria 28489
80 Ga0171463_1006 3300013249 Bacteria 336402
81 Ga0182007_10004365 3300015262 Bacteria 6422
82 Ga0183363_1150 3300015690 Bacteria 17320
83 Ga0214544_1000893 3300021320 Bacteria 58796
84 Ga0214542_1000115 3300021321 Bacteria 109873
85 Ga0214543_1000008 3300021327 Bacteria 385680
86 Ga0214543_1000098 3300021327 Bacteria 109894
87 Ga0228710_1000003 3300022740 Bacteria 262981
88 Ga0209435_100009 3300025206 Bacteria 476614
89 Ga0209436_100110 3300025208 Bacteria 41189
90 Ga0209436_101047 3300025208 Bacteria 10513
91 Ga0209437_100204 3300025233 Bacteria 115781
92 Ga0207425_1000043 3300025245 Bacteria 208791
93 Ga0207425_1001070 3300025245 Bacteria 12495
94 Ga0207425_1011388 3300025245 Bacteria 2125
95 Ga0209646_1000018 3300025246 Bacteria 476716
96 Ga0209026_1000043 3300025250 Bacteria 269142
97 Ga0209677_100265 3300025253 Bacteria 35526
98 Ga0209759_1000007 3300025256 Bacteria 476614
99 Ga0209129_1000072 3300025258 Bacteria 208805
100 Ga0209129_1000226 3300025258 Bacteria 63537
101 Ga0209129_1000237 3300025258 Bacteria 60205
102 Ga0209129_1001129 3300025258 Bacteria 15472
103 Ga0209129_1001799 3300025258 Bacteria 11396
104 Ga0209129_1003697 3300025258 Bacteria 6483
105 Ga0209129_1003923 3300025258 Bacteria 6176
106 Ga0209129_1003928 3300025258 Bacteria 6172
107 Ga0209233_1000255 3300025261 Bacteria 82230
108 Ga0209233_1000332 3300025261 Bacteria 48225
109 Ga0209673_1000132 3300025273 Bacteria 162349
110 Ga0209673_1000161 3300025273 Bacteria 142073
111 Ga0209673_1000239 3300025273 Bacteria 105502
112 Ga0209673_1000478 3300025273 Bacteria 66832
113 Ga0209673_1000554 3300025273 Bacteria 60073
114 Ga0209673_1001495 3300025273 Bacteria 21722
115 Ga0209673_1001737 3300025273 Bacteria 18320
116 Ga0209673_1001746 3300025273 Bacteria 18190
117 Ga0209673_1002608 3300025273 Bacteria 12126
118 Ga0209673_1003977 3300025273 Bacteria 8234
119 Ga0209673_1004398 3300025273 Bacteria 7569
120 Ga0209130_1000023 3300025284 Bacteria 359355
121 Ga0209130_1000037 3300025284 Bacteria 284019
122 Ga0209130_1000164 3300025284 Bacteria 97595
123 Ga0209130_1011010 3300025284 Bacteria 2447
124 Ga0209676_1000239 3300025292 Bacteria 117696
125 Ga0209676_1014043 3300025292 Bacteria 3038
126 Ga0209676_1016246 3300025292 Bacteria 2697
127 Ga0209025_1000120 3300025294 Bacteria 208791
128 Ga0209025_1000411 3300025294 Bacteria 86058
129 Ga0209025_1000651 3300025294 Bacteria 60813
130 Ga0209025_1001885 3300025294 Bacteria 24518
131 Ga0209025_1003840 3300025294 Bacteria 13675
132 Ga0209025_1008747 3300025294 Bacteria 7210
133 Ga0209025_1019769 3300025294 Bacteria 3725
134 Ga0209025_1022864 3300025294 Bacteria 3295
135 Ga0209025_1059930 3300025294 Bacteria 1433
136 Ga0209564_1000086 3300025295 Bacteria 251385
137 Ga0209564_1000215 3300025295 Bacteria 132838
138 Ga0209564_1000393 3300025295 Bacteria 78338
139 Ga0209564_1001841 3300025295 Bacteria 19383
140 Ga0209564_1003290 3300025295 Bacteria 11236
141 Ga0209564_1005240 3300025295 Bacteria 7499
142 Ga0209564_1006876 3300025295 Bacteria 5997
143 Ga0209564_1007468 3300025295 Bacteria 5640
144 Ga0209564_1016206 3300025295 Bacteria 2982
145 Ga0209758_1000111 3300025297 Bacteria 208790
146 Ga0209758_1000390 3300025297 Bacteria 75869
147 Ga0209758_1000422 3300025297 Bacteria 71804
148 Ga0209758_1001594 3300025297 Bacteria 25947
149 Ga0209758_1001976 3300025297 Bacteria 22157
150 Ga0209758_1003033 3300025297 Bacteria 16009
151 Ga0209758_1014613 3300025297 Bacteria 4157
152 Ga0209050_1000962 3300025298 Bacteria 37160
153 Ga0209050_1002262 3300025298 Bacteria 17098
154 Ga0209256_1000155 3300025299 Bacteria 144379
155 Ga0209256_1000276 3300025299 Bacteria 89888
156 Ga0209256_1000292 3300025299 Bacteria 88135
157 Ga0209256_1000479 3300025299 Bacteria 59572
158 Ga0209256_1000619 3300025299 Bacteria 49078
159 Ga0209256_1001902 3300025299 Bacteria 19096
160 Ga0209256_1001999 3300025299 Bacteria 18246
161 Ga0209256_1003132 3300025299 Bacteria 12050
162 Ga0209256_1003475 3300025299 Bacteria 11001
163 Ga0209256_1008015 3300025299 Bacteria 5017
164 Ga0209256_1016346 3300025299 Bacteria 2534
165 Ga0207426_1000048 3300025302 Bacteria 409127
166 Ga0207426_1000082 3300025302 Bacteria 298939
167 Ga0207426_1000087 3300025302 Bacteria 288870
168 Ga0207426_1000386 3300025302 Bacteria 75890
169 Ga0207426_1000447 3300025302 Bacteria 66140
170 Ga0209051_1000321 3300025303 Bacteria 72390
171 Ga0209051_1004748 3300025303 Bacteria 8223
172 Ga0209051_1011522 3300025303 Bacteria 4357
173 Ga0209051_1016476 3300025303 Bacteria 3342
174 Ga0209051_1017584 3300025303 Bacteria 3190
175 Ga0209051_1026294 3300025303 Bacteria 2349
176 Ga0209257_1001228 3300025304 Bacteria 31886
177 Ga0209257_1006251 3300025304 Bacteria 7794
178 Ga0209257_1009821 3300025304 Bacteria 5007
179 Ga0207656_10016374 3300025321 Bacteria 2886
180 Ga0207695_10000044 3300025913 Bacteria 440819
181 Ga0207671_10000043 3300025914 Bacteria 206915
182 Ga0207681_10055172 3300025923 Bacteria 2705
183 Ga0207711_10219817 3300025941 Bacteria 1737
184 Ga0207668_10019754 3300025972 Bacteria 4266
185 Ga0209281_1000061 3300027111 Bacteria 293814
186 Ga0209281_1000081 3300027111 Bacteria 258084
187 Ga0209371_1003713 3300027312 Bacteria 7168
188 Ga0209282_1000040 3300027666 Bacteria 127969
189 Ga0268266_10084411 3300028379 Bacteria 2773
190 Ga0307515_10003918 3300028794 Bacteria 31060
191 Ga0307515_10007465 3300028794 Bacteria 21615
192 Ga0307515_10061749 3300028794 Bacteria 5307
193 Ga0268256_1003408 3300030500 Bacteria 7168
194 Ga0307406_10018957 3300031901 Bacteria 4030
195 Ga0307412_10001443 3300031911 Bacteria 13234
196 Ga0315914_1000002 3300031967 Bacteria 365357
197 Ga0307409_100182956 3300031995 Bacteria 1857
198 Ga0307416_100360416 3300032002 Bacteria 1476
199 Ga0307414_10010740 3300032004 Bacteria 5334
200 Ga0315913_1000016 3300033430 Bacteria 113410
201 Ga0315915_1000005 3300033464 Bacteria 397591
202 Ga0395905_0111447 3300037471 Bacteria 2569
203 Ga0439436_0023121 3300041404 Bacteria 1839
204 Ga0439465_0004344 3300041413 Bacteria 4596
205 Ga0439465_0008056 3300041413 Bacteria 3334
206 Ga0451787_424287 3300041441 Bacteria 5926
207 Ga0451833_0141423 3300041491 Bacteria 1798
208 Ga0451833_1303459 3300041491 Bacteria 1653
209 Ga0451845_0576944 3300041501 Bacteria 2003
210 Ga0451847_0451069 3300041503 Bacteria 3345
211 Ga0451851_1206714 3300041507 Bacteria 4294
212 Ga0451843_1253034 3300041509 Bacteria 1508
213 Ga0451853_2308566 3300041512 Bacteria 2477
214 Ga0439449_0007099 3300042007 Bacteria 4263
215 Ga0466982_0121402 3300044672 Bacteria 1612
216 Ga0466958_0079006 3300045836 Bacteria 2023
217 Ga0495638_0012975 3300046460 Bacteria 5689
218 Ga0495638_0059354 3300046460 Bacteria 2369
219 Ga0495605_0104242 3300046474 Bacteria 1300
220 Ga0495585_0001460 3300046492 Bacteria 18516
221 Ga0495585_0004405 3300046492 Bacteria 9132
222 Ga0495607_0070509 3300046501 Bacteria 1953
223 Ga0495583_0015186 3300046506 Bacteria 4201
224 Ga0495606_0041275 3300046507 Bacteria 3095
225 Ga0495606_0089349 3300046507 Bacteria 1898
226 Ga0495606_0102939 3300046507 Bacteria 1735
227 Ga0495610_0000257 3300046512 Bacteria 55903
228 Ga0495610_0026096 3300046512 Bacteria 3123
229 Ga0495610_0026104 3300046512 Bacteria 3123
230 Ga0495616_0078710 3300046513 Bacteria 1581
231 Ga0495616_0083767 3300046513 Bacteria 1521
232 Ga0495620_0013213 3300046515 Bacteria 4235
233 Ga0495620_0025390 3300046515 Bacteria 2804
234 Ga0495620_0099312 3300046515 Bacteria 1161
235 Ga0495631_0003030 3300046518 Bacteria 9290
236 Ga0495631_0020049 3300046518 Bacteria 3128
237 Ga0495631_0056741 3300046518 Bacteria 1705
238 Ga0495632_0006584 3300046519 Bacteria 7437
239 Ga0495632_0010916 3300046519 Bacteria 5334
240 Ga0495632_0036194 3300046519 Bacteria 2512
241 Ga0495643_0022396 3300046522 Bacteria 3606
242 Ga0495643_0106866 3300046522 Bacteria 1427
243 Ga0495648_0076638 3300046524 Bacteria 1919
244 Ga0495663_0021022 3300046525 Bacteria 1877
245 Ga0495652_0228165 3300046529 Bacteria 1395
246 Ga0495654_0056634 3300046530 Bacteria 1894
247 Ga0495597_0007790 3300046542 Bacteria 5406
248 Ga0495622_0111753 3300046557 Bacteria 1251
249 Ga0495633_0006764 3300046558 Bacteria 6737
250 Ga0495633_0099507 3300046558 Bacteria 1350
251 Ga0495656_0015470 3300046615 Bacteria 2880
252 Ga0495656_0081335 3300046615 Bacteria 1462
253 Ga0495668_0018944 3300046616 Bacteria 3975
254 Ga0495668_0037790 3300046616 Bacteria 2700
255 Ga0495611_0008667 3300046648 Bacteria 4303
256 Ga0495611_0046586 3300046648 Bacteria 1945
257 Ga0495625_0002949 3300046660 Bacteria 17733
258 Ga0495625_0013539 3300046660 Bacteria 6544
259 Ga0495661_0067684 3300046665 Bacteria 2097
260 Ga0495661_0151373 3300046665 Bacteria 1253
261 Ga0495588_0024075 3300046674 Bacteria 3022
262 Ga0495588_0024584 3300046674 Bacteria 2994
263 Ga0495658_0053189 3300046683 Bacteria 2299
264 Ga0495670_0005303 3300046691 Bacteria 6343
265 Ga0495670_0032345 3300046691 Bacteria 2602
266 Ga0495604_0002705 3300047317 Bacteria 14216
267 Ga0495636_0005879 3300047318 Bacteria 4814
268 Ga0495672_0011616 3300047320 Bacteria 6201
269 Ga0495683_0075146 3300047323 Bacteria 1655
270 Ga0495687_035846 3300047443 Bacteria 2226
271 Ga0495686_0005195 3300047472 Bacteria 10366
272 Ga0495686_0019372 3300047472 Bacteria 4546
273 Ga0495686_0020259 3300047472 Bacteria 4435
274 Ga0495686_0037187 3300047472 Bacteria 3120
275 Ga0495686_0072506 3300047472 Bacteria 2117
276 Ga0496100_0087787 3300048903 Bacteria 2115
277 Ga0496102_0111333 3300048905 Bacteria 2552
278 Ga0496102_0148371 3300048905 Bacteria 2202
279 Ga0496104_0158887 3300048907 Bacteria 2169
280 Ga0496106_0000028 3300048909 Bacteria 143296
281 Ga0496116_0001108 3300048919 Bacteria 32260
282 Ga0496116_0007501 3300048919 Bacteria 9656
283 Ga0496116_0011512 3300048919 Bacteria 7311
284 Ga0496116_0015064 3300048919 Bacteria 6130
285 Ga0496116_0015397 3300048919 Bacteria 6045
286 Ga0496116_0018465 3300048919 Bacteria 5376
287 Ga0496116_0030873 3300048919 Bacteria 3844
288 Ga0496116_0047915 3300048919 Bacteria 2872
289 Ga0496116_0054513 3300048919 Bacteria 2633
290 Ga0496117_0006782 3300048920 Bacteria 11428
291 Ga0496117_0007061 3300048920 Bacteria 11107
292 Ga0496117_0020235 3300048920 Bacteria 5433
293 Ga0496117_0046355 3300048920 Bacteria 3127
294 Ga0496118_0003900 3300048921 Bacteria 18269
295 Ga0496118_0005464 3300048921 Bacteria 14437
296 Ga0496118_0011274 3300048921 Bacteria 8745
297 Ga0496118_0021581 3300048921 Bacteria 5662
298 Ga0496119_0018154 3300048922 Bacteria 5253
299 Ga0496119_0058203 3300048922 Bacteria 2330
300 Ga0496120_0005215 3300048923 Bacteria 10469
301 Ga0496121_0006969 3300048924 Bacteria 13756
302 Ga0496121_0009632 3300048924 Bacteria 11066
303 Ga0496121_0011205 3300048924 Bacteria 9989
304 Ga0496121_0024084 3300048924 Bacteria 5833
305 Ga0496121_0025908 3300048924 Bacteria 5547
306 Ga0496121_0033052 3300048924 Bacteria 4690
307 Ga0496121_0070996 3300048924 Bacteria 2802
308 Ga0496121_0117359 3300048924 Bacteria 2016
309 Ga0496122_0005978 3300048925 Bacteria 14237
310 Ga0496122_0011784 3300048925 Bacteria 8802
311 Ga0496122_0019526 3300048925 Bacteria 6184
312 Ga0496122_0030933 3300048925 Bacteria 4470
313 Ga0496122_0055741 3300048925 Bacteria 2953
314 Ga0496122_0059454 3300048925 Bacteria 2821
315 Ga0496122_0119389 3300048925 Bacteria 1705
316 Ga0496123_0006059 3300048926 Bacteria 11866
317 Ga0496123_0015783 3300048926 Bacteria 6171
318 Ga0496123_0016864 3300048926 Bacteria 5904
319 Ga0496123_0049062 3300048926 Bacteria 2834
320 Ga0496124_0001626 3300048927 Bacteria 32229
321 Ga0496124_0005538 3300048927 Bacteria 14144
322 Ga0496124_0016951 3300048927 Bacteria 6899
323 Ga0496124_0019699 3300048927 Bacteria 6267
324 Ga0496124_0046382 3300048927 Bacteria 3721
325 Ga0496124_0089357 3300048927 Bacteria 2515
326 Ga0496124_0121405 3300048927 Bacteria 2087
327 Ga0496125_0004359 3300048928 Bacteria 16404
328 Ga0496125_0012009 3300048928 Bacteria 8623
329 Ga0496126_0021054 3300048929 Bacteria 6380
330 Ga0496126_0129756 3300048929 Bacteria 2179
331 Ga0496126_0191951 3300048929 Bacteria 1729
332 Ga0495678_008047 3300049459 Bacteria 5377
333 Ga0495678_010790 3300049459 Bacteria 4412
334 Ga0495678_033821 3300049459 Bacteria 2108
335 Ga0495682_0018894 3300049460 Bacteria 2595
336 Ga0501032_0021199 3300049569 Bacteria 4520
337 Ga0501036_0250830 3300049572 Bacteria 1483
338 Ga0501043_0012005 3300049579 Bacteria 6776
339 Ga0501047_0086377 3300049581 Bacteria 3014
340 Ga0501083_0071524 3300049744 Bacteria 2306
341 Ga0501044_0021271 3300049823 Bacteria 6925
342 nmdc:mga0k408_16016_c1 3300050493 Bacteria 4152
343 nmdc:mga06z11_13728_c1 3300050494 Bacteria 3567
344 nmdc:mga06z11_39781_c1 3300050494 Bacteria 2342
345 nmdc:mga07m45_14543_c1 3300050496 Bacteria 4195
346 Ga0495601_0081698 3300053077 Bacteria 2074
347 Ga0500578_0036094 3300053086 Bacteria 3175
348 Ga0500651_0065364 3300053093 Bacteria 2267
349 Ga0500557_000349 3300053105 Bacteria 6030
350 Ga0500569_000512 3300053109 Bacteria 6456
351 Ga0500594_0000677 3300053118 Bacteria 7267
352 Ga0500618_002505 3300053125 Bacteria 6862
353 Ga0500618_009705 3300053125 Bacteria 2617
354 Ga0500618_011655 3300053125 Bacteria 2325
355 Ga0500658_0005447 3300053134 Bacteria 4732
356 Ga0500658_0109090 3300053134 Bacteria 1216
357 Ga0500559_0003154 3300053136 Bacteria 8187
358 Ga0500568_0000123 3300053139 Bacteria 69417
359 Ga0500568_0000360 3300053139 Bacteria 35367
360 Ga0500573_0074876 3300053140 Bacteria 1928
361 Ga0500577_0004573 3300053142 Bacteria 3669
362 Ga0500590_020016 3300053148 Bacteria 3469
363 Ga0500604_0015955 3300053151 Bacteria 2063
364 Ga0500616_0001502 3300053153 Bacteria 22017
365 Ga0500622_0000593 3300053156 Bacteria 32900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0007501 Ga0496116_0007501_6951_8114 345
2 iso_pu_bacteria 8005307578 8005311398 350
3 3300002773 JGI25152J39213_1006343 JGI25152J39213_10063431 353
4 3300003775 Ga0055524_1004222 Ga0055524_10042222 353
5 3300003790 Ga0055528_1006763 Ga0055528_10067636 353
6 3300003792 Ga0055540_1024427 Ga0055540_10244271 353
7 3300025258 Ga0209129_1000237 Ga0209129_100023736 353
8 3300025273 Ga0209673_1000554 Ga0209673_100055440 353
9 3300025294 Ga0209025_1008747 Ga0209025_10087472 353
10 3300025295 Ga0209564_1016206 Ga0209564_10162063 353
11 3300025299 Ga0209256_1000292 Ga0209256_100029270 353
12 3300028794 Ga0307515_10003918 Ga0307515_1000391827 353
13 3300021327 Ga0214543_1000008 Ga0214543_1000008136 355
14 3300046515 Ga0495620_0099312 Ga0495620_0099312_10_1146 355
15 3300032004 Ga0307414_10010740 Ga0307414_100107404 356
16 3300041491 Ga0451833_1303459 Ga0451833_1303459_503_1627 356
17 3300046615 Ga0495656_0081335 Ga0495656_0081335_61_1236 358
18 3300046674 Ga0495588_0024075 Ga0495588_0024075_941_2116 358
19 3300048919 Ga0496116_0011512 Ga0496116_0011512_1971_3125 358
20 3300048919 Ga0496116_0018465 Ga0496116_0018465_4151_5305 358
21 3300048920 Ga0496117_0020235 Ga0496117_0020235_4151_5305 358
22 3300048924 Ga0496121_0011205 Ga0496121_0011205_5087_6241 358
23 3300048925 Ga0496122_0019526 Ga0496122_0019526_4210_5364 358
24 3300048927 Ga0496124_0016951 Ga0496124_0016951_5617_6771 358
25 3300048928 Ga0496125_0012009 Ga0496125_0012009_719_1873 358
26 3300046558 Ga0495633_0099507 Ga0495633_0099507_181_1329 359
27 3300002739 JGI25158J39367_1003652 JGI25158J39367_10036522 360
28 3300002987 JGI25159J45721_1000018 JGI25159J45721_100001848 360
29 3300003187 JGI25151J46595_10005118 JGI25151J46595_100051183 360
30 3300003354 JGI25160J50197_1000009 JGI25160J50197_1000009160 360
31 3300003374 JGI25161J50226_1000243 JGI25161J50226_100024313 360
32 3300003771 Ga0055526_1006602 Ga0055526_10066022 360
33 3300003781 Ga0055536_1000168 Ga0055536_10001683 360
34 3300003794 Ga0055531_10025723 Ga0055531_100257232 360
35 3300004625 Ga0055543_1000090 Ga0055543_100009052 360
36 3300005262 Ga0065165_1000020 Ga0065165_1000020110 360
37 3300025208 Ga0209436_101047 Ga0209436_1010472 360
38 3300025284 Ga0209130_1000037 Ga0209130_1000037111 360
39 3300025292 Ga0209676_1000239 Ga0209676_100023958 360
40 3300025294 Ga0209025_1000651 Ga0209025_100065148 360
41 3300025295 Ga0209564_1000086 Ga0209564_1000086159 360
42 3300025298 Ga0209050_1000962 Ga0209050_100096214 360
43 3300025299 Ga0209256_1001999 Ga0209256_10019994 360
44 3300025302 Ga0207426_1000048 Ga0207426_1000048151 360
45 3300025303 Ga0209051_1004748 Ga0209051_10047486 360
46 3300025304 Ga0209257_1001228 Ga0209257_10012286 360
47 iso_pu_bacteria 2915986958 2915989404 360
48 3300027111 Ga0209281_1000061 Ga0209281_100006188 361
49 3300048924 Ga0496121_0117359 Ga0496121_0117359_316_1434 362
50 3300048926 Ga0496123_0006059 Ga0496123_0006059_3207_4325 362
51 iso_pu_bacteria 2551306086 2551693873 362
52 3300021320 Ga0214544_1000893 Ga0214544_100089349 363
53 3300021321 Ga0214542_1000115 Ga0214542_100011556 363
54 3300021327 Ga0214543_1000098 Ga0214543_100009856 363
55 3300013249 Ga0171463_1006 Ga0171463_1006163 364
56 3300015690 Ga0183363_1150 Ga0183363_115010 364
57 3300031901 Ga0307406_10018957 Ga0307406_100189572 364
58 3300031911 Ga0307412_10001443 Ga0307412_100014439 364
59 3300048919 Ga0496116_0015064 Ga0496116_0015064_4157_5335 364
60 3300048919 Ga0496116_0030873 Ga0496116_0030873_2619_3797 364
61 3300048920 Ga0496117_0006782 Ga0496117_0006782_4684_5862 364
62 3300048921 Ga0496118_0011274 Ga0496118_0011274_6889_8067 364
63 3300048924 Ga0496121_0024084 Ga0496121_0024084_4611_5789 364
64 3300048925 Ga0496122_0030933 Ga0496122_0030933_796_1974 364
65 3300048925 Ga0496122_0059454 Ga0496122_0059454_561_1739 364
66 3300048927 Ga0496124_0005538 Ga0496124_0005538_7388_8566 364
67 3300048927 Ga0496124_0046382 Ga0496124_0046382_39_1217 364
68 3300048929 Ga0496126_0129756 Ga0496126_0129756_173_1351 364
69 iso_pu_bacteria 2513237159 2513999591 364
70 iso_pu_bacteria 2582581306 2585270239 364
71 iso_pu_bacteria 2582581865 2585390461 364
72 iso_pu_bacteria 2582581866 2585395818 364
73 iso_pu_bacteria 2643221688 2644492596 364
74 iso_pu_bacteria 2643221689 2644497925 364
75 iso_pu_bacteria 2842521101 2842525817 364
76 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002462 365
77 3300003187 JGI25151J46595_10000027 JGI25151J46595_10000027127 365
78 3300003215 JGI25153J46596_10000517 JGI25153J46596_1000051718 365
79 3300025245 Ga0207425_1000043 Ga0207425_1000043125 365
80 3300025258 Ga0209129_1000072 Ga0209129_100007269 365
81 3300025273 Ga0209673_1004398 Ga0209673_10043984 365
82 3300025294 Ga0209025_1000120 Ga0209025_100012069 365
83 3300025297 Ga0209758_1000111 Ga0209758_100011169 365
84 3300041404 Ga0439436_0023121 Ga0439436_0023121_586_1743 365
85 3300046615 Ga0495656_0015470 Ga0495656_0015470_23_1177 365
86 3300048919 Ga0496116_0001108 Ga0496116_0001108_6847_7986 365
87 3300048924 Ga0496121_0033052 Ga0496121_0033052_3291_4430 365
88 3300048924 Ga0496121_0070996 Ga0496121_0070996_911_2095 365
89 3300048925 Ga0496122_0005978 Ga0496122_0005978_6845_7984 365
90 3300048926 Ga0496123_0015783 Ga0496123_0015783_1980_3119 365
91 3300048927 Ga0496124_0001626 Ga0496124_0001626_24270_25409 365
92 iso_pu_bacteria 2582581283 2585169040 365
93 iso_pu_bacteria 2643221607 2644051220 365
94 iso_pu_bacteria 2643221636 2644200891 365
95 iso_pu_bacteria 2643221686 2644484124 365
96 3300003775 Ga0055524_1001018 Ga0055524_100101816 366
97 3300025294 Ga0209025_1059930 Ga0209025_10599301 366
98 3300025299 Ga0209256_1000276 Ga0209256_100027657 366
99 3300041441 Ga0451787_424287 Ga0451787_424287_2733_3887 366
100 3300041491 Ga0451833_0141423 Ga0451833_0141423_614_1768 366
101 3300041501 Ga0451845_0576944 Ga0451845_0576944_80_1234 366
102 3300041503 Ga0451847_0451069 Ga0451847_0451069_146_1300 366
103 3300041507 Ga0451851_1206714 Ga0451851_1206714_2140_3294 366
104 3300041509 Ga0451843_1253034 Ga0451843_1253034_80_1234 366
105 3300041512 Ga0451853_2308566 Ga0451853_2308566_98_1252 366
106 3300046460 Ga0495638_0059354 Ga0495638_0059354_133_1287 366
107 3300046474 Ga0495605_0104242 Ga0495605_0104242_11_1165 366
108 3300046492 Ga0495585_0004405 Ga0495585_0004405_3276_4430 366
109 3300046507 Ga0495606_0102939 Ga0495606_0102939_428_1582 366
110 3300046512 Ga0495610_0026096 Ga0495610_0026096_1421_2575 366
111 3300046513 Ga0495616_0083767 Ga0495616_0083767_29_1183 366
112 3300046515 Ga0495620_0013213 Ga0495620_0013213_2564_3718 366
113 3300046518 Ga0495631_0020049 Ga0495631_0020049_935_2089 366
114 3300046518 Ga0495631_0056741 Ga0495631_0056741_520_1674 366
115 3300046522 Ga0495643_0106866 Ga0495643_0106866_146_1300 366
116 3300046524 Ga0495648_0076638 Ga0495648_0076638_62_1216 366
117 3300046525 Ga0495663_0021022 Ga0495663_0021022_515_1669 366
118 3300046542 Ga0495597_0007790 Ga0495597_0007790_2989_4143 366
119 3300046558 Ga0495633_0006764 Ga0495633_0006764_1829_2983 366
120 3300046616 Ga0495668_0018944 Ga0495668_0018944_2370_3524 366
121 3300046648 Ga0495611_0008667 Ga0495611_0008667_1896_3050 366
122 3300046660 Ga0495625_0013539 Ga0495625_0013539_355_1509 366
123 3300046665 Ga0495661_0067684 Ga0495661_0067684_843_1997 366
124 3300046665 Ga0495661_0151373 Ga0495661_0151373_84_1238 366
125 3300046691 Ga0495670_0005303 Ga0495670_0005303_2335_3489 366
126 3300047318 Ga0495636_0005879 Ga0495636_0005879_2264_3418 366
127 3300047323 Ga0495683_0075146 Ga0495683_0075146_390_1544 366
128 3300047443 Ga0495687_035846 Ga0495687_035846_922_2076 366
129 3300047472 Ga0495686_0019372 Ga0495686_0019372_777_1931 366
130 3300047472 Ga0495686_0072506 Ga0495686_0072506_535_1767 366
131 3300049459 Ga0495678_033821 Ga0495678_033821_802_1956 366
132 3300053086 Ga0500578_0036094 Ga0500578_0036094_1894_3048 366
133 3300053134 Ga0500658_0109090 Ga0500658_0109090_25_1179 366
134 3300047472 Ga0495686_0005195 Ga0495686_0005195_446_1591 367
135 3300028794 Ga0307515_10061749 Ga0307515_100617494 368
136 3300003790 Ga0055528_1000151 Ga0055528_100015143 369
137 3300025273 Ga0209673_1000239 Ga0209673_100023973 369
138 3300025292 Ga0209676_1016246 Ga0209676_10162463 369
139 3300025294 Ga0209025_1022864 Ga0209025_10228642 369
140 3300025295 Ga0209564_1005240 Ga0209564_10052405 369
141 3300025299 Ga0209256_1000619 Ga0209256_100061923 369
142 3300046512 Ga0495610_0000257 Ga0495610_0000257_52743_53921 369
143 3300046515 Ga0495620_0025390 Ga0495620_0025390_320_1498 369
144 3300046519 Ga0495632_0036194 Ga0495632_0036194_504_1682 369
145 3300047472 Ga0495686_0020259 Ga0495686_0020259_2997_4175 369
146 3300049459 Ga0495678_008047 Ga0495678_008047_2536_3714 369
147 3300053125 Ga0500618_002505 Ga0500618_002505_1344_2522 369
148 iso_pu_bacteria 2529292951 2530646301 369
149 iso_pu_bacteria 2599185352 2600194650 369
150 iso_pu_bacteria 2643221557 2643804075 369
151 iso_pu_bacteria 2643221610 2644064875 369
152 iso_pu_bacteria 2643221618 2644108586 369
153 iso_pu_bacteria 2643221626 2644145632 369
154 iso_pu_bacteria 2643221655 2644312291 369
155 iso_pu_bacteria 2643221659 2644335920 369
156 iso_pu_bacteria 2643221668 2644376183 369
157 iso_pu_bacteria 2643221675 2644416548 369
158 iso_pu_bacteria 2643221680 2644449588 369
159 iso_pu_bacteria 2643221698 2644546777 369
160 iso_pu_bacteria 2643221712 2644617974 369
161 iso_pu_bacteria 2643221723 2644676846 369
162 iso_pu_bacteria 2643221726 2644688163 369
163 iso_pu_bacteria 2844163670 2844169140 369
164 iso_pu_bacteria 2920822456 2920828590 369
165 iso_pu_bacteria 2941499720 2941501796 369
166 3300003187 JGI25151J46595_10030990 JGI25151J46595_100309901 370
167 3300005262 Ga0065165_1013822 Ga0065165_10138222 370
168 3300022740 Ga0228710_1000003 Ga0228710_100000353 370
169 3300025258 Ga0209129_1000226 Ga0209129_100022629 370
170 3300025294 Ga0209025_1001885 Ga0209025_10018859 370
171 3300025297 Ga0209758_1014613 Ga0209758_10146132 370
172 3300027111 Ga0209281_1000081 Ga0209281_100008147 370
173 3300027666 Ga0209282_1000040 Ga0209282_100004069 370
174 3300031967 Ga0315914_1000002 Ga0315914_1000002153 370
175 3300031995 Ga0307409_100182956 Ga0307409_1001829561 370
176 3300032002 Ga0307416_100360416 Ga0307416_1003604162 370
177 3300033430 Ga0315913_1000016 Ga0315913_100001656 370
178 3300033464 Ga0315915_1000005 Ga0315915_1000005153 370
179 3300042007 Ga0439449_0007099 Ga0439449_0007099_1833_2990 370
180 iso_pu_bacteria 2508501122 2509109747 370
181 iso_pu_bacteria 2509276019 2509379281 370
182 iso_pu_bacteria 2511231052 2511502899 370
183 iso_pu_bacteria 2512047086 2512534141 370
184 iso_pu_bacteria 2512875026 2512974024 370
185 iso_pu_bacteria 2513237086 2513584119 370
186 iso_pu_bacteria 2513237089 2513602259 370
187 iso_pu_bacteria 2513237091 2513616985 370
188 iso_pu_bacteria 2513237140 2513881998 370
189 iso_pu_bacteria 2513237143 2513905536 370
190 iso_pu_bacteria 2513237156 2513985489 370
191 iso_pu_bacteria 2513237160 2514003902 370
192 iso_pu_bacteria 2515154107 2515610443 370
193 iso_pu_bacteria 2516653046 2516894305 370
194 iso_pu_bacteria 2517487022 2517570912 370
195 iso_pu_bacteria 2524023207 2524451772 370
196 iso_pu_bacteria 2551306084 2551674724 370
197 iso_pu_bacteria 2551306085 2551685466 370
198 iso_pu_bacteria 2551306087 2551698538 370
199 iso_pu_bacteria 2551306092 2551736238 370
200 iso_pu_bacteria 2551306093 2551741343 370
201 iso_pu_bacteria 2558860100 2558860321 370
202 iso_pu_bacteria 2690316117 2692314610 370
203 iso_pu_bacteria 2751185821 2753458708 370
204 iso_pu_bacteria 2791355082 2792582636 370
205 iso_pu_bacteria 2791355091 2792622902 370
206 iso_pu_bacteria 2791355092 2792629156 370
207 iso_pu_bacteria 2791355094 2792640491 370
208 iso_pu_bacteria 2802428858 2802717998 370
209 iso_pu_bacteria 2802428859 2802725151 370
210 iso_pu_bacteria 2802428860 2802730725 370
211 iso_pu_bacteria 2802428861 2802738072 370
212 iso_pu_bacteria 2802428862 2802744058 370
213 iso_pu_bacteria 2802428863 2802750937 370
214 iso_pu_bacteria 2847417321 2847420340 370
215 iso_pu_bacteria 2848992105 2848995152 370
216 iso_pu_bacteria 2850079185 2850082219 370
217 iso_pu_bacteria 2855825444 2855826940 370
218 iso_pu_bacteria 2855839649 2855842336 370
219 iso_pu_bacteria 2855872281 2855878527 370
220 iso_pu_bacteria 2858800743 2858803151 370
221 iso_pu_bacteria 2913295892 2913299753 370
222 iso_pu_bacteria 2915980308 2915980459 370
223 iso_pu_bacteria 2915993759 2915999007 370
224 iso_pu_bacteria 2916000859 2916006176 370
225 iso_pu_bacteria 2916007675 2916013016 370
226 iso_pu_bacteria 2916014648 2916015608 370
227 iso_pu_bacteria 2916021584 2916022475 370
228 iso_pu_bacteria 2916028427 2916029077 370
229 iso_pu_bacteria 2916035215 2916038405 370
230 iso_pu_bacteria 2916041962 2916044837 370
231 iso_pu_bacteria 2916055098 2916058156 370
232 iso_pu_bacteria 2916061851 2916067037 370
233 iso_pu_bacteria 2916068649 2916068731 370
234 iso_pu_bacteria 2921208531 2921210675 370
235 iso_pu_bacteria 2921244191 2921244869 370
236 iso_pu_bacteria 2921250672 2921252277 370
237 iso_pu_bacteria 2921263974 2921270832 370
238 iso_pu_bacteria 2921282425 2921282894 370
239 iso_pu_bacteria 2921289301 2921290866 370
240 iso_pu_bacteria 2921296804 2921300941 370
241 iso_pu_bacteria 2924144063 2924149320 370
242 iso_pu_bacteria 2924150972 2924155470 370
243 iso_pu_bacteria 2924158325 2924163260 370
244 iso_pu_bacteria 2924165586 2924171847 370
245 iso_pu_bacteria 2924172951 2924176972 370
246 iso_pu_bacteria 2924186466 2924191596 370
247 iso_pu_bacteria 2924193448 2924195013 370
248 iso_pu_bacteria 2924200457 2924201624 370
249 iso_pu_bacteria 2924207177 2924213495 370
250 iso_pu_bacteria 2924221636 2924221858 370
251 iso_pu_bacteria 2924228884 2924233359 370
252 iso_pu_bacteria 2936996657 2936999943 370
253 iso_pu_bacteria 2937002841 2937007081 370
254 iso_pu_bacteria 2937009748 2937010937 370
255 iso_pu_bacteria 2937016420 2937018271 370
256 iso_pu_bacteria 2937023124 2937025754 370
257 iso_pu_bacteria 2937029754 2937033100 370
258 iso_pu_bacteria 2937036028 2937036602 370
259 iso_pu_bacteria 2937042894 2937044041 370
260 iso_pu_bacteria 2937056579 2937058402 370
261 iso_pu_bacteria 2937063883 2937067445 370
262 iso_pu_bacteria 2937071275 2937074775 370
263 iso_pu_bacteria 2937078374 2937078525 370
264 iso_pu_bacteria 2937084907 2937091356 370
265 iso_pu_bacteria 2937091812 2937092751 370
266 iso_pu_bacteria 2937106411 2937111746 370
267 iso_pu_bacteria 2937113482 2937114935 370
268 iso_pu_bacteria 2937119839 2937121448 370
269 iso_pu_bacteria 2937126314 2937129418 370
270 iso_pu_bacteria 2957375807 2957377544 370
271 iso_pu_bacteria 2957382221 2957387671 370
272 iso_pu_bacteria 2957388812 2957389884 370
273 iso_pu_bacteria 2957395598 2957397422 370
274 iso_pu_bacteria 2957402308 2957404645 370
275 iso_pu_bacteria 2957408893 2957409113 370
276 iso_pu_bacteria 2957415311 2957420701 370
277 iso_pu_bacteria 2957422303 2957426436 370
278 iso_pu_bacteria 2957430029 2957435754 370
279 iso_pu_bacteria 2957437181 2957437283 370
280 iso_pu_bacteria 2957443900 2957449453 370
281 iso_pu_bacteria 2957457609 2957458681 370
282 iso_pu_bacteria 2957464669 2957469696 370
283 iso_pu_bacteria 2957471148 2957472120 370
284 iso_pu_bacteria 2957478035 2957484460 370
285 iso_pu_bacteria 2957484790 2957490930 370
286 iso_pu_bacteria 2957491536 2957496289 370
287 iso_pu_bacteria 2957498199 2957499360 370
288 iso_pu_bacteria 2957505466 2957509077 370
289 iso_pu_bacteria 2960584000 2960585450 370
290 iso_pu_bacteria 2960591022 2960591173 370
291 iso_pu_bacteria 2960597568 2960602275 370
292 iso_pu_bacteria 2960603979 2960609599 370
293 iso_pu_bacteria 2960610863 2960614323 370
294 iso_pu_bacteria 2960617483 2960623452 370
295 iso_pu_bacteria 2960624210 2960627999 370
296 iso_pu_bacteria 2960631154 2960635026 370
297 iso_pu_bacteria 2960645483 2960651549 370
298 iso_pu_bacteria 2960652885 2960653172 370
299 iso_pu_bacteria 2960660292 2960665370 370
300 iso_pu_bacteria 2960667422 2960672539 370
301 iso_pu_bacteria 2960674078 2960676326 370
302 iso_pu_bacteria 2960680706 2960682541 370
303 iso_pu_bacteria 2960687367 2960692451 370
304 iso_pu_bacteria 2960693952 2960696902 370
305 iso_pu_bacteria 2964607997 2964612913 370
306 iso_pu_bacteria 2964615318 2964619731 370
307 iso_pu_bacteria 2964621998 2964628291 370
308 iso_pu_bacteria 2964628898 2964630950 370
309 iso_pu_bacteria 2964636051 2964637102 370
310 iso_pu_bacteria 2964643177 2964644729 370
311 iso_pu_bacteria 2964649959 2964651410 370
312 iso_pu_bacteria 2964656573 2964657704 370
313 iso_pu_bacteria 2964663802 2964666568 370
314 iso_pu_bacteria 2964678106 2964679549 370
315 iso_pu_bacteria 2964685014 2964687363 370
316 iso_pu_bacteria 2964691889 2964692324 370
317 iso_pu_bacteria 2964698721 2964702617 370
318 iso_pu_bacteria 2964705432 2964711113 370
319 iso_pu_bacteria 2964712639 2964713290 370
320 iso_pu_bacteria 2967671571 2967672815 370
321 iso_pu_bacteria 2967678726 2967685304 370
322 iso_pu_bacteria 2967686174 2967689314 370
323 iso_pu_bacteria 2967693043 2967696255 370
324 iso_pu_bacteria 2967699805 2967704447 370
325 iso_pu_bacteria 2967714385 2967719983 370
326 iso_pu_bacteria 2967721400 2967727765 370
327 iso_pu_bacteria 2967728569 2967732592 370
328 iso_pu_bacteria 2967735183 2967735291 370
329 iso_pu_bacteria 2967748971 2967752346 370
330 iso_pu_bacteria 2967755722 2967759265 370
331 iso_pu_bacteria 2967762386 2967766870 370
332 iso_pu_bacteria 2967769361 2967770533 370
333 iso_pu_bacteria 2967775926 2967777551 370
334 iso_pu_bacteria 2970019648 2970025893 370
335 iso_pu_bacteria 2970026789 2970028199 370
336 iso_pu_bacteria 2970033650 2970035017 370
337 iso_pu_bacteria 2970040964 2970042496 370
338 iso_pu_bacteria 2970047711 2970053492 370
339 iso_pu_bacteria 2970054988 2970056060 370
340 iso_pu_bacteria 2970061556 2970063045 370
341 iso_pu_bacteria 2970068827 2970074497 370
342 iso_pu_bacteria 2970076120 2970079213 370
343 iso_pu_bacteria 2970088815 2970089156 370
344 iso_pu_bacteria 2970095765 2970100288 370
345 iso_pu_bacteria 2970102677 2970103791 370
346 iso_pu_bacteria 2970109326 2970116131 370
347 iso_pu_bacteria 2970116247 2970121252 370
348 iso_pu_bacteria 2970122695 2970126035 370
349 iso_pu_bacteria 2970129317 2970130173 370
350 iso_pu_bacteria 2970136068 2970141215 370
351 iso_pu_bacteria 2970143518 2970146527 370
352 iso_pu_bacteria 2970149975 2970150526 370
353 iso_pu_bacteria 2970164137 2970166819 370
354 iso_pu_bacteria 2970170962 2970173478 370
355 iso_pu_bacteria 2970177841 2970180682 370
356 iso_pu_bacteria 2970184632 2970191548 370
357 iso_pu_bacteria 2970191845 2970196266 370
358 iso_pu_bacteria 2977516862 2977519836 370
359 iso_pu_bacteria 2977530762 2977534250 370
360 iso_pu_bacteria 2977537788 2977541100 370
361 iso_pu_bacteria 2977544691 2977548086 370
362 iso_pu_bacteria 2977551784 2977552170 370
363 iso_pu_bacteria 2977558990 2977560066 370
364 iso_pu_bacteria 2977565890 2977567258 370
365 iso_pu_bacteria 2977572785 2977574859 370
366 iso_pu_bacteria 2977579622 2977579843 370
367 iso_pu_bacteria 643692032 643826991 370
368 iso_pu_bacteria 648276728 648735934 370
369 iso_pu_bacteria 8003992118 8003994874 370
370 iso_pu_bacteria 8003999396 8004002627 370
371 iso_pu_bacteria 8049293176 8049295850 370
372 3300003187 JGI25151J46595_10003623 JGI25151J46595_100036232 371
373 3300003354 JGI25160J50197_1001479 JGI25160J50197_10014792 371
374 3300003374 JGI25161J50226_1002334 JGI25161J50226_10023342 371
375 3300003771 Ga0055526_1000401 Ga0055526_10004014 371
376 3300003792 Ga0055540_1006007 Ga0055540_10060072 371
377 3300004625 Ga0055543_1000419 Ga0055543_100041912 371
378 3300005262 Ga0065165_1009279 Ga0065165_10092792 371
379 3300006177 Ga0075362_10000300 Ga0075362_100003002 371
380 3300006178 Ga0075367_10002247 Ga0075367_100022473 371
381 3300006186 Ga0075369_10001617 Ga0075369_100016171 371
382 3300006195 Ga0075366_10008362 Ga0075366_100083622 371
383 3300025245 Ga0207425_1011388 Ga0207425_10113882 371
384 3300025258 Ga0209129_1001129 Ga0209129_10011292 371
385 3300025273 Ga0209673_1001737 Ga0209673_10017376 371
386 3300025284 Ga0209130_1011010 Ga0209130_10110102 371
387 3300025294 Ga0209025_1000411 Ga0209025_100041150 371
388 3300025295 Ga0209564_1003290 Ga0209564_10032907 371
389 3300025297 Ga0209758_1001594 Ga0209758_100159413 371
390 3300025299 Ga0209256_1001902 Ga0209256_100190212 371
391 3300025302 Ga0207426_1000386 Ga0207426_100038660 371
392 3300025303 Ga0209051_1016476 Ga0209051_10164761 371
393 3300050493 nmdc:mga0k408_16016_c1 nmdc:mga0k408_16016_c1_717_1892 371
394 3300050494 nmdc:mga06z11_13728_c1 nmdc:mga06z11_13728_c1_801_1976 371
395 3300050496 nmdc:mga07m45_14543_c1 nmdc:mga07m45_14543_c1_17_1192 371
396 iso_pu_bacteria 2765235802 2765465100 371
397 iso_pu_bacteria 2838074704 2838077340 371
398 iso_pu_bacteria 2840764183 2840767915 371
399 iso_pu_bacteria 2894652903 2894656473 371
400 iso_pu_bacteria 2896384573 2896386354 371
401 iso_pu_bacteria 2920760137 2920760872 371
402 iso_pu_bacteria 3002141150 3002144128 371
403 iso_pu_bacteria 8024486573 8024490899 371
404 3300003215 JGI25153J46596_10006795 JGI25153J46596_100067953 372
405 3300003775 Ga0055524_1005365 Ga0055524_10053652 372
406 3300003790 Ga0055528_1000039 Ga0055528_100003996 372
407 3300003790 Ga0055528_1002356 Ga0055528_100235613 372
408 3300003790 Ga0055528_1021271 Ga0055528_10212713 372
409 3300025273 Ga0209673_1000132 Ga0209673_100013217 372
410 3300025273 Ga0209673_1000161 Ga0209673_1000161117 372
411 3300025273 Ga0209673_1003977 Ga0209673_10039775 372
412 3300025295 Ga0209564_1001841 Ga0209564_10018412 372
413 3300025295 Ga0209564_1007468 Ga0209564_10074681 372
414 3300025297 Ga0209758_1003033 Ga0209758_10030337 372
415 3300025299 Ga0209256_1000479 Ga0209256_100047917 372
416 3300025299 Ga0209256_1008015 Ga0209256_10080152 372
417 3300025303 Ga0209051_1017584 Ga0209051_10175841 372
418 3300025303 Ga0209051_1026294 Ga0209051_10262941 372
419 3300046507 Ga0495606_0041275 Ga0495606_0041275_573_1727 372
420 3300046519 Ga0495632_0006584 Ga0495632_0006584_1808_2959 372
421 3300048919 Ga0496116_0015397 Ga0496116_0015397_1999_3162 372
422 3300048929 Ga0496126_0021054 Ga0496126_0021054_4111_5274 372
423 iso_pu_bacteria 2767802442 2770198270 372
424 iso_pu_bacteria 2775506902 2776271212 372
425 iso_pu_bacteria 2775506904 2776280791 372
426 3300002739 JGI25158J39367_1000069 JGI25158J39367_100006913 373
427 3300002773 JGI25152J39213_1003318 JGI25152J39213_10033185 373
428 3300002987 JGI25159J45721_1001373 JGI25159J45721_10013739 373
429 3300003215 JGI25153J46596_10004960 JGI25153J46596_100049602 373
430 3300003374 JGI25161J50226_1000079 JGI25161J50226_10000798 373
431 3300003771 Ga0055526_1005379 Ga0055526_10053793 373
432 3300003775 Ga0055524_1005905 Ga0055524_10059056 373
433 3300003790 Ga0055528_1000864 Ga0055528_100086410 373
434 3300004625 Ga0055543_1000646 Ga0055543_100064614 373
435 3300025208 Ga0209436_100110 Ga0209436_10011021 373
436 3300025258 Ga0209129_1001799 Ga0209129_10017998 373
437 3300025273 Ga0209673_1001495 Ga0209673_10014953 373
438 3300025284 Ga0209130_1000023 Ga0209130_1000023228 373
439 3300025295 Ga0209564_1000393 Ga0209564_100039317 373
440 3300025297 Ga0209758_1000390 Ga0209758_100039039 373
441 3300025299 Ga0209256_1003475 Ga0209256_10034753 373
442 3300025302 Ga0207426_1000087 Ga0207426_1000087134 373
443 3300025303 Ga0209051_1011522 Ga0209051_10115222 373
444 3300025304 Ga0209257_1009821 Ga0209257_10098213 373
445 3300041413 Ga0439465_0008056 Ga0439465_0008056_535_1710 373
446 3300046460 Ga0495638_0012975 Ga0495638_0012975_97_1263 374
447 3300046529 Ga0495652_0228165 Ga0495652_0228165_97_1317 374
448 3300046557 Ga0495622_0111753 Ga0495622_0111753_15_1172 374
449 3300046674 Ga0495588_0024584 Ga0495588_0024584_1120_2277 374
450 3300046683 Ga0495658_0053189 Ga0495658_0053189_732_1952 374
451 3300047317 Ga0495604_0002705 Ga0495604_0002705_10787_12007 374
452 3300053077 Ga0495601_0081698 Ga0495601_0081698_725_1945 374
453 3300053125 Ga0500618_009705 Ga0500618_009705_249_1436 374
454 3300053136 Ga0500559_0003154 Ga0500559_0003154_901_2061 374
455 3300053148 Ga0500590_020016 Ga0500590_020016_2013_3233 374
456 iso_pu_bacteria 2818991461 2819687755 374
457 iso_pu_bacteria 2821123053 2821129917 374
458 iso_pu_bacteria 2839993093 2839995157 374
459 iso_pu_bacteria 2904578770 2904583261 374
460 iso_pu_bacteria 2919119836 2919121121 374
461 3300009765 Ga0123341_1000011 Ga0123341_100001174 375
462 3300009766 Ga0123342_1034329 Ga0123342_10343292 375
463 3300048909 Ga0496106_0000028 Ga0496106_0000028_127925_129100 375
464 3300053093 Ga0500651_0065364 Ga0500651_0065364_252_1427 375
465 3300053134 Ga0500658_0005447 Ga0500658_0005447_2270_3445 375
466 3300053139 Ga0500568_0000360 Ga0500568_0000360_33611_34786 375
467 3300053151 Ga0500604_0015955 Ga0500604_0015955_439_1614 375
468 iso_pu_bacteria 2513237146 2513927991 376
469 iso_pu_bacteria 2515154114 2515646055 376
470 iso_pu_bacteria 2599185170 2599421001 376
471 iso_pu_bacteria 2838035591 2838041362 376
472 iso_pu_bacteria 2838661181 2838665754 376
473 iso_pu_bacteria 2510065019 2510134457 377
474 iso_pu_bacteria 2510461076 2510895883 377
475 iso_pu_bacteria 2510917028 2511183103 377
476 iso_pu_bacteria 2510917030 2511194853 377
477 iso_pu_bacteria 2511231027 2511390526 377
478 iso_pu_bacteria 2513237084 2513567428 377
479 iso_pu_bacteria 2513237088 2513596969 377
480 iso_pu_bacteria 2513237093 2513632088 377
481 iso_pu_bacteria 2513237103 2513712442 377
482 iso_pu_bacteria 2513237138 2513869768 377
483 iso_pu_bacteria 2513237144 2513910551 377
484 iso_pu_bacteria 2513237162 2514017812 377
485 iso_pu_bacteria 2515154113 2515635332 377
486 iso_pu_bacteria 2515154116 2515654849 377
487 iso_pu_bacteria 2515154134 2515739976 377
488 iso_pu_bacteria 2516653077 2517037235 377
489 iso_pu_bacteria 2516653085 2517077573 377
490 iso_pu_bacteria 2517093000 2517096344 377
491 iso_pu_bacteria 2517287029 2517408200 377
492 iso_pu_bacteria 2582581294 2585204578 377
493 iso_pu_bacteria 2582581298 2585225160 377
494 iso_pu_bacteria 2582581299 2585230772 377
495 iso_pu_bacteria 2582581304 2585259271 377
496 iso_pu_bacteria 2582581867 2585402843 377
497 iso_pu_bacteria 2585427526 2585525001 377
498 iso_pu_bacteria 2585427528 2585542697 377
499 iso_pu_bacteria 2585427529 2585547716 377
500 iso_pu_bacteria 2585427590 2585823495 377
501 iso_pu_bacteria 2585427593 2585841339 377
502 iso_pu_bacteria 2585427594 2585847518 377
503 iso_pu_bacteria 2643221599 2644003020 377
504 iso_pu_bacteria 2643221634 2644196758 377
505 iso_pu_bacteria 2643221643 2644237992 377
506 iso_pu_bacteria 2724679232 2725949300 377
507 iso_pu_bacteria 2738541293 2738803273 377
508 iso_pu_bacteria 2738541333 2739033323 377
509 iso_pu_bacteria 2765235942 2766066372 377
510 iso_pu_bacteria 2791355256 2793293930 377
511 iso_pu_bacteria 2791355262 2793335025 377
512 iso_pu_bacteria 2791355265 2793355405 377
513 iso_pu_bacteria 2802429605 2805929622 377
514 iso_pu_bacteria 2802429606 2805937294 377
515 iso_pu_bacteria 2802429633 2806047435 377
516 iso_pu_bacteria 2802429634 2806055214 377
517 iso_pu_bacteria 2802429635 2806062662 377
518 iso_pu_bacteria 2802429636 2806069710 377
519 iso_pu_bacteria 2802429637 2806075639 377
520 iso_pu_bacteria 2838668709 2838671856 377
521 iso_pu_bacteria 2838686498 2838686548 377
522 iso_pu_bacteria 2838701080 2838704535 377
523 iso_pu_bacteria 2838729681 2838734790 377
524 iso_pu_bacteria 2838742623 2838747405 377
525 iso_pu_bacteria 2841851746 2841854377 377
526 iso_pu_bacteria 2842110456 2842115485 377
527 iso_pu_bacteria 2842146304 2842149753 377
528 iso_pu_bacteria 2842156927 2842158604 377
529 iso_pu_bacteria 2842163707 2842168950 377
530 iso_pu_bacteria 2842180545 2842182218 377
531 iso_pu_bacteria 2842192696 2842195543 377
532 iso_pu_bacteria 2842205361 2842210864 377
533 iso_pu_bacteria 2842217011 2842218450 377
534 iso_pu_bacteria 2842229732 2842229782 377
535 iso_pu_bacteria 2842243621 2842243671 377
536 iso_pu_bacteria 2842257432 2842258244 377
537 iso_pu_bacteria 2842271015 2842271914 377
538 iso_pu_bacteria 2842278818 2842284318 377
539 iso_pu_bacteria 2842285085 2842285104 377
540 iso_pu_bacteria 2842304105 2842305526 377
541 iso_pu_bacteria 2842317721 2842320051 377
542 iso_pu_bacteria 2842402390 2842402462 377
543 iso_pu_bacteria 2842409023 2842410167 377
544 iso_pu_bacteria 2842415677 2842416815 377
545 iso_pu_bacteria 2842489311 2842493409 377
546 iso_pu_bacteria 2842495871 2842497559 377
547 iso_pu_bacteria 2842502639 2842504306 377
548 iso_pu_bacteria 2842871566 2842872855 377
549 iso_pu_bacteria 2844454524 2844457846 377
550 iso_pu_bacteria 2857516855 2857516918 377
551 iso_pu_bacteria 2919100787 2919105688 377
552 iso_pu_bacteria 2923556063 2923562028 377
553 iso_pu_bacteria 2933570622 2933571333 377
554 iso_pu_bacteria 2933586486 2933591900 377
555 iso_pu_bacteria 2935901341 2935901392 377
556 iso_pu_bacteria 2936367885 2936371537 377
557 iso_pu_bacteria 2936375103 2936376908 377
558 iso_pu_bacteria 2954011201 2954015410 377
559 iso_pu_bacteria 2996887358 2996892628 377
560 iso_pu_bacteria 3005445848 3005448927 377
561 iso_pu_bacteria 639633055 639649661 377
562 iso_pu_bacteria 8005258706 8005264745 377
563 iso_pu_bacteria 8005289223 8005289559 377
564 iso_pu_bacteria 8005321885 8005327155 377
565 iso_pu_bacteria 8005376324 8005382597 377
566 iso_pu_bacteria 8005542996 8005546154 377
567 iso_pu_bacteria 8005556819 8005561720 377
568 iso_pu_bacteria 8005563573 8005568499 377
569 iso_pu_bacteria 8005570704 8005572966 377
570 iso_pu_bacteria 8018163183 8018163259 377
571 iso_pu_bacteria 8023680758 8023682668 377
572 iso_pu_bacteria 8024479707 8024486024 377
573 iso_pu_bacteria 8024501048 8024501104 377
574 iso_pu_bacteria 8056382006 8056387424 377
575 iso_pu_bacteria 8057874678 8057881837 377
576 3300037471 Ga0395905_0111447 Ga0395905_0111447_1046_2227 378
577 3300046519 Ga0495632_0010916 Ga0495632_0010916_2752_3921 378
578 iso_pu_bacteria 2509276021 2509390088 378
579 iso_pu_bacteria 2509276033 2509447625 378
580 iso_pu_bacteria 2519899620 2520378484 378
581 iso_pu_bacteria 2585427608 2585897030 378
582 iso_pu_bacteria 2599185236 2599721753 378
583 iso_pu_bacteria 2615840624 2616296566 378
584 iso_pu_bacteria 2615840626 2616306564 378
585 iso_pu_bacteria 2718217882 2719182333 378
586 iso_pu_bacteria 2718217927 2719386924 378
587 iso_pu_bacteria 2718217997 2719666660 378
588 iso_pu_bacteria 2718218009 2719733049 378
589 iso_pu_bacteria 2718218199 2720493080 378
590 iso_pu_bacteria 2718218232 2720614558 378
591 iso_pu_bacteria 2718218233 2720621332 378
592 iso_pu_bacteria 2718218235 2720632658 378
593 iso_pu_bacteria 2718218269 2720776382 378
594 iso_pu_bacteria 2718218363 2721148446 378
595 iso_pu_bacteria 2718218365 2721159832 378
596 iso_pu_bacteria 2718218366 2721165260 378
597 iso_pu_bacteria 2718218423 2721400647 378
598 iso_pu_bacteria 2721755514 2722841430 378
599 iso_pu_bacteria 2721755556 2723027971 378
600 iso_pu_bacteria 2721755684 2723561601 378
601 iso_pu_bacteria 2721755685 2723568230 378
602 iso_pu_bacteria 2721755809 2724039460 378
603 iso_pu_bacteria 2721755810 2724045805 378
604 iso_pu_bacteria 2721755819 2724090989 378
605 iso_pu_bacteria 2721755822 2724105495 378
606 iso_pu_bacteria 2721755823 2724111320 378
607 iso_pu_bacteria 2728369352 2730108907 378
608 iso_pu_bacteria 2728369365 2730165568 378
609 iso_pu_bacteria 2728369397 2730299464 378
610 iso_pu_bacteria 2791355259 2793314396 378
611 iso_pu_bacteria 2791355260 2793323882 378
612 iso_pu_bacteria 2791355261 2793330166 378
613 iso_pu_bacteria 2791355263 2793342388 378
614 iso_pu_bacteria 2791355264 2793349756 378
615 iso_pu_bacteria 2791355266 2793362113 378
616 iso_pu_bacteria 2791355267 2793369968 378
617 iso_pu_bacteria 2838016132 2838019848 378
618 iso_pu_bacteria 2838022645 2838023354 378
619 iso_pu_bacteria 2838042994 2838045702 378
620 iso_pu_bacteria 2838048938 2838052656 378
621 iso_pu_bacteria 2838061910 2838064914 378
622 iso_pu_bacteria 2838068647 2838069641 378
623 iso_pu_bacteria 2838680041 2838682940 378
624 iso_pu_bacteria 2838694306 2838698117 378
625 iso_pu_bacteria 2838707686 2838711231 378
626 iso_pu_bacteria 2841864319 2841867476 378
627 iso_pu_bacteria 2842077413 2842079408 378
628 iso_pu_bacteria 2842118031 2842118082 378
629 iso_pu_bacteria 2842198810 2842198868 378
630 iso_pu_bacteria 2842237096 2842239996 378
631 iso_pu_bacteria 2842264693 2842268995 378
632 iso_pu_bacteria 2842291075 2842293069 378
633 iso_pu_bacteria 2842311132 2842314248 378
634 iso_pu_bacteria 2842341865 2842347553 378
635 iso_pu_bacteria 2842363717 2842368797 378
636 iso_pu_bacteria 2842370503 2842373569 378
637 iso_pu_bacteria 2842377471 2842379466 378
638 iso_pu_bacteria 2842384541 2842384593 378
639 iso_pu_bacteria 2842395702 2842400495 378
640 iso_pu_bacteria 2842422224 2842423255 378
641 iso_pu_bacteria 2842428310 2842433083 378
642 iso_pu_bacteria 2842434925 2842439388 378
643 iso_pu_bacteria 2842441272 2842446017 378
644 iso_pu_bacteria 2842447887 2842449045 378
645 iso_pu_bacteria 2842462802 2842467378 378
646 iso_pu_bacteria 2842469257 2842474173 378
647 iso_pu_bacteria 2933599457 2933600447 378
648 iso_pu_bacteria 2935894831 2935896500 378
649 iso_pu_bacteria 2936381700 2936383501 378
650 iso_pu_bacteria 2996893221 2996898141 378
651 iso_pu_bacteria 8005275841 8005281738 378
652 iso_pu_bacteria 8005282627 8005284306 378
653 iso_pu_bacteria 8005301065 8005303643 378
654 iso_pu_bacteria 8005382845 8005384560 378
655 iso_pu_bacteria 8005395548 8005395587 378
656 iso_pu_bacteria 8005430974 8005434436 378
657 iso_pu_bacteria 8005497431 8005501409 378
658 iso_pu_bacteria 8005619151 8005622771 378
659 iso_pu_bacteria 8005626139 8005630285 378
660 iso_pu_bacteria 8005668836 8005672830 378
661 iso_pu_bacteria 8005688590 8005691577 378
662 iso_pu_bacteria 8005695170 8005696709 378
663 iso_pu_bacteria 8018127388 8018130643 378
664 iso_pu_bacteria 8018176218 8018180577 378
665 iso_pu_bacteria 8056375014 8056377104 378
666 3300028794 Ga0307515_10007465 Ga0307515_100074658 379
667 iso_pu_bacteria 2510917022 2511133124 379
668 iso_pu_bacteria 2582581307 2585271864 379
669 iso_pu_bacteria 2582581308 2585279774 379
670 iso_pu_bacteria 2582581315 2585326687 379
671 iso_pu_bacteria 2582581316 2585333849 379
672 iso_pu_bacteria 2585427527 2585531823 379
673 iso_pu_bacteria 2585427530 2585551230 379
674 iso_pu_bacteria 2585427531 2585563773 379
675 iso_pu_bacteria 2585427609 2585907112 379
676 iso_pu_bacteria 2585428125 2587982894 379
677 iso_pu_bacteria 2615840698 2616551203 379
678 iso_pu_bacteria 2617270742 2617382949 379
679 iso_pu_bacteria 2667528174 2671113326 379
680 iso_pu_bacteria 2775507266 2778179067 379
681 iso_pu_bacteria 2818991448 2819611661 379
682 iso_pu_bacteria 2818991453 2819638661 379
683 iso_pu_bacteria 2838029111 2838031090 379
684 iso_pu_bacteria 2838694306 2838696226 379
685 iso_pu_bacteria 2838707686 2838710536 379
686 iso_pu_bacteria 2842077413 2842078709 379
687 iso_pu_bacteria 2842118031 2842118782 379
688 iso_pu_bacteria 2842237096 2842240692 379
689 iso_pu_bacteria 2842291075 2842292371 379
690 iso_pu_bacteria 2842370503 2842372222 379
691 iso_pu_bacteria 2842377471 2842378768 379
692 iso_pu_bacteria 2842384541 2842385292 379
693 iso_pu_bacteria 2842475841 2842477822 379
694 iso_pu_bacteria 2842482326 2842485120 379
695 iso_pu_bacteria 2919408235 2919411220 379
696 iso_pu_bacteria 2935894831 2935897195 379
697 iso_pu_bacteria 3005416602 3005421463 379
698 iso_pu_bacteria 8005314921 8005319832 379
699 iso_pu_bacteria 8005484373 8005490458 379
700 iso_pu_bacteria 8005682033 8005687030 379
701 3300002773 JGI25152J39213_1002897 JGI25152J39213_10028974 380
702 3300002774 JGI25150J39212_1001062 JGI25150J39212_10010624 380
703 3300003215 JGI25153J46596_10006185 JGI25153J46596_100061854 380
704 3300003215 JGI25153J46596_10006193 JGI25153J46596_100061934 380
705 3300005347 Ga0070668_100053210 Ga0070668_1000532102 380
706 3300006038 Ga0075365_10018612 Ga0075365_100186123 380
707 3300006178 Ga0075367_10000594 Ga0075367_100005949 380
708 3300006178 Ga0075367_10032705 Ga0075367_100327054 380
709 3300006186 Ga0075369_10001098 Ga0075369_100010983 380
710 3300009011 Ga0105251_10008240 Ga0105251_100082402 380
711 3300009766 Ga0123342_1020455 Ga0123342_10204552 380
712 3300025245 Ga0207425_1001070 Ga0207425_100107010 380
713 3300025258 Ga0209129_1003697 Ga0209129_10036972 380
714 3300025258 Ga0209129_1003923 Ga0209129_10039232 380
715 3300025258 Ga0209129_1003928 Ga0209129_10039282 380
716 3300025273 Ga0209673_1002608 Ga0209673_10026087 380
717 3300025294 Ga0209025_1003840 Ga0209025_10038402 380
718 3300025294 Ga0209025_1019769 Ga0209025_10197692 380
719 3300025295 Ga0209564_1006876 Ga0209564_10068762 380
720 3300025297 Ga0209758_1000422 Ga0209758_100042211 380
721 3300025297 Ga0209758_1001976 Ga0209758_100197611 380
722 3300025299 Ga0209256_1003132 Ga0209256_10031327 380
723 3300025299 Ga0209256_1016346 Ga0209256_10163462 380
724 3300025302 Ga0207426_1000447 Ga0207426_100044713 380
725 3300025923 Ga0207681_10055172 Ga0207681_100551722 380
726 3300025941 Ga0207711_10219817 Ga0207711_102198172 380
727 3300025972 Ga0207668_10019754 Ga0207668_100197542 380
728 3300041413 Ga0439465_0004344 Ga0439465_0004344_3105_4280 380
729 3300044672 Ga0466982_0121402 Ga0466982_0121402_126_1301 380
730 3300046512 Ga0495610_0026104 Ga0495610_0026104_345_1520 380
731 3300046513 Ga0495616_0078710 Ga0495616_0078710_369_1544 380
732 3300047472 Ga0495686_0037187 Ga0495686_0037187_272_1447 380
733 3300048905 Ga0496102_0148371 Ga0496102_0148371_265_1440 380
734 3300048907 Ga0496104_0158887 Ga0496104_0158887_138_1313 380
735 3300048919 Ga0496116_0054513 Ga0496116_0054513_1332_2507 380
736 3300048920 Ga0496117_0046355 Ga0496117_0046355_1002_2177 380
737 3300048921 Ga0496118_0021581 Ga0496118_0021581_2907_4082 380
738 3300048924 Ga0496121_0006969 Ga0496121_0006969_6525_7700 380
739 3300048925 Ga0496122_0011784 Ga0496122_0011784_7243_8418 380
740 3300048925 Ga0496122_0119389 Ga0496122_0119389_414_1589 380
741 3300048926 Ga0496123_0016864 Ga0496123_0016864_3053_4228 380
742 3300048927 Ga0496124_0019699 Ga0496124_0019699_840_2015 380
743 3300048927 Ga0496124_0121405 Ga0496124_0121405_748_1923 380
744 3300048928 Ga0496125_0004359 Ga0496125_0004359_1482_2657 380
745 3300048929 Ga0496126_0191951 Ga0496126_0191951_38_1213 380
746 3300049569 Ga0501032_0021199 Ga0501032_0021199_1882_3057 380
747 3300049572 Ga0501036_0250830 Ga0501036_0250830_14_1189 380
748 3300049579 Ga0501043_0012005 Ga0501043_0012005_3918_5093 380
749 3300049581 Ga0501047_0086377 Ga0501047_0086377_1471_2646 380
750 3300049744 Ga0501083_0071524 Ga0501083_0071524_976_2151 380
751 3300049823 Ga0501044_0021271 Ga0501044_0021271_967_2220 380
752 3300050494 nmdc:mga06z11_39781_c1 nmdc:mga06z11_39781_c1_857_2032 380
753 3300053156 Ga0500622_0000593 Ga0500622_0000593_12980_14155 380
754 iso_pu_bacteria 2524023209 2524458645 380
755 iso_pu_bacteria 2842298080 2842300093 380
756 iso_pu_bacteria 2842357229 2842359004 380
757 iso_pu_bacteria 2842509118 2842511525 380
758 iso_pu_bacteria 2852387548 2852391934 380
759 iso_pu_bacteria 8046767195 8046767427 380
760 iso_pu_bacteria 8057575449 8057580328 380
761 3300003790 Ga0055528_1000525 Ga0055528_100052513 381
762 3300003792 Ga0055540_1000215 Ga0055540_10002158 381
763 3300025273 Ga0209673_1000478 Ga0209673_100047846 381
764 3300025273 Ga0209673_1001746 Ga0209673_100174613 381
765 3300025292 Ga0209676_1014043 Ga0209676_10140432 381
766 3300025295 Ga0209564_1000215 Ga0209564_10002159 381
767 3300025298 Ga0209050_1002262 Ga0209050_10022627 381
768 3300025299 Ga0209256_1000155 Ga0209256_1000155107 381
769 3300025303 Ga0209051_1000321 Ga0209051_100032122 381
770 3300025304 Ga0209257_1006251 Ga0209257_10062515 381
771 3300046492 Ga0495585_0001460 Ga0495585_0001460_3014_4195 381
772 3300046501 Ga0495607_0070509 Ga0495607_0070509_252_1433 381
773 3300046506 Ga0495583_0015186 Ga0495583_0015186_1161_2342 381
774 3300046518 Ga0495631_0003030 Ga0495631_0003030_5322_6503 381
775 3300046522 Ga0495643_0022396 Ga0495643_0022396_723_1904 381
776 3300046530 Ga0495654_0056634 Ga0495654_0056634_435_1616 381
777 3300046616 Ga0495668_0037790 Ga0495668_0037790_923_2104 381
778 3300046648 Ga0495611_0046586 Ga0495611_0046586_45_1226 381
779 3300046660 Ga0495625_0002949 Ga0495625_0002949_13229_14410 381
780 3300046691 Ga0495670_0032345 Ga0495670_0032345_323_1504 381
781 3300047320 Ga0495672_0011616 Ga0495672_0011616_2378_3559 381
782 3300048921 Ga0496118_0003900 Ga0496118_0003900_2390_3568 381
783 3300049459 Ga0495678_010790 Ga0495678_010790_3193_4374 381
784 3300049460 Ga0495682_0018894 Ga0495682_0018894_86_1267 381
785 3300053105 Ga0500557_000349 Ga0500557_000349_3206_4387 381
786 3300053109 Ga0500569_000512 Ga0500569_000512_2389_3570 381
787 3300053118 Ga0500594_0000677 Ga0500594_0000677_3037_4218 381
788 3300053139 Ga0500568_0000123 Ga0500568_0000123_2824_4005 381
789 3300053142 Ga0500577_0004573 Ga0500577_0004573_399_1580 381
790 3300053153 Ga0500616_0001502 Ga0500616_0001502_724_1905 381
791 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004152 383
792 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001428 383
793 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001568 383
794 3300002737 JGI25162J39368_1000789 JGI25162J39368_10007897 383
795 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002680 383
796 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005111 383
797 3300003214 JGI25165J46597_1000642 JGI25165J46597_100064215 383
798 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002214 383
799 3300003374 JGI25161J50226_1000024 JGI25161J50226_1000024118 383
800 3300004625 Ga0055543_1000025 Ga0055543_100002514 383
801 3300005262 Ga0065165_1000200 Ga0065165_100020014 383
802 3300005367 Ga0070667_100234831 Ga0070667_1002348312 383
803 3300005548 Ga0070665_100093027 Ga0070665_1000930272 383
804 3300005578 Ga0068854_100084398 Ga0068854_1000843982 383
805 3300009093 Ga0105240_10000013 Ga0105240_10000013385 383
806 3300009545 Ga0105237_10000949 Ga0105237_100009492 383
807 3300010375 Ga0105239_10000768 Ga0105239_1000076814 383
808 3300013104 Ga0157370_10001544 Ga0157370_1000154411 383
809 3300015262 Ga0182007_10004365 Ga0182007_100043655 383
810 3300025206 Ga0209435_100009 Ga0209435_100009108 383
811 3300025233 Ga0209437_100204 Ga0209437_10020414 383
812 3300025246 Ga0209646_1000018 Ga0209646_1000018108 383
813 3300025250 Ga0209026_1000043 Ga0209026_1000043108 383
814 3300025253 Ga0209677_100265 Ga0209677_10026525 383
815 3300025256 Ga0209759_1000007 Ga0209759_1000007108 383
816 3300025261 Ga0209233_1000255 Ga0209233_100025548 383
817 3300025261 Ga0209233_1000332 Ga0209233_100033214 383
818 3300025284 Ga0209130_1000164 Ga0209130_100016427 383
819 3300025302 Ga0207426_1000082 Ga0207426_100008227 383
820 3300025321 Ga0207656_10016374 Ga0207656_100163741 383
821 3300025913 Ga0207695_10000044 Ga0207695_10000044342 383
822 3300025914 Ga0207671_10000043 Ga0207671_10000043146 383
823 3300027312 Ga0209371_1003713 Ga0209371_10037132 383
824 3300028379 Ga0268266_10084411 Ga0268266_100844112 383
825 3300030500 Ga0268256_1003408 Ga0268256_10034082 383
826 3300045836 Ga0466958_0079006 Ga0466958_0079006_775_1956 383
827 3300046507 Ga0495606_0089349 Ga0495606_0089349_369_1553 383
828 3300048903 Ga0496100_0087787 Ga0496100_0087787_879_2060 383
829 3300048905 Ga0496102_0111333 Ga0496102_0111333_1156_2337 383
830 3300048919 Ga0496116_0047915 Ga0496116_0047915_1273_2454 383
831 3300048920 Ga0496117_0007061 Ga0496117_0007061_470_1651 383
832 3300048921 Ga0496118_0005464 Ga0496118_0005464_1140_2321 383
833 3300048922 Ga0496119_0018154 Ga0496119_0018154_1116_2297 383
834 3300048922 Ga0496119_0058203 Ga0496119_0058203_287_1471 383
835 3300048923 Ga0496120_0005215 Ga0496120_0005215_8803_9984 383
836 3300048924 Ga0496121_0009632 Ga0496121_0009632_429_1610 383
837 3300048924 Ga0496121_0025908 Ga0496121_0025908_375_1559 383
838 3300048925 Ga0496122_0055741 Ga0496122_0055741_438_1619 383
839 3300048926 Ga0496123_0049062 Ga0496123_0049062_247_1428 383
840 3300048927 Ga0496124_0089357 Ga0496124_0089357_1202_2383 383
841 3300053125 Ga0500618_011655 Ga0500618_011655_170_1351 383
842 3300053140 Ga0500573_0074876 Ga0500573_0074876_682_1866 383
843 iso_pu_bacteria 8005645114 8005647101 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

53

102

0.97

PF13437

HlyD_3

HlyD family secretion protein

164

275

0.86

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

46

278

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qwe-assembly1.cif.gz_A-2 crystal structure of the n-terminal domain of the gem interacting protein 0.9516 91 157
3tul-assembly5.cif.gz_C crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.929 93 157
6h2e-assembly1.cif.gz_Q-2 structure of the soluble ahlc of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.9169 93 157
3tul-assembly5.cif.gz_A crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.9144 93 157
2fic-assembly2.cif.gz_A the crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition 0.9112 92 155
ID Description Score Start End Superfamily
3qweA00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9516 91 157 1.20.1270.60
af_Q555L8_1_280_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9493 91 155 1.20.1270.60
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9484 57 188 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9457 57 190 2.40.50.100
af_Q55DK5_17_291_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9417 92 157 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A522CAK5-F1-model_v4 HlyD family secretion protein 0.8931 53 194 GO:0030313
AF-A0A534FSU2-F1-model_v4 Biotin/lipoyl-binding protein 0.8687 49 202 GO:0005886
AF-A0A0B8Q846-F1-model_v4 Membrane fusion protein 0.8529 21 294 GO:0015562
GO:0019898
GO:0030313
GO:1990195
GO:1990281
GO:1990961
AF-A0A292SQW5-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.8448 45 285 GO:0015562
GO:1990281
AF-A0A0B8Q846-F1-model_v4 Membrane fusion protein 0.8407 21 294 GO:0015562
GO:0019898
GO:0030313
GO:1990195
GO:1990281
GO:1990961

Feature Viewer

pLDDT pTM Quality
80.47 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map