F482988

General Info

Members Datasets Scaffolds Average Seq Length
838 294 1676 110

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0249341|Ga0373951_0249341_108_485
Length 125
Sequence MMRYSSCEATPGEDAMAQSTLGLLQGTVDVLILRTLSWTSMHGYGIARWINDRSDGALAVEDAALYQALHRLERKGFVESEWGTADTGHRAKYYTLTPAGRRQLKSEVAELRQYMGVLFRVLDTA

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
103 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
215 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
256 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
263 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
264 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
265 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
266 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
267 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
268 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
269 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
270 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
271 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
272 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
273 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
274 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
275 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
276 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.43
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 15.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0249341 3300035091 Unclassified 533
2 JGI24750J21931_1044345 3300002070 Bacteria 682
3 JGI24738J21930_10147362 3300002075 Bacteria 522
4 Ga0065704_10170423 3300005289 Bacteria 1295
5 Ga0065712_10226648 3300005290 Bacteria 1024
6 Ga0065712_10435187 3300005290 Bacteria 699
7 Ga0065715_10397249 3300005293 Bacteria 881
8 Ga0065707_10089614 3300005295 Bacteria 4321
9 Ga0065707_10226310 3300005295 Bacteria 1205
10 Ga0065707_10448822 3300005295 Bacteria 802
11 Ga0070658_10219079 3300005327 Bacteria 1609
12 Ga0070676_10000961 3300005328 Bacteria 14329
13 Ga0070676_10060071 3300005328 Bacteria 2256
14 Ga0070676_10104009 3300005328 Bacteria 1759
15 Ga0070676_10785145 3300005328 Bacteria 702
16 Ga0070676_10908980 3300005328 Unclassified 656
17 Ga0070683_100006724 3300005329 Bacteria 9658
18 Ga0070683_100010564 3300005329 Bacteria 7937
19 Ga0070683_100017372 3300005329 Bacteria 6358
20 Ga0070683_100107775 3300005329 Bacteria 2627
21 Ga0070683_100132329 3300005329 Bacteria 2361
22 Ga0070683_100136014 3300005329 Bacteria 2327
23 Ga0070683_100482676 3300005329 Unclassified 1183
24 Ga0070683_101453131 3300005329 Bacteria 659
25 Ga0070690_100010030 3300005330 Bacteria 5499
26 Ga0070690_100046934 3300005330 Bacteria 2747
27 Ga0070690_100167819 3300005330 Bacteria 1509
28 Ga0070670_100004272 3300005331 Bacteria 11953
29 Ga0070670_100014959 3300005331 Bacteria 6659
30 Ga0070670_100017626 3300005331 Bacteria 6130
31 Ga0070670_100090828 3300005331 Bacteria 2625
32 Ga0070670_100099760 3300005331 Unclassified 2499
33 Ga0070670_100146746 3300005331 Bacteria 2041
34 Ga0070670_100717404 3300005331 Bacteria 900
35 Ga0070670_101521521 3300005331 Bacteria 614
36 Ga0070677_10018579 3300005333 Bacteria 2505
37 Ga0070677_10890432 3300005333 Unclassified 514
38 Ga0068869_100001352 3300005334 Bacteria 14527
39 Ga0068869_100004561 3300005334 Bacteria 8628
40 Ga0068869_100565252 3300005334 Unclassified 957
41 Ga0068869_101122298 3300005334 Bacteria 689
42 Ga0070666_10221029 3300005335 Bacteria 1336
43 Ga0070666_10239585 3300005335 Bacteria 1283
44 Ga0070680_100018166 3300005336 Bacteria 5555
45 Ga0070680_100027439 3300005336 Bacteria 4559
46 Ga0070682_100064588 3300005337 Bacteria 2324
47 Ga0070682_100070392 3300005337 Unclassified 2236
48 Ga0070682_100103758 3300005337 Bacteria 1882
49 Ga0068868_100009552 3300005338 Bacteria 6992
50 Ga0068868_100039678 3300005338 Bacteria 3659
51 Ga0068868_100817083 3300005338 Bacteria 842
52 Ga0070660_100188696 3300005339 Unclassified 1669
53 Ga0070660_100402491 3300005339 Bacteria 1132
54 Ga0070660_100697589 3300005339 Bacteria 851
55 Ga0070660_100981430 3300005339 Bacteria 713
56 Ga0070689_100007571 3300005340 Bacteria 7604
57 Ga0070689_100027544 3300005340 Bacteria 4284
58 Ga0070689_100118892 3300005340 Bacteria 2109
59 Ga0070689_100269017 3300005340 Bacteria 1410
60 Ga0070687_100012616 3300005343 Bacteria 3738
61 Ga0070687_100082251 3300005343 Bacteria 1760
62 Ga0070661_100001181 3300005344 Bacteria 18433
63 Ga0070661_100015432 3300005344 Bacteria 5392
64 Ga0070661_100054102 3300005344 Bacteria 2940
65 Ga0070661_100081768 3300005344 Bacteria 2385
66 Ga0070661_100490294 3300005344 Bacteria 982
67 Ga0070661_101236245 3300005344 Bacteria 625
68 Ga0070692_10004281 3300005345 Bacteria 5933
69 Ga0070692_10009184 3300005345 Bacteria 4447
70 Ga0070692_10801765 3300005345 Unclassified 643
71 Ga0070668_100001373 3300005347 Bacteria 17444
72 Ga0070668_100020945 3300005347 Bacteria 4940
73 Ga0070668_100025751 3300005347 Bacteria 4461
74 Ga0070669_100023989 3300005353 Bacteria 4370
75 Ga0070669_100055298 3300005353 Bacteria 2908
76 Ga0070669_100496728 3300005353 Bacteria 1012
77 Ga0070669_100582693 3300005353 Bacteria 936
78 Ga0070675_100004932 3300005354 Bacteria 10175
79 Ga0070675_100027068 3300005354 Bacteria 4605
80 Ga0070675_100042312 3300005354 Bacteria 3722
81 Ga0070675_100048791 3300005354 Bacteria 3472
82 Ga0070675_100094235 3300005354 Bacteria 2512
83 Ga0070675_100400548 3300005354 Bacteria 1224
84 Ga0070675_101450867 3300005354 Bacteria 633
85 Ga0070671_100186610 3300005355 Bacteria 1757
86 Ga0070671_100215064 3300005355 Archaea 1631
87 Ga0070671_100401779 3300005355 Bacteria 1172
88 Ga0070674_100093448 3300005356 Bacteria 2176
89 Ga0070674_100138703 3300005356 Bacteria 1823
90 Ga0070674_100663504 3300005356 Bacteria 888
91 Ga0070674_101624080 3300005356 Unclassified 583
92 Ga0070674_102001899 3300005356 Unclassified 527
93 Ga0070673_100084798 3300005364 Bacteria 2577
94 Ga0070673_100115853 3300005364 Bacteria 2229
95 Ga0070673_100190603 3300005364 Bacteria 1761
96 Ga0070673_100320599 3300005364 Bacteria 1369
97 Ga0070673_100904251 3300005364 Bacteria 819
98 Ga0070673_100924310 3300005364 Unclassified 810
99 Ga0070688_100032102 3300005365 Bacteria 3163
100 Ga0070688_100054175 3300005365 Unclassified 2511
101 Ga0070688_100083614 3300005365 Bacteria 2072
102 Ga0070688_100086504 3300005365 Bacteria 2040
103 Ga0070659_100001392 3300005366 Bacteria 17454
104 Ga0070659_100026417 3300005366 Bacteria 4468
105 Ga0070659_100043659 3300005366 Bacteria 3506
106 Ga0070659_100066568 3300005366 Unclassified 2855
107 Ga0070659_100125588 3300005366 Bacteria 2081
108 Ga0070659_100341191 3300005366 Unclassified 1255
109 Ga0070659_100855872 3300005366 Bacteria 793
110 Ga0070667_100028433 3300005367 Bacteria 4654
111 Ga0070667_100070794 3300005367 Bacteria 2969
112 Ga0070667_100089522 3300005367 Bacteria 2644
113 Ga0070667_100255390 3300005367 Bacteria 1568
114 Ga0070667_100927048 3300005367 Unclassified 811
115 Ga0070667_101103569 3300005367 Bacteria 742
116 Ga0070703_10193194 3300005406 Bacteria 794
117 Ga0070709_10850331 3300005434 Bacteria 719
118 Ga0070714_100576593 3300005435 Bacteria 1079
119 Ga0070701_10001896 3300005438 Bacteria 7925
120 Ga0070701_10002221 3300005438 Bacteria 7422
121 Ga0070701_10547778 3300005438 Bacteria 758
122 Ga0070711_100082081 3300005439 Bacteria 2299
123 Ga0070711_100436021 3300005439 Bacteria 1070
124 Ga0070705_101179567 3300005440 Unclassified 630
125 Ga0070700_100026206 3300005441 Bacteria 3440
126 Ga0070700_100101185 3300005441 Bacteria 1899
127 Ga0070700_100416047 3300005441 Bacteria 1015
128 Ga0070694_100008690 3300005444 Bacteria 6220
129 Ga0070694_100359764 3300005444 Bacteria 1130
130 Ga0070708_100327241 3300005445 Bacteria 1444
131 Ga0070663_100008954 3300005455 Bacteria 6180
132 Ga0070663_100619539 3300005455 Unclassified 912
133 Ga0070678_100085428 3300005456 Bacteria 2405
134 Ga0070678_100688900 3300005456 Bacteria 920
135 Ga0070678_101605363 3300005456 Unclassified 611
136 Ga0070662_100001809 3300005457 Bacteria 13144
137 Ga0070662_100004300 3300005457 Bacteria 8994
138 Ga0070662_100038589 3300005457 Bacteria 3393
139 Ga0070662_100067164 3300005457 Bacteria 2633
140 Ga0070662_100279927 3300005457 Bacteria 1350
141 Ga0070681_10000205 3300005458 Bacteria 46132
142 Ga0070681_10005352 3300005458 Bacteria 12390
143 Ga0070681_10054229 3300005458 Unclassified 3994
144 Ga0070681_10074491 3300005458 Bacteria 3356
145 Ga0068867_100045755 3300005459 Bacteria 3211
146 Ga0068867_100052148 3300005459 Bacteria 3018
147 Ga0068867_100057900 3300005459 Bacteria 2871
148 Ga0068867_100240277 3300005459 Bacteria 1468
149 Ga0068867_101870679 3300005459 Bacteria 565
150 Ga0070685_10154109 3300005466 Bacteria 1459
151 Ga0070685_10766648 3300005466 Unclassified 709
152 Ga0070685_11002145 3300005466 Bacteria 627
153 Ga0070707_100422766 3300005468 Bacteria 1293
154 Ga0070698_100001612 3300005471 Bacteria 25109
155 Ga0070698_100225835 3300005471 Unclassified 1806
156 Ga0070699_100003321 3300005518 Bacteria 14230
157 Ga0070699_101310390 3300005518 Unclassified 664
158 Ga0070679_100014126 3300005530 Bacteria 7658
159 Ga0070679_100041785 3300005530 Bacteria 4564
160 Ga0070679_100869196 3300005530 Bacteria 845
161 Ga0070679_101373936 3300005530 Unclassified 652
162 Ga0070684_100006226 3300005535 Bacteria 9209
163 Ga0070684_100009915 3300005535 Bacteria 7528
164 Ga0070684_100012830 3300005535 Bacteria 6731
165 Ga0070684_100014258 3300005535 Bacteria 6433
166 Ga0070684_100127226 3300005535 Unclassified 2296
167 Ga0070684_100203440 3300005535 Bacteria 1804
168 Ga0070684_100214608 3300005535 Bacteria 1754
169 Ga0070684_100383004 3300005535 Bacteria 1295
170 Ga0070684_100766758 3300005535 Bacteria 901
171 Ga0070684_100791601 3300005535 Unclassified 886
172 Ga0068853_100029031 3300005539 Bacteria 4657
173 Ga0068853_100087582 3300005539 Bacteria 2733
174 Ga0068853_100526569 3300005539 Bacteria 1118
175 Ga0068853_100653100 3300005539 Unclassified 1001
176 Ga0070672_100014766 3300005543 Bacteria 5541
177 Ga0070672_100031155 3300005543 Bacteria 4012
178 Ga0070672_100034535 3300005543 Bacteria 3838
179 Ga0070672_100042037 3300005543 Bacteria 3517
180 Ga0070672_100060295 3300005543 Bacteria 2987
181 Ga0070672_101162574 3300005543 Unclassified 687
182 Ga0070686_100144410 3300005544 Bacteria 1660
183 Ga0070686_100158851 3300005544 Bacteria 1590
184 Ga0070695_100553749 3300005545 Bacteria 897
185 Ga0070695_101172202 3300005545 Bacteria 631
186 Ga0070696_100000259 3300005546 Bacteria 32023
187 Ga0070696_100085478 3300005546 Bacteria 2239
188 Ga0070693_101196689 3300005547 Unclassified 583
189 Ga0070665_100183031 3300005548 Bacteria 2096
190 Ga0070665_100275127 3300005548 Bacteria 1685
191 Ga0070665_100300582 3300005548 Bacteria 1608
192 Ga0070665_101486569 3300005548 Bacteria 686
193 Ga0070665_102213911 3300005548 Unclassified 553
194 Ga0070704_100493234 3300005549 Unclassified 1062
195 Ga0070704_102155241 3300005549 Unclassified 518
196 Ga0068855_100011773 3300005563 Bacteria 10577
197 Ga0068855_100036114 3300005563 Bacteria 5883
198 Ga0070664_100002437 3300005564 Bacteria 14961
199 Ga0070664_100006032 3300005564 Bacteria 9800
200 Ga0070664_100007254 3300005564 Bacteria 8936
201 Ga0070664_100014143 3300005564 Bacteria 6510
202 Ga0070664_100018487 3300005564 Bacteria 5727
203 Ga0070664_100019542 3300005564 Bacteria 5573
204 Ga0070664_100026440 3300005564 Bacteria 4814
205 Ga0070664_100074334 3300005564 Bacteria 2917
206 Ga0070664_100227452 3300005564 Unclassified 1671
207 Ga0070664_100355186 3300005564 Bacteria 1334
208 Ga0070664_100579112 3300005564 Bacteria 1040
209 Ga0068857_100000581 3300005577 Bacteria 26730
210 Ga0068857_100008229 3300005577 Bacteria 9016
211 Ga0068857_100015424 3300005577 Bacteria 6673
212 Ga0068857_100059511 3300005577 Bacteria 3393
213 Ga0068857_100060072 3300005577 Bacteria 3377
214 Ga0068857_100803776 3300005577 Unclassified 898
215 Ga0068857_101935463 3300005577 Unclassified 578
216 Ga0068854_100143492 3300005578 Bacteria 1835
217 Ga0068854_101237082 3300005578 Bacteria 670
218 Ga0070702_100191714 3300005615 Bacteria 1346
219 Ga0068852_100001386 3300005616 Bacteria 16294
220 Ga0068852_100067936 3300005616 Bacteria 3117
221 Ga0068852_100191536 3300005616 Bacteria 1930
222 Ga0068852_100354885 3300005616 Bacteria 1433
223 Ga0068852_102010228 3300005616 Unclassified 600
224 Ga0068859_100167465 3300005617 Unclassified 2277
225 Ga0068859_100424801 3300005617 Bacteria 1425
226 Ga0068859_101595836 3300005617 Bacteria 720
227 Ga0068859_102137461 3300005617 Bacteria 618
228 Ga0068864_100289082 3300005618 Bacteria 1532
229 Ga0068864_100455060 3300005618 Bacteria 1224
230 Ga0068864_100695387 3300005618 Bacteria 993
231 Ga0068864_100762035 3300005618 Bacteria 949
232 Ga0068864_101103012 3300005618 Bacteria 790
233 Ga0068864_101409828 3300005618 Bacteria 699
234 Ga0068866_10095997 3300005718 Bacteria 1625
235 Ga0068861_100000287 3300005719 Bacteria 28299
236 Ga0068861_100011688 3300005719 Bacteria 6108
237 Ga0068861_100055907 3300005719 Bacteria 3011
238 Ga0068851_10029729 3300005834 Bacteria 2707
239 Ga0068851_10047760 3300005834 Bacteria 2169
240 Ga0068851_10050786 3300005834 Bacteria 2106
241 Ga0068870_10124059 3300005840 Bacteria 1491
242 Ga0068870_10172336 3300005840 Unclassified 1292
243 Ga0068863_100021081 3300005841 Bacteria 6224
244 Ga0068863_100074294 3300005841 Bacteria 3216
245 Ga0068863_101051723 3300005841 Unclassified 818
246 Ga0068858_100280179 3300005842 Bacteria 1587
247 Ga0068858_100700612 3300005842 Bacteria 985
248 Ga0068860_100370928 3300005843 Bacteria 1411
249 Ga0068860_100412277 3300005843 Bacteria 1338
250 Ga0068860_100512699 3300005843 Bacteria 1198
251 Ga0068860_100802185 3300005843 Bacteria 955
252 Ga0068862_100003813 3300005844 Bacteria 12838
253 Ga0068862_100020010 3300005844 Bacteria 5587
254 Ga0068862_100033498 3300005844 Bacteria 4343
255 Ga0068862_100247678 3300005844 Bacteria 1623
256 Ga0068862_100459889 3300005844 Bacteria 1201
257 Ga0068862_101103098 3300005844 Bacteria 789
258 Ga0081539_10000107 3300005985 Bacteria 195503
259 Ga0070712_100036883 3300006175 Bacteria 3329
260 Ga0070712_100277667 3300006175 Bacteria 1348
261 Ga0097621_100241602 3300006237 Bacteria 1579
262 Ga0068871_100683570 3300006358 Bacteria 939
263 Ga0068871_101053833 3300006358 Unclassified 759
264 Ga0068871_101125573 3300006358 Bacteria 735
265 Ga0075428_100009561 3300006844 Bacteria 10767
266 Ga0075428_100032981 3300006844 Bacteria 5717
267 Ga0075428_100082297 3300006844 Bacteria 3512
268 Ga0075428_100218637 3300006844 Bacteria 2058
269 Ga0075428_101190085 3300006844 Bacteria 804
270 Ga0075430_100004278 3300006846 Bacteria 12053
271 Ga0075430_100013038 3300006846 Bacteria 7085
272 Ga0075430_100029215 3300006846 Bacteria 4680
273 Ga0075430_100071214 3300006846 Bacteria 2916
274 Ga0075430_100134289 3300006846 Bacteria 2062
275 Ga0075430_100248518 3300006846 Unclassified 1474
276 Ga0075430_100835493 3300006846 Bacteria 759
277 Ga0075430_101652659 3300006846 Unclassified 526
278 Ga0075431_100015380 3300006847 Bacteria 7753
279 Ga0075431_100051632 3300006847 Bacteria 4240
280 Ga0075431_100082189 3300006847 Bacteria 3325
281 Ga0075431_100100477 3300006847 Bacteria 2984
282 Ga0075431_100188101 3300006847 Bacteria 2116
283 Ga0075431_100260693 3300006847 Bacteria 1759
284 Ga0075431_100694152 3300006847 Unclassified 996
285 Ga0075433_10030408 3300006852 Bacteria 4608
286 Ga0075433_10088425 3300006852 Bacteria 2738
287 Ga0075434_100000988 3300006871 Bacteria 23007
288 Ga0075434_100013039 3300006871 Bacteria 7892
289 Ga0075434_100375193 3300006871 Bacteria 1443
290 Ga0075434_101242100 3300006871 Unclassified 757
291 Ga0075429_100025558 3300006880 Bacteria 5125
292 Ga0075429_100066751 3300006880 Bacteria 3132
293 Ga0075429_100561226 3300006880 Bacteria 1000
294 Ga0068865_100010062 3300006881 Bacteria 5883
295 Ga0068865_100114445 3300006881 Bacteria 1995
296 Ga0068865_100244376 3300006881 Bacteria 1414
297 Ga0068865_101022491 3300006881 Unclassified 724
298 Ga0097620_100167467 3300006931 Unclassified 2277
299 Ga0097620_100424786 3300006931 Bacteria 1425
300 Ga0097620_102137193 3300006931 Bacteria 618
301 Ga0075435_100100681 3300007076 Bacteria 2394
302 Ga0075435_101070024 3300007076 Bacteria 705
303 Ga0105240_12084134 3300009093 Bacteria 589
304 Ga0105240_12282054 3300009093 Bacteria 561
305 Ga0111539_10057138 3300009094 Bacteria 4634
306 Ga0111539_10064443 3300009094 Bacteria 4335
307 Ga0111539_10072444 3300009094 Bacteria 4063
308 Ga0111539_10490748 3300009094 Bacteria 1430
309 Ga0111539_10528343 3300009094 Bacteria 1374
310 Ga0111539_11303882 3300009094 Unclassified 843
311 Ga0105245_10024740 3300009098 Bacteria 5275
312 Ga0105245_11036755 3300009098 Bacteria 865
313 Ga0114129_10005906 3300009147 Bacteria 17319
314 Ga0114129_10279029 3300009147 Bacteria 2233
315 Ga0105243_10028077 3300009148 Bacteria 4316
316 Ga0105243_10447984 3300009148 Bacteria 1210
317 Ga0105243_10594025 3300009148 Bacteria 1065
318 Ga0105241_10039884 3300009174 Unclassified 3543
319 Ga0105241_10994366 3300009174 Bacteria 784
320 Ga0105242_10060876 3300009176 Bacteria 3104
321 Ga0105242_10129143 3300009176 Bacteria 2179
322 Ga0105242_10139040 3300009176 Bacteria 2105
323 Ga0105242_10319864 3300009176 Bacteria 1423
324 Ga0105242_10552633 3300009176 Bacteria 1104
325 Ga0105242_11252364 3300009176 Unclassified 763
326 Ga0105242_12837764 3300009176 Bacteria 535
327 Ga0105248_10035475 3300009177 Bacteria 5579
328 Ga0105248_10065111 3300009177 Bacteria 4092
329 Ga0105248_10073865 3300009177 Bacteria 3833
330 Ga0105248_10475888 3300009177 Bacteria 1408
331 Ga0105248_10506281 3300009177 Bacteria 1361
332 Ga0105248_11075693 3300009177 Bacteria 909
333 Ga0105237_10131699 3300009545 Unclassified 2495
334 Ga0105237_10249783 3300009545 Unclassified 1776
335 Ga0105249_10001386 3300009553 Bacteria 21216
336 Ga0105249_10009897 3300009553 Bacteria 8359
337 Ga0105249_10025570 3300009553 Bacteria 5316
338 Ga0105249_10095820 3300009553 Unclassified 2783
339 Ga0105239_10006810 3300010375 Bacteria 13185
340 Ga0105239_10221250 3300010375 Bacteria 2123
341 Ga0105239_13168323 3300010375 Bacteria 536
342 Ga0105246_11616037 3300011119 Unclassified 613
343 Ga0157314_1028014 3300012500 Bacteria 617
344 Ga0157313_1044861 3300012503 Bacteria 556
345 Ga0157373_10096727 3300013100 Bacteria 2079
346 Ga0157373_10299815 3300013100 Unclassified 1141
347 Ga0157373_10478670 3300013100 Bacteria 898
348 Ga0157371_10022158 3300013102 Bacteria 4659
349 Ga0157371_10462434 3300013102 Bacteria 934
350 Ga0157370_10594267 3300013104 Bacteria 1013
351 Ga0157369_10030564 3300013105 Bacteria 5939
352 Ga0157369_10035575 3300013105 Bacteria 5460
353 Ga0157369_10084474 3300013105 Bacteria 3393
354 Ga0157369_11042361 3300013105 Unclassified 837
355 Ga0157374_10026096 3300013296 Bacteria 5254
356 Ga0157374_10079996 3300013296 Bacteria 3098
357 Ga0157374_10375416 3300013296 Bacteria 1416
358 Ga0157374_10554632 3300013296 Unclassified 1157
359 Ga0157378_10031506 3300013297 Bacteria 4682
360 Ga0157378_10152181 3300013297 Bacteria 2156
361 Ga0157378_10236998 3300013297 Unclassified 1741
362 Ga0157378_10387802 3300013297 Bacteria 1373
363 Ga0163162_10010957 3300013306 Bacteria 8830
364 Ga0163162_10075043 3300013306 Bacteria 3441
365 Ga0163162_10099652 3300013306 Bacteria 2996
366 Ga0163162_10240490 3300013306 Bacteria 1941
367 Ga0157372_10022971 3300013307 Bacteria 6756
368 Ga0157372_10030155 3300013307 Bacteria 5931
369 Ga0157372_10270199 3300013307 Bacteria 1975
370 Ga0157372_10535492 3300013307 Unclassified 1365
371 Ga0157372_10807798 3300013307 Unclassified 1090
372 Ga0157375_10083126 3300013308 Bacteria 3246
373 Ga0157375_10093688 3300013308 Bacteria 3070
374 Ga0157375_10159572 3300013308 Bacteria 2396
375 Ga0157375_10275280 3300013308 Bacteria 1845
376 Ga0157375_10836254 3300013308 Unclassified 1068
377 Ga0163163_10003369 3300014325 Bacteria 13562
378 Ga0163163_10014072 3300014325 Bacteria 7345
379 Ga0163163_11875630 3300014325 Unclassified 659
380 Ga0163163_11922617 3300014325 Bacteria 652
381 Ga0157380_10038023 3300014326 Bacteria 3734
382 Ga0157380_10044992 3300014326 Bacteria 3462
383 Ga0157380_10196388 3300014326 Bacteria 1786
384 Ga0157380_10518070 3300014326 Unclassified 1162
385 Ga0157380_10730126 3300014326 Bacteria 999
386 Ga0157380_12309318 3300014326 Unclassified 602
387 Ga0157377_10001757 3300014745 Bacteria 9443
388 Ga0157377_10036113 3300014745 Bacteria 2716
389 Ga0157377_10264719 3300014745 Bacteria 1120
390 Ga0157379_10042788 3300014968 Bacteria 4045
391 Ga0157379_10062050 3300014968 Bacteria 3343
392 Ga0182005_1020583 3300015265 Bacteria 1814
393 Ga0163161_10016221 3300017792 Bacteria 5199
394 Ga0163161_10017904 3300017792 Bacteria 4964
395 Ga0213876_10248286 3300021384 Unclassified 946
396 Ga0207697_10001122 3300025315 Bacteria 14748
397 Ga0207697_10002877 3300025315 Bacteria 8719
398 Ga0207656_10026351 3300025321 Bacteria 2369
399 Ga0207656_10069813 3300025321 Bacteria 1559
400 Ga0207656_10105257 3300025321 Bacteria 1298
401 Ga0207656_10153868 3300025321 Bacteria 1091
402 Ga0207656_10410708 3300025321 Bacteria 681
403 Ga0207682_10031031 3300025893 Bacteria 2144
404 Ga0207682_10581331 3300025893 Bacteria 529
405 Ga0207642_10009240 3300025899 Bacteria 3422
406 Ga0207688_10305129 3300025901 Bacteria 974
407 Ga0207688_10593058 3300025901 Bacteria 698
408 Ga0207680_10056199 3300025903 Bacteria 2376
409 Ga0207680_10068176 3300025903 Bacteria 2194
410 Ga0207680_10930039 3300025903 Bacteria 623
411 Ga0207647_10028040 3300025904 Bacteria 3664
412 Ga0207647_10361046 3300025904 Bacteria 822
413 Ga0207645_10000096 3300025907 Bacteria 64474
414 Ga0207645_10000369 3300025907 Bacteria 37388
415 Ga0207645_10303841 3300025907 Unclassified 1063
416 Ga0207645_10674682 3300025907 Bacteria 702
417 Ga0207643_10007193 3300025908 Bacteria 5975
418 Ga0207643_10357913 3300025908 Archaea 917
419 Ga0207707_10016133 3300025912 Bacteria 6514
420 Ga0207707_10213370 3300025912 Bacteria 1681
421 Ga0207707_10259224 3300025912 Bacteria 1509
422 Ga0207707_10402599 3300025912 Bacteria 1175
423 Ga0207695_10997164 3300025913 Bacteria 717
424 Ga0207671_10236144 3300025914 Unclassified 1435
425 Ga0207693_10213997 3300025915 Bacteria 1514
426 Ga0207693_10232712 3300025915 Bacteria 1447
427 Ga0207663_10025080 3300025916 Bacteria 3441
428 Ga0207663_10348280 3300025916 Bacteria 1121
429 Ga0207660_10024641 3300025917 Bacteria 4075
430 Ga0207660_10686596 3300025917 Bacteria 835
431 Ga0207662_10006126 3300025918 Bacteria 6469
432 Ga0207662_10012455 3300025918 Bacteria 4737
433 Ga0207662_10549743 3300025918 Bacteria 799
434 Ga0207657_10067798 3300025919 Bacteria 3033
435 Ga0207657_10187722 3300025919 Unclassified 1669
436 Ga0207657_10571683 3300025919 Bacteria 883
437 Ga0207657_10712537 3300025919 Bacteria 779
438 Ga0207649_10004772 3300025920 Bacteria 7331
439 Ga0207649_10006212 3300025920 Bacteria 6487
440 Ga0207649_10011921 3300025920 Bacteria 4808
441 Ga0207649_10015436 3300025920 Bacteria 4291
442 Ga0207649_10652704 3300025920 Archaea 813
443 Ga0207649_10773094 3300025920 Bacteria 748
444 Ga0207649_11294860 3300025920 Bacteria 576
445 Ga0207652_10013005 3300025921 Bacteria 6736
446 Ga0207652_10050297 3300025921 Bacteria 3570
447 Ga0207652_10196754 3300025921 Bacteria 1814
448 Ga0207652_11160819 3300025921 Bacteria 674
449 Ga0207681_10008245 3300025923 Bacteria 6371
450 Ga0207681_10088589 3300025923 Bacteria 2204
451 Ga0207681_10127003 3300025923 Bacteria 1879
452 Ga0207681_10645450 3300025923 Bacteria 877
453 Ga0207650_10002665 3300025925 Bacteria 12351
454 Ga0207650_10095986 3300025925 Bacteria 2273
455 Ga0207650_10163357 3300025925 Bacteria 1766
456 Ga0207650_10464755 3300025925 Archaea 1054
457 Ga0207650_10656382 3300025925 Bacteria 884
458 Ga0207650_10864796 3300025925 Bacteria 767
459 Ga0207659_10029453 3300025926 Bacteria 3742
460 Ga0207659_10069621 3300025926 Bacteria 2563
461 Ga0207659_10071961 3300025926 Bacteria 2526
462 Ga0207659_10497440 3300025926 Bacteria 1032
463 Ga0207659_10508696 3300025926 Unclassified 1020
464 Ga0207659_10718310 3300025926 Bacteria 856
465 Ga0207687_10019536 3300025927 Bacteria 4490
466 Ga0207644_10090822 3300025931 Bacteria 2276
467 Ga0207644_11456432 3300025931 Bacteria 575
468 Ga0207690_10013769 3300025932 Bacteria 4869
469 Ga0207690_10105672 3300025932 Bacteria 2019
470 Ga0207690_10137194 3300025932 Bacteria 1797
471 Ga0207690_10200003 3300025932 Unclassified 1517
472 Ga0207690_10744665 3300025932 Bacteria 807
473 Ga0207706_10000182 3300025933 Bacteria 70053
474 Ga0207706_10000294 3300025933 Bacteria 54206
475 Ga0207706_10024413 3300025933 Bacteria 5419
476 Ga0207706_10085473 3300025933 Bacteria 2774
477 Ga0207706_10108340 3300025933 Bacteria 2445
478 Ga0207686_10025870 3300025934 Bacteria 3420
479 Ga0207686_10102500 3300025934 Bacteria 1913
480 Ga0207686_10615511 3300025934 Unclassified 856
481 Ga0207686_10803982 3300025934 Bacteria 754
482 Ga0207709_10169451 3300025935 Bacteria 1531
483 Ga0207670_10024484 3300025936 Bacteria 3773
484 Ga0207669_10054219 3300025937 Bacteria 2421
485 Ga0207669_10128552 3300025937 Bacteria 1736
486 Ga0207669_10297774 3300025937 Bacteria 1224
487 Ga0207669_11372174 3300025937 Bacteria 601
488 Ga0207704_10035925 3300025938 Bacteria 2845
489 Ga0207704_10064577 3300025938 Bacteria 2288
490 Ga0207704_10135188 3300025938 Bacteria 1715
491 Ga0207704_10206558 3300025938 Bacteria 1442
492 Ga0207704_10394530 3300025938 Unclassified 1090
493 Ga0207704_10659374 3300025938 Bacteria 863
494 Ga0207691_10001012 3300025940 Bacteria 27901
495 Ga0207691_10001459 3300025940 Bacteria 23565
496 Ga0207691_10003744 3300025940 Bacteria 14752
497 Ga0207691_10045464 3300025940 Bacteria 4036
498 Ga0207691_10600281 3300025940 Unclassified 932
499 Ga0207711_10357236 3300025941 Bacteria 1353
500 Ga0207711_10421075 3300025941 Bacteria 1242
501 Ga0207711_10569025 3300025941 Bacteria 1057
502 Ga0207711_10821304 3300025941 Unclassified 866
503 Ga0207711_10865689 3300025941 Bacteria 841
504 Ga0207689_10002453 3300025942 Bacteria 17280
505 Ga0207689_10013908 3300025942 Bacteria 6855
506 Ga0207689_10122252 3300025942 Bacteria 2141
507 Ga0207661_10016631 3300025944 Bacteria 5430
508 Ga0207661_10075424 3300025944 Bacteria 2767
509 Ga0207661_10086366 3300025944 Bacteria 2603
510 Ga0207661_10247694 3300025944 Bacteria 1583
511 Ga0207661_10262233 3300025944 Unclassified 1539
512 Ga0207661_10556437 3300025944 Bacteria 1051
513 Ga0207661_11016444 3300025944 Bacteria 763
514 Ga0207679_10000924 3300025945 Bacteria 18745
515 Ga0207679_10002676 3300025945 Bacteria 11002
516 Ga0207679_10004677 3300025945 Bacteria 8527
517 Ga0207679_10007030 3300025945 Bacteria 7133
518 Ga0207679_10011133 3300025945 Bacteria 5809
519 Ga0207679_10014685 3300025945 Bacteria 5155
520 Ga0207679_10018492 3300025945 Bacteria 4669
521 Ga0207679_10041925 3300025945 Bacteria 3286
522 Ga0207679_10043189 3300025945 Bacteria 3245
523 Ga0207679_10164513 3300025945 Bacteria 1820
524 Ga0207679_10255428 3300025945 Unclassified 1492
525 Ga0207679_11681955 3300025945 Bacteria 581
526 Ga0207667_10043056 3300025949 Bacteria 4793
527 Ga0207667_10692362 3300025949 Bacteria 1022
528 Ga0207651_10027977 3300025960 Bacteria 3549
529 Ga0207651_10090022 3300025960 Bacteria 2242
530 Ga0207651_10185177 3300025960 Bacteria 1656
531 Ga0207651_10460492 3300025960 Unclassified 1093
532 Ga0207651_11004663 3300025960 Bacteria 745
533 Ga0207712_10001948 3300025961 Bacteria 13554
534 Ga0207712_10002543 3300025961 Bacteria 11725
535 Ga0207712_10004085 3300025961 Bacteria 9208
536 Ga0207712_10265113 3300025961 Unclassified 1395
537 Ga0207668_10003757 3300025972 Bacteria 8942
538 Ga0207668_10007307 3300025972 Bacteria 6562
539 Ga0207668_10108370 3300025972 Bacteria 2079
540 Ga0207668_10166017 3300025972 Bacteria 1726
541 Ga0207668_10461331 3300025972 Bacteria 1086
542 Ga0207640_10403979 3300025981 Bacteria 1113
543 Ga0207640_11523654 3300025981 Unclassified 601
544 Ga0207658_10018283 3300025986 Bacteria 4838
545 Ga0207658_10120975 3300025986 Bacteria 2087
546 Ga0207658_10242313 3300025986 Bacteria 1528
547 Ga0207658_10313158 3300025986 Bacteria 1356
548 Ga0207658_10870449 3300025986 Unclassified 820
549 Ga0207677_10007525 3300026023 Bacteria 6036
550 Ga0207677_11190608 3300026023 Bacteria 697
551 Ga0207677_11796507 3300026023 Unclassified 569
552 Ga0207703_10147157 3300026035 Unclassified 2050
553 Ga0207703_10835859 3300026035 Bacteria 880
554 Ga0207703_10890038 3300026035 Bacteria 852
555 Ga0207639_10050621 3300026041 Bacteria 3155
556 Ga0207639_10072801 3300026041 Bacteria 2692
557 Ga0207639_10111264 3300026041 Bacteria 2232
558 Ga0207678_10051859 3300026067 Bacteria 3540
559 Ga0207678_10086845 3300026067 Bacteria 2673
560 Ga0207708_10004165 3300026075 Bacteria 10634
561 Ga0207708_10023769 3300026075 Bacteria 4633
562 Ga0207708_10031201 3300026075 Bacteria 4044
563 Ga0207702_10468368 3300026078 Bacteria 1225
564 Ga0207702_10956410 3300026078 Bacteria 849
565 Ga0207702_11524468 3300026078 Unclassified 662
566 Ga0207641_10165629 3300026088 Bacteria 2013
567 Ga0207641_10212747 3300026088 Bacteria 1789
568 Ga0207641_10642704 3300026088 Bacteria 1041
569 Ga0207641_10786918 3300026088 Bacteria 940
570 Ga0207648_10006890 3300026089 Bacteria 11262
571 Ga0207648_10100270 3300026089 Bacteria 2537
572 Ga0207648_10107834 3300026089 Bacteria 2444
573 Ga0207648_10148876 3300026089 Bacteria 2065
574 Ga0207648_10172535 3300026089 Bacteria 1912
575 Ga0207648_10389982 3300026089 Bacteria 1260
576 Ga0207648_11706970 3300026089 Unclassified 591
577 Ga0207676_10040778 3300026095 Bacteria 3560
578 Ga0207676_10049493 3300026095 Bacteria 3270
579 Ga0207676_10087669 3300026095 Bacteria 2546
580 Ga0207676_10749389 3300026095 Bacteria 950
581 Ga0207676_10814367 3300026095 Bacteria 912
582 Ga0207676_10919257 3300026095 Bacteria 859
583 Ga0207674_10000678 3300026116 Bacteria 44204
584 Ga0207674_10001382 3300026116 Bacteria 31330
585 Ga0207674_10001495 3300026116 Bacteria 30163
586 Ga0207674_10013171 3300026116 Bacteria 9201
587 Ga0207674_10929746 3300026116 Unclassified 838
588 Ga0207674_11363799 3300026116 Unclassified 678
589 Ga0207675_100000503 3300026118 Bacteria 37948
590 Ga0207675_100000535 3300026118 Bacteria 36989
591 Ga0207675_100036944 3300026118 Bacteria 4557
592 Ga0207683_10265097 3300026121 Unclassified 1569
593 Ga0207683_10284458 3300026121 Bacteria 1511
594 Ga0207683_10706050 3300026121 Bacteria 935
595 Ga0207698_10047638 3300026142 Bacteria 3249
596 Ga0207698_10112509 3300026142 Bacteria 2285
597 Ga0207698_10197200 3300026142 Bacteria 1800
598 Ga0207698_10241005 3300026142 Bacteria 1648
599 Ga0207698_11919919 3300026142 Unclassified 607
600 Ga0207428_10126975 3300027907 Bacteria 1953
601 Ga0207428_10154899 3300027907 Bacteria 1743
602 Ga0207428_10165174 3300027907 Bacteria 1679
603 Ga0207428_10649746 3300027907 Bacteria 757
604 Ga0207428_10888652 3300027907 Unclassified 630
605 Ga0268266_10182385 3300028379 Bacteria 1912
606 Ga0268266_10588252 3300028379 Bacteria 1068
607 Ga0268266_10856232 3300028379 Bacteria 879
608 Ga0268265_10020718 3300028380 Bacteria 4594
609 Ga0268265_10080256 3300028380 Bacteria 2572
610 Ga0268265_10196622 3300028380 Bacteria 1745
611 Ga0268265_10488898 3300028380 Bacteria 1157
612 Ga0268265_10751568 3300028380 Bacteria 946
613 Ga0268264_10184110 3300028381 Bacteria 1899
614 Ga0268264_10193304 3300028381 Bacteria 1856
615 Ga0268264_10378338 3300028381 Bacteria 1355
616 Ga0265332_10007280 3300031238 Bacteria 5006
617 Ga0307408_100001491 3300031548 Bacteria 17368
618 Ga0307408_100002267 3300031548 Bacteria 13704
619 Ga0307408_100029592 3300031548 Bacteria 3796
620 Ga0307408_100074913 3300031548 Bacteria 2513
621 Ga0307408_101299176 3300031548 Bacteria 682
622 Ga0307408_101528586 3300031548 Bacteria 632
623 Ga0265314_10028272 3300031711 Bacteria 4182
624 Ga0307405_10025382 3300031731 Bacteria 3401
625 Ga0307405_10028042 3300031731 Bacteria 3275
626 Ga0307405_10362010 3300031731 Bacteria 1123
627 Ga0307405_10605289 3300031731 Bacteria 895
628 Ga0307405_11721266 3300031731 Bacteria 556
629 Ga0316577_10014030 3300031733 Bacteria 4395
630 Ga0307413_10033547 3300031824 Bacteria 2924
631 Ga0307413_10990297 3300031824 Bacteria 720
632 Ga0307410_10013655 3300031852 Bacteria 4747
633 Ga0307410_10029135 3300031852 Bacteria 3511
634 Ga0307410_10046987 3300031852 Bacteria 2883
635 Ga0307410_10954666 3300031852 Unclassified 737
636 Ga0307410_11881388 3300031852 Unclassified 532
637 Ga0307406_10000320 3300031901 Bacteria 27945
638 Ga0307406_10005591 3300031901 Bacteria 6873
639 Ga0307406_10010920 3300031901 Bacteria 5136
640 Ga0307406_10358730 3300031901 Bacteria 1142
641 Ga0307406_11214672 3300031901 Bacteria 655
642 Ga0307406_11217844 3300031901 Bacteria 654
643 Ga0307406_12077437 3300031901 Unclassified 509
644 Ga0307407_10001122 3300031903 Bacteria 9373
645 Ga0307407_10044356 3300031903 Bacteria 2505
646 Ga0307407_10099580 3300031903 Unclassified 1801
647 Ga0307407_10600757 3300031903 Bacteria 819
648 Ga0307412_10018176 3300031911 Bacteria 4224
649 Ga0307412_10059752 3300031911 Bacteria 2556
650 Ga0307412_10466465 3300031911 Unclassified 1044
651 Ga0307412_11588060 3300031911 Bacteria 597
652 Ga0307412_11662526 3300031911 Bacteria 584
653 Ga0307409_100002084 3300031995 Bacteria 10278
654 Ga0307409_100042426 3300031995 Bacteria 3407
655 Ga0307409_100523489 3300031995 Unclassified 1159
656 Ga0307409_100587787 3300031995 Bacteria 1098
657 Ga0307409_100632876 3300031995 Bacteria 1061
658 Ga0307416_100010627 3300032002 Bacteria 6093
659 Ga0307416_100062225 3300032002 Bacteria 3050
660 Ga0307416_100245644 3300032002 Bacteria 1738
661 Ga0307416_100265809 3300032002 Bacteria 1680
662 Ga0307416_100788180 3300032002 Bacteria 1045
663 Ga0307416_100961004 3300032002 Bacteria 956
664 Ga0307416_101016976 3300032002 Unclassified 932
665 Ga0307416_103391353 3300032002 Bacteria 533
666 Ga0307416_103502559 3300032002 Unclassified 525
667 Ga0307416_103665748 3300032002 Bacteria 514
668 Ga0307414_10199104 3300032004 Bacteria 1627
669 Ga0307414_10577407 3300032004 Bacteria 1005
670 Ga0307414_10782748 3300032004 Bacteria 869
671 Ga0307414_12092506 3300032004 Bacteria 528
672 Ga0307411_10001535 3300032005 Bacteria 9526
673 Ga0307411_10329761 3300032005 Unclassified 1236
674 Ga0307411_10629777 3300032005 Unclassified 926
675 Ga0307411_10741577 3300032005 Bacteria 859
676 Ga0307411_10942923 3300032005 Unclassified 769
677 Ga0307411_10999209 3300032005 Unclassified 749
678 Ga0307411_11174664 3300032005 Unclassified 695
679 Ga0307415_100011392 3300032126 Bacteria 5086
680 Ga0307415_100148524 3300032126 Bacteria 1800
681 Ga0307415_100568397 3300032126 Bacteria 1004
682 Ga0307415_100700905 3300032126 Bacteria 914
683 Ga0307415_100784946 3300032126 Bacteria 868
684 Ga0307415_101702339 3300032126 Bacteria 608
685 Ga0316583_10295412 3300032133 Unclassified 560
686 Ga0373934_0006842 3300035086 Bacteria 4234
687 Ga0373940_0367250 3300035088 Unclassified 508
688 Ga0373953_0202200 3300035117 Bacteria 859
689 Ga0373956_0055367 3300035119 Bacteria 1789
690 Ga0373957_0063335 3300035120 Bacteria 1436
691 Ga0373955_0015970 3300035172 Bacteria 3687
692 Ga0373961_0060629 3300035241 Bacteria 1147
693 Ga0316574_0396713 3300035398 Bacteria 869
694 Ga0373931_0397865 3300035691 Bacteria 872
695 Ga0373933_0024480 3300035724 Bacteria 3456
696 Ga0373933_1195366 3300035724 Bacteria 501
697 Ga0373937_0021289 3300036401 Bacteria 5819
698 Ga0373925_0435016 3300037068 Bacteria 1073
699 Ga0436365_0511229 3300039437 Bacteria 1264
700 Ga0436365_0723372 3300039437 Bacteria 513
701 Ga0436365_1317039 3300039437 Bacteria 1946
702 Ga0451789_0780576 3300041443 Bacteria 596
703 Ga0451789_1040236 3300041443 Bacteria 981
704 Ga0451807_0123902 3300041486 Unclassified 1428
705 Ga0451807_1356045 3300041486 Bacteria 1124
706 Ga0451843_0463463 3300041509 Bacteria 605
707 Ga0451853_1854011 3300041512 Bacteria 1759
708 Ga0439448_0104569 3300042005 Bacteria 964
709 Ga0439450_197188 3300042008 Unclassified 538
710 Ga0439455_0009364 3300042012 Bacteria 2124
711 Ga0439440_0058378 3300042993 Bacteria 980
712 Ga0466965_0150565 3300044683 Unclassified 1216
713 Ga0466963_0067465 3300044694 Bacteria 2401
714 Ga0466968_0680694 3300044735 Unclassified 524
715 Ga0451576_0133040 3300045051 Bacteria 2592
716 Ga0451576_0208075 3300045051 Bacteria 2043
717 Ga0466967_0790083 3300045976 Bacteria 942
718 Ga0495592_0653945 3300046454 Unclassified 636
719 Ga0495629_0329637 3300046459 Bacteria 1043
720 Ga0495629_0837291 3300046459 Bacteria 606
721 Ga0495651_0030288 3300046462 Bacteria 4220
722 Ga0495651_0254131 3300046462 Bacteria 1199
723 Ga0495653_0035044 3300046463 Bacteria 3963
724 Ga0495664_0097981 3300046477 Bacteria 1765
725 Ga0495628_0021344 3300046516 Bacteria 5330
726 Ga0495652_0048443 3300046529 Bacteria 3641
727 Ga0495665_0179270 3300046531 Bacteria 1101
728 Ga0495665_0357714 3300046531 Bacteria 743
729 Ga0495665_0490326 3300046531 Bacteria 619
730 Ga0495587_0018335 3300046536 Bacteria 4341
731 Ga0495645_0002088 3300046543 Bacteria 13568
732 Ga0495645_0075075 3300046543 Bacteria 2433
733 Ga0495667_0124452 3300046559 Bacteria 1664
734 Ga0495635_0180189 3300046663 Bacteria 1436
735 Ga0495588_0754549 3300046674 Bacteria 509
736 Ga0495657_0350850 3300046675 Bacteria 873
737 Ga0495599_0006599 3300046678 Bacteria 7002
738 Ga0495623_0010092 3300046679 Bacteria 6112
739 Ga0495646_0607026 3300046680 Unclassified 555
740 Ga0495658_0308277 3300046683 Bacteria 1002
741 Ga0495613_0451442 3300046689 Unclassified 871
742 Ga0495600_0276015 3300046809 Bacteria 1065
743 Ga0495600_0525195 3300046809 Bacteria 725
744 Ga0495581_0359650 3300047315 Bacteria 850
745 Ga0495604_0027293 3300047317 Bacteria 4542
746 Ga0495674_0456706 3300047319 Bacteria 1026
747 Ga0495672_0003234 3300047320 Bacteria 14154
748 Ga0495680_0690046 3300047322 Bacteria 675
749 Ga0495675_0011938 3300047444 Bacteria 5459
750 Ga0495684_0027923 3300047471 Bacteria 4334
751 Ga0495602_0023674 3300048088 Bacteria 5978
752 Ga0496107_0680936 3300048910 Bacteria 757
753 Ga0496108_0260263 3300048911 Bacteria 1510
754 Ga0496109_0033603 3300048912 Bacteria 4615
755 Ga0496109_0942303 3300048912 Bacteria 801
756 Ga0496112_0156876 3300048915 Bacteria 2243
757 Ga0496112_0225344 3300048915 Bacteria 1830
758 Ga0496113_0995392 3300048916 Bacteria 660
759 Ga0496114_0622760 3300048917 Bacteria 951
760 Ga0501293_019551 3300049516 Bacteria 654
761 Ga0501299_014174 3300049522 Bacteria 1383
762 Ga0501033_0492034 3300049570 Unclassified 849
763 Ga0501034_0545993 3300049571 Bacteria 1069
764 Ga0501040_0053786 3300049576 Bacteria 2759
765 Ga0501070_0172029 3300049586 Bacteria 1784
766 Ga0501072_0177280 3300049588 Bacteria 1700
767 Ga0501209_136838 3300049656 Unclassified 733
768 Ga0501209_202000 3300049656 Bacteria 612
769 Ga0501216_171811 3300049660 Bacteria 525
770 Ga0501217_112813 3300049661 Unclassified 783
771 Ga0501217_157981 3300049661 Bacteria 682
772 Ga0501217_280476 3300049661 Unclassified 545
773 Ga0501224_036404 3300049664 Bacteria 740
774 Ga0501227_109925 3300049665 Unclassified 738
775 Ga0501239_020262 3300049672 Unclassified 811
776 Ga0501249_064142 3300049679 Bacteria 853
777 Ga0501249_115220 3300049679 Bacteria 652
778 Ga0501249_212449 3300049679 Bacteria 512
779 Ga0501253_039871 3300049683 Bacteria 941
780 Ga0501259_077772 3300049688 Bacteria 723
781 Ga0501259_163090 3300049688 Bacteria 558
782 Ga0501225_0091337 3300049705 Bacteria 882
783 Ga0501225_0207100 3300049705 Unclassified 625
784 Ga0501234_031615 3300049707 Unclassified 856
785 Ga0501263_046188 3300049760 Bacteria 652
786 Ga0501267_014565 3300049764 Bacteria 826
787 Ga0501270_124989 3300049767 Unclassified 563
788 Ga0501270_127444 3300049767 Unclassified 560
789 Ga0501274_021062 3300049771 Bacteria 678
790 Ga0501035_0783216 3300049822 Bacteria 763
791 Ga0501044_0880454 3300049823 Unclassified 771
792 nmdc:mga05p37_1094301_c1 3300050507 Unclassified 835
793 nmdc:mga05p37_206624_c1 3300050507 Bacteria 2375
794 nmdc:mga05p37_28658_c1 3300050507 Bacteria 6792
795 nmdc:mga05p37_564185_c1 3300050507 Bacteria 1293
796 nmdc:mga09592_296110_c1 3300050508 Bacteria 1403
797 nmdc:mga09592_43274_c1 3300050508 Bacteria 3790
798 nmdc:mga09592_43548_c1 3300050508 Bacteria 3777
799 nmdc:mga09592_537086_c1 3300050508 Bacteria 1005
800 nmdc:mga09592_739055_c1 3300050508 Bacteria 835
801 nmdc:mga0qj67_1375033_c1 3300050509 Bacteria 545
802 nmdc:mga0qj67_1490860_c1 3300050509 Unclassified 520
803 nmdc:mga0qj67_229841_c1 3300050509 Bacteria 1505
804 nmdc:mga0qj67_33383_c1 3300050509 Bacteria 4016
805 nmdc:mga0qj67_342075_c1 3300050509 Bacteria 1210
806 nmdc:mga0qj67_3812_c1 3300050509 Bacteria 10891
807 nmdc:mga0qj67_40350_c1 3300050509 Bacteria 3669
808 nmdc:mga0qj67_43781_c1 3300050509 Bacteria 3526
809 nmdc:mga06r32_103951_c1 3300050510 Bacteria 2789
810 nmdc:mga06r32_139390_c1 3300050510 Bacteria 2401
811 nmdc:mga06r32_323874_c1 3300050510 Bacteria 1526
812 nmdc:mga06r32_44040_c1 3300050510 Bacteria 4248
813 nmdc:mga06r32_679465_c1 3300050510 Unclassified 996
814 nmdc:mga06r32_756267_c1 3300050510 Bacteria 935
815 nmdc:mga06r32_820683_c1 3300050510 Bacteria 890
816 nmdc:mga08y16_1379255_c1 3300050511 Unclassified 669
817 nmdc:mga08y16_14949_c1 3300050511 Bacteria 8163
818 nmdc:mga08y16_1499639_c1 3300050511 Bacteria 635
819 nmdc:mga08y16_259683_c1 3300050511 Bacteria 1794
820 nmdc:mga08y16_476807_c1 3300050511 Bacteria 1270
821 nmdc:mga08y16_61903_c1 3300050511 Bacteria 3908
822 nmdc:mga08y16_99901_c1 3300050511 Bacteria 3021
823 nmdc:mga0n895_3580_c1 3300050512 Bacteria 12553
824 nmdc:mga0n895_37263_c1 3300050512 Bacteria 4703
825 nmdc:mga0n895_4241_c1 3300050512 Bacteria 11724
826 nmdc:mga0rr50_950168_c1 3300050513 Bacteria 733
827 nmdc:mga0a205_37285_c1 3300050515 Bacteria 4674
828 nmdc:mga0a205_47632_c1 3300050515 Bacteria 4137
829 nmdc:mga0a205_48243_c1 3300050515 Bacteria 4110
830 nmdc:mga0a205_879922_c1 3300050515 Bacteria 743
831 Ga0495612_0106106 3300053078 Bacteria 1199
832 Ga0495595_0027449 3300053084 Unclassified 2537
833 Ga0495619_0204462 3300053085 Bacteria 1367
834 Ga0500641_0278523 3300053096 Bacteria 694
835 Ga0590071_027639 3300059421 Bacteria 1347
836 Ga0590075_022552 3300059424 Unclassified 1576
837 Ga0590077_035243 3300059426 Bacteria 1102
838 Ga0501082_0915460 3300060353 Bacteria 767
839 Ga0373951_0249341
840 JGI24750J21931_1044345
841 JGI24738J21930_10147362
842 Ga0065704_10170423
843 Ga0065712_10226648
844 Ga0065712_10435187
845 Ga0065715_10397249
846 Ga0065707_10089614
847 Ga0065707_10226310
848 Ga0065707_10448822
849 Ga0070658_10219079
850 Ga0070676_10000961
851 Ga0070676_10060071
852 Ga0070676_10104009
853 Ga0070676_10785145
854 Ga0070676_10908980
855 Ga0070683_100006724
856 Ga0070683_100010564
857 Ga0070683_100017372
858 Ga0070683_100107775
859 Ga0070683_100132329
860 Ga0070683_100136014
861 Ga0070683_100482676
862 Ga0070683_101453131
863 Ga0070690_100010030
864 Ga0070690_100046934
865 Ga0070690_100167819
866 Ga0070670_100004272
867 Ga0070670_100014959
868 Ga0070670_100017626
869 Ga0070670_100090828
870 Ga0070670_100099760
871 Ga0070670_100146746
872 Ga0070670_100717404
873 Ga0070670_101521521
874 Ga0070677_10018579
875 Ga0070677_10890432
876 Ga0068869_100001352
877 Ga0068869_100004561
878 Ga0068869_100565252
879 Ga0068869_101122298
880 Ga0070666_10221029
881 Ga0070666_10239585
882 Ga0070680_100018166
883 Ga0070680_100027439
884 Ga0070682_100064588
885 Ga0070682_100070392
886 Ga0070682_100103758
887 Ga0068868_100009552
888 Ga0068868_100039678
889 Ga0068868_100817083
890 Ga0070660_100188696
891 Ga0070660_100402491
892 Ga0070660_100697589
893 Ga0070660_100981430
894 Ga0070689_100007571
895 Ga0070689_100027544
896 Ga0070689_100118892
897 Ga0070689_100269017
898 Ga0070687_100012616
899 Ga0070687_100082251
900 Ga0070661_100001181
901 Ga0070661_100015432
902 Ga0070661_100054102
903 Ga0070661_100081768
904 Ga0070661_100490294
905 Ga0070661_101236245
906 Ga0070692_10004281
907 Ga0070692_10009184
908 Ga0070692_10801765
909 Ga0070668_100001373
910 Ga0070668_100020945
911 Ga0070668_100025751
912 Ga0070669_100023989
913 Ga0070669_100055298
914 Ga0070669_100496728
915 Ga0070669_100582693
916 Ga0070675_100004932
917 Ga0070675_100027068
918 Ga0070675_100042312
919 Ga0070675_100048791
920 Ga0070675_100094235
921 Ga0070675_100400548
922 Ga0070675_101450867
923 Ga0070671_100186610
924 Ga0070671_100215064
925 Ga0070671_100401779
926 Ga0070674_100093448
927 Ga0070674_100138703
928 Ga0070674_100663504
929 Ga0070674_101624080
930 Ga0070674_102001899
931 Ga0070673_100084798
932 Ga0070673_100115853
933 Ga0070673_100190603
934 Ga0070673_100320599
935 Ga0070673_100904251
936 Ga0070673_100924310
937 Ga0070688_100032102
938 Ga0070688_100054175
939 Ga0070688_100083614
940 Ga0070688_100086504
941 Ga0070659_100001392
942 Ga0070659_100026417
943 Ga0070659_100043659
944 Ga0070659_100066568
945 Ga0070659_100125588
946 Ga0070659_100341191
947 Ga0070659_100855872
948 Ga0070667_100028433
949 Ga0070667_100070794
950 Ga0070667_100089522
951 Ga0070667_100255390
952 Ga0070667_100927048
953 Ga0070667_101103569
954 Ga0070703_10193194
955 Ga0070709_10850331
956 Ga0070714_100576593
957 Ga0070701_10001896
958 Ga0070701_10002221
959 Ga0070701_10547778
960 Ga0070711_100082081
961 Ga0070711_100436021
962 Ga0070705_101179567
963 Ga0070700_100026206
964 Ga0070700_100101185
965 Ga0070700_100416047
966 Ga0070694_100008690
967 Ga0070694_100359764
968 Ga0070708_100327241
969 Ga0070663_100008954
970 Ga0070663_100619539
971 Ga0070678_100085428
972 Ga0070678_100688900
973 Ga0070678_101605363
974 Ga0070662_100001809
975 Ga0070662_100004300
976 Ga0070662_100038589
977 Ga0070662_100067164
978 Ga0070662_100279927
979 Ga0070681_10000205
980 Ga0070681_10005352
981 Ga0070681_10054229
982 Ga0070681_10074491
983 Ga0068867_100045755
984 Ga0068867_100052148
985 Ga0068867_100057900
986 Ga0068867_100240277
987 Ga0068867_101870679
988 Ga0070685_10154109
989 Ga0070685_10766648
990 Ga0070685_11002145
991 Ga0070707_100422766
992 Ga0070698_100001612
993 Ga0070698_100225835
994 Ga0070699_100003321
995 Ga0070699_101310390
996 Ga0070679_100014126
997 Ga0070679_100041785
998 Ga0070679_100869196
999 Ga0070679_101373936
1000 Ga0070684_100006226
1001 Ga0070684_100009915
1002 Ga0070684_100012830
1003 Ga0070684_100014258
1004 Ga0070684_100127226
1005 Ga0070684_100203440
1006 Ga0070684_100214608
1007 Ga0070684_100383004
1008 Ga0070684_100766758
1009 Ga0070684_100791601
1010 Ga0068853_100029031
1011 Ga0068853_100087582
1012 Ga0068853_100526569
1013 Ga0068853_100653100
1014 Ga0070672_100014766
1015 Ga0070672_100031155
1016 Ga0070672_100034535
1017 Ga0070672_100042037
1018 Ga0070672_100060295
1019 Ga0070672_101162574
1020 Ga0070686_100144410
1021 Ga0070686_100158851
1022 Ga0070695_100553749
1023 Ga0070695_101172202
1024 Ga0070696_100000259
1025 Ga0070696_100085478
1026 Ga0070693_101196689
1027 Ga0070665_100183031
1028 Ga0070665_100275127
1029 Ga0070665_100300582
1030 Ga0070665_101486569
1031 Ga0070665_102213911
1032 Ga0070704_100493234
1033 Ga0070704_102155241
1034 Ga0068855_100011773
1035 Ga0068855_100036114
1036 Ga0070664_100002437
1037 Ga0070664_100006032
1038 Ga0070664_100007254
1039 Ga0070664_100014143
1040 Ga0070664_100018487
1041 Ga0070664_100019542
1042 Ga0070664_100026440
1043 Ga0070664_100074334
1044 Ga0070664_100227452
1045 Ga0070664_100355186
1046 Ga0070664_100579112
1047 Ga0068857_100000581
1048 Ga0068857_100008229
1049 Ga0068857_100015424
1050 Ga0068857_100059511
1051 Ga0068857_100060072
1052 Ga0068857_100803776
1053 Ga0068857_101935463
1054 Ga0068854_100143492
1055 Ga0068854_101237082
1056 Ga0070702_100191714
1057 Ga0068852_100001386
1058 Ga0068852_100067936
1059 Ga0068852_100191536
1060 Ga0068852_100354885
1061 Ga0068852_102010228
1062 Ga0068859_100167465
1063 Ga0068859_100424801
1064 Ga0068859_101595836
1065 Ga0068859_102137461
1066 Ga0068864_100289082
1067 Ga0068864_100455060
1068 Ga0068864_100695387
1069 Ga0068864_100762035
1070 Ga0068864_101103012
1071 Ga0068864_101409828
1072 Ga0068866_10095997
1073 Ga0068861_100000287
1074 Ga0068861_100011688
1075 Ga0068861_100055907
1076 Ga0068851_10029729
1077 Ga0068851_10047760
1078 Ga0068851_10050786
1079 Ga0068870_10124059
1080 Ga0068870_10172336
1081 Ga0068863_100021081
1082 Ga0068863_100074294
1083 Ga0068863_101051723
1084 Ga0068858_100280179
1085 Ga0068858_100700612
1086 Ga0068860_100370928
1087 Ga0068860_100412277
1088 Ga0068860_100512699
1089 Ga0068860_100802185
1090 Ga0068862_100003813
1091 Ga0068862_100020010
1092 Ga0068862_100033498
1093 Ga0068862_100247678
1094 Ga0068862_100459889
1095 Ga0068862_101103098
1096 Ga0081539_10000107
1097 Ga0070712_100036883
1098 Ga0070712_100277667
1099 Ga0097621_100241602
1100 Ga0068871_100683570
1101 Ga0068871_101053833
1102 Ga0068871_101125573
1103 Ga0075428_100009561
1104 Ga0075428_100032981
1105 Ga0075428_100082297
1106 Ga0075428_100218637
1107 Ga0075428_101190085
1108 Ga0075430_100004278
1109 Ga0075430_100013038
1110 Ga0075430_100029215
1111 Ga0075430_100071214
1112 Ga0075430_100134289
1113 Ga0075430_100248518
1114 Ga0075430_100835493
1115 Ga0075430_101652659
1116 Ga0075431_100015380
1117 Ga0075431_100051632
1118 Ga0075431_100082189
1119 Ga0075431_100100477
1120 Ga0075431_100188101
1121 Ga0075431_100260693
1122 Ga0075431_100694152
1123 Ga0075433_10030408
1124 Ga0075433_10088425
1125 Ga0075434_100000988
1126 Ga0075434_100013039
1127 Ga0075434_100375193
1128 Ga0075434_101242100
1129 Ga0075429_100025558
1130 Ga0075429_100066751
1131 Ga0075429_100561226
1132 Ga0068865_100010062
1133 Ga0068865_100114445
1134 Ga0068865_100244376
1135 Ga0068865_101022491
1136 Ga0097620_100167467
1137 Ga0097620_100424786
1138 Ga0097620_102137193
1139 Ga0075435_100100681
1140 Ga0075435_101070024
1141 Ga0105240_12084134
1142 Ga0105240_12282054
1143 Ga0111539_10057138
1144 Ga0111539_10064443
1145 Ga0111539_10072444
1146 Ga0111539_10490748
1147 Ga0111539_10528343
1148 Ga0111539_11303882
1149 Ga0105245_10024740
1150 Ga0105245_11036755
1151 Ga0114129_10005906
1152 Ga0114129_10279029
1153 Ga0105243_10028077
1154 Ga0105243_10447984
1155 Ga0105243_10594025
1156 Ga0105241_10039884
1157 Ga0105241_10994366
1158 Ga0105242_10060876
1159 Ga0105242_10129143
1160 Ga0105242_10139040
1161 Ga0105242_10319864
1162 Ga0105242_10552633
1163 Ga0105242_11252364
1164 Ga0105242_12837764
1165 Ga0105248_10035475
1166 Ga0105248_10065111
1167 Ga0105248_10073865
1168 Ga0105248_10475888
1169 Ga0105248_10506281
1170 Ga0105248_11075693
1171 Ga0105237_10131699
1172 Ga0105237_10249783
1173 Ga0105249_10001386
1174 Ga0105249_10009897
1175 Ga0105249_10025570
1176 Ga0105249_10095820
1177 Ga0105239_10006810
1178 Ga0105239_10221250
1179 Ga0105239_13168323
1180 Ga0105246_11616037
1181 Ga0157314_1028014
1182 Ga0157313_1044861
1183 Ga0157373_10096727
1184 Ga0157373_10299815
1185 Ga0157373_10478670
1186 Ga0157371_10022158
1187 Ga0157371_10462434
1188 Ga0157370_10594267
1189 Ga0157369_10030564
1190 Ga0157369_10035575
1191 Ga0157369_10084474
1192 Ga0157369_11042361
1193 Ga0157374_10026096
1194 Ga0157374_10079996
1195 Ga0157374_10375416
1196 Ga0157374_10554632
1197 Ga0157378_10031506
1198 Ga0157378_10152181
1199 Ga0157378_10236998
1200 Ga0157378_10387802
1201 Ga0163162_10010957
1202 Ga0163162_10075043
1203 Ga0163162_10099652
1204 Ga0163162_10240490
1205 Ga0157372_10022971
1206 Ga0157372_10030155
1207 Ga0157372_10270199
1208 Ga0157372_10535492
1209 Ga0157372_10807798
1210 Ga0157375_10083126
1211 Ga0157375_10093688
1212 Ga0157375_10159572
1213 Ga0157375_10275280
1214 Ga0157375_10836254
1215 Ga0163163_10003369
1216 Ga0163163_10014072
1217 Ga0163163_11875630
1218 Ga0163163_11922617
1219 Ga0157380_10038023
1220 Ga0157380_10044992
1221 Ga0157380_10196388
1222 Ga0157380_10518070
1223 Ga0157380_10730126
1224 Ga0157380_12309318
1225 Ga0157377_10001757
1226 Ga0157377_10036113
1227 Ga0157377_10264719
1228 Ga0157379_10042788
1229 Ga0157379_10062050
1230 Ga0182005_1020583
1231 Ga0163161_10016221
1232 Ga0163161_10017904
1233 Ga0213876_10248286
1234 Ga0207697_10001122
1235 Ga0207697_10002877
1236 Ga0207656_10026351
1237 Ga0207656_10069813
1238 Ga0207656_10105257
1239 Ga0207656_10153868
1240 Ga0207656_10410708
1241 Ga0207682_10031031
1242 Ga0207682_10581331
1243 Ga0207642_10009240
1244 Ga0207688_10305129
1245 Ga0207688_10593058
1246 Ga0207680_10056199
1247 Ga0207680_10068176
1248 Ga0207680_10930039
1249 Ga0207647_10028040
1250 Ga0207647_10361046
1251 Ga0207645_10000096
1252 Ga0207645_10000369
1253 Ga0207645_10303841
1254 Ga0207645_10674682
1255 Ga0207643_10007193
1256 Ga0207643_10357913
1257 Ga0207707_10016133
1258 Ga0207707_10213370
1259 Ga0207707_10259224
1260 Ga0207707_10402599
1261 Ga0207695_10997164
1262 Ga0207671_10236144
1263 Ga0207693_10213997
1264 Ga0207693_10232712
1265 Ga0207663_10025080
1266 Ga0207663_10348280
1267 Ga0207660_10024641
1268 Ga0207660_10686596
1269 Ga0207662_10006126
1270 Ga0207662_10012455
1271 Ga0207662_10549743
1272 Ga0207657_10067798
1273 Ga0207657_10187722
1274 Ga0207657_10571683
1275 Ga0207657_10712537
1276 Ga0207649_10004772
1277 Ga0207649_10006212
1278 Ga0207649_10011921
1279 Ga0207649_10015436
1280 Ga0207649_10652704
1281 Ga0207649_10773094
1282 Ga0207649_11294860
1283 Ga0207652_10013005
1284 Ga0207652_10050297
1285 Ga0207652_10196754
1286 Ga0207652_11160819
1287 Ga0207681_10008245
1288 Ga0207681_10088589
1289 Ga0207681_10127003
1290 Ga0207681_10645450
1291 Ga0207650_10002665
1292 Ga0207650_10095986
1293 Ga0207650_10163357
1294 Ga0207650_10464755
1295 Ga0207650_10656382
1296 Ga0207650_10864796
1297 Ga0207659_10029453
1298 Ga0207659_10069621
1299 Ga0207659_10071961
1300 Ga0207659_10497440
1301 Ga0207659_10508696
1302 Ga0207659_10718310
1303 Ga0207687_10019536
1304 Ga0207644_10090822
1305 Ga0207644_11456432
1306 Ga0207690_10013769
1307 Ga0207690_10105672
1308 Ga0207690_10137194
1309 Ga0207690_10200003
1310 Ga0207690_10744665
1311 Ga0207706_10000182
1312 Ga0207706_10000294
1313 Ga0207706_10024413
1314 Ga0207706_10085473
1315 Ga0207706_10108340
1316 Ga0207686_10025870
1317 Ga0207686_10102500
1318 Ga0207686_10615511
1319 Ga0207686_10803982
1320 Ga0207709_10169451
1321 Ga0207670_10024484
1322 Ga0207669_10054219
1323 Ga0207669_10128552
1324 Ga0207669_10297774
1325 Ga0207669_11372174
1326 Ga0207704_10035925
1327 Ga0207704_10064577
1328 Ga0207704_10135188
1329 Ga0207704_10206558
1330 Ga0207704_10394530
1331 Ga0207704_10659374
1332 Ga0207691_10001012
1333 Ga0207691_10001459
1334 Ga0207691_10003744
1335 Ga0207691_10045464
1336 Ga0207691_10600281
1337 Ga0207711_10357236
1338 Ga0207711_10421075
1339 Ga0207711_10569025
1340 Ga0207711_10821304
1341 Ga0207711_10865689
1342 Ga0207689_10002453
1343 Ga0207689_10013908
1344 Ga0207689_10122252
1345 Ga0207661_10016631
1346 Ga0207661_10075424
1347 Ga0207661_10086366
1348 Ga0207661_10247694
1349 Ga0207661_10262233
1350 Ga0207661_10556437
1351 Ga0207661_11016444
1352 Ga0207679_10000924
1353 Ga0207679_10002676
1354 Ga0207679_10004677
1355 Ga0207679_10007030
1356 Ga0207679_10011133
1357 Ga0207679_10014685
1358 Ga0207679_10018492
1359 Ga0207679_10041925
1360 Ga0207679_10043189
1361 Ga0207679_10164513
1362 Ga0207679_10255428
1363 Ga0207679_11681955
1364 Ga0207667_10043056
1365 Ga0207667_10692362
1366 Ga0207651_10027977
1367 Ga0207651_10090022
1368 Ga0207651_10185177
1369 Ga0207651_10460492
1370 Ga0207651_11004663
1371 Ga0207712_10001948
1372 Ga0207712_10002543
1373 Ga0207712_10004085
1374 Ga0207712_10265113
1375 Ga0207668_10003757
1376 Ga0207668_10007307
1377 Ga0207668_10108370
1378 Ga0207668_10166017
1379 Ga0207668_10461331
1380 Ga0207640_10403979
1381 Ga0207640_11523654
1382 Ga0207658_10018283
1383 Ga0207658_10120975
1384 Ga0207658_10242313
1385 Ga0207658_10313158
1386 Ga0207658_10870449
1387 Ga0207677_10007525
1388 Ga0207677_11190608
1389 Ga0207677_11796507
1390 Ga0207703_10147157
1391 Ga0207703_10835859
1392 Ga0207703_10890038
1393 Ga0207639_10050621
1394 Ga0207639_10072801
1395 Ga0207639_10111264
1396 Ga0207678_10051859
1397 Ga0207678_10086845
1398 Ga0207708_10004165
1399 Ga0207708_10023769
1400 Ga0207708_10031201
1401 Ga0207702_10468368
1402 Ga0207702_10956410
1403 Ga0207702_11524468
1404 Ga0207641_10165629
1405 Ga0207641_10212747
1406 Ga0207641_10642704
1407 Ga0207641_10786918
1408 Ga0207648_10006890
1409 Ga0207648_10100270
1410 Ga0207648_10107834
1411 Ga0207648_10148876
1412 Ga0207648_10172535
1413 Ga0207648_10389982
1414 Ga0207648_11706970
1415 Ga0207676_10040778
1416 Ga0207676_10049493
1417 Ga0207676_10087669
1418 Ga0207676_10749389
1419 Ga0207676_10814367
1420 Ga0207676_10919257
1421 Ga0207674_10000678
1422 Ga0207674_10001382
1423 Ga0207674_10001495
1424 Ga0207674_10013171
1425 Ga0207674_10929746
1426 Ga0207674_11363799
1427 Ga0207675_100000503
1428 Ga0207675_100000535
1429 Ga0207675_100036944
1430 Ga0207683_10265097
1431 Ga0207683_10284458
1432 Ga0207683_10706050
1433 Ga0207698_10047638
1434 Ga0207698_10112509
1435 Ga0207698_10197200
1436 Ga0207698_10241005
1437 Ga0207698_11919919
1438 Ga0207428_10126975
1439 Ga0207428_10154899
1440 Ga0207428_10165174
1441 Ga0207428_10649746
1442 Ga0207428_10888652
1443 Ga0268266_10182385
1444 Ga0268266_10588252
1445 Ga0268266_10856232
1446 Ga0268265_10020718
1447 Ga0268265_10080256
1448 Ga0268265_10196622
1449 Ga0268265_10488898
1450 Ga0268265_10751568
1451 Ga0268264_10184110
1452 Ga0268264_10193304
1453 Ga0268264_10378338
1454 Ga0265332_10007280
1455 Ga0307408_100001491
1456 Ga0307408_100002267
1457 Ga0307408_100029592
1458 Ga0307408_100074913
1459 Ga0307408_101299176
1460 Ga0307408_101528586
1461 Ga0265314_10028272
1462 Ga0307405_10025382
1463 Ga0307405_10028042
1464 Ga0307405_10362010
1465 Ga0307405_10605289
1466 Ga0307405_11721266
1467 Ga0316577_10014030
1468 Ga0307413_10033547
1469 Ga0307413_10990297
1470 Ga0307410_10013655
1471 Ga0307410_10029135
1472 Ga0307410_10046987
1473 Ga0307410_10954666
1474 Ga0307410_11881388
1475 Ga0307406_10000320
1476 Ga0307406_10005591
1477 Ga0307406_10010920
1478 Ga0307406_10358730
1479 Ga0307406_11214672
1480 Ga0307406_11217844
1481 Ga0307406_12077437
1482 Ga0307407_10001122
1483 Ga0307407_10044356
1484 Ga0307407_10099580
1485 Ga0307407_10600757
1486 Ga0307412_10018176
1487 Ga0307412_10059752
1488 Ga0307412_10466465
1489 Ga0307412_11588060
1490 Ga0307412_11662526
1491 Ga0307409_100002084
1492 Ga0307409_100042426
1493 Ga0307409_100523489
1494 Ga0307409_100587787
1495 Ga0307409_100632876
1496 Ga0307416_100010627
1497 Ga0307416_100062225
1498 Ga0307416_100245644
1499 Ga0307416_100265809
1500 Ga0307416_100788180
1501 Ga0307416_100961004
1502 Ga0307416_101016976
1503 Ga0307416_103391353
1504 Ga0307416_103502559
1505 Ga0307416_103665748
1506 Ga0307414_10199104
1507 Ga0307414_10577407
1508 Ga0307414_10782748
1509 Ga0307414_12092506
1510 Ga0307411_10001535
1511 Ga0307411_10329761
1512 Ga0307411_10629777
1513 Ga0307411_10741577
1514 Ga0307411_10942923
1515 Ga0307411_10999209
1516 Ga0307411_11174664
1517 Ga0307415_100011392
1518 Ga0307415_100148524
1519 Ga0307415_100568397
1520 Ga0307415_100700905
1521 Ga0307415_100784946
1522 Ga0307415_101702339
1523 Ga0316583_10295412
1524 Ga0373934_0006842
1525 Ga0373940_0367250
1526 Ga0373953_0202200
1527 Ga0373956_0055367
1528 Ga0373957_0063335
1529 Ga0373955_0015970
1530 Ga0373961_0060629
1531 Ga0316574_0396713
1532 Ga0373931_0397865
1533 Ga0373933_0024480
1534 Ga0373933_1195366
1535 Ga0373937_0021289
1536 Ga0373925_0435016
1537 Ga0436365_0511229
1538 Ga0436365_0723372
1539 Ga0436365_1317039
1540 Ga0451789_0780576
1541 Ga0451789_1040236
1542 Ga0451807_0123902
1543 Ga0451807_1356045
1544 Ga0451843_0463463
1545 Ga0451853_1854011
1546 Ga0439448_0104569
1547 Ga0439450_197188
1548 Ga0439455_0009364
1549 Ga0439440_0058378
1550 Ga0466965_0150565
1551 Ga0466963_0067465
1552 Ga0466968_0680694
1553 Ga0451576_0133040
1554 Ga0451576_0208075
1555 Ga0466967_0790083
1556 Ga0495592_0653945
1557 Ga0495629_0329637
1558 Ga0495629_0837291
1559 Ga0495651_0030288
1560 Ga0495651_0254131
1561 Ga0495653_0035044
1562 Ga0495664_0097981
1563 Ga0495628_0021344
1564 Ga0495652_0048443
1565 Ga0495665_0179270
1566 Ga0495665_0357714
1567 Ga0495665_0490326
1568 Ga0495587_0018335
1569 Ga0495645_0002088
1570 Ga0495645_0075075
1571 Ga0495667_0124452
1572 Ga0495635_0180189
1573 Ga0495588_0754549
1574 Ga0495657_0350850
1575 Ga0495599_0006599
1576 Ga0495623_0010092
1577 Ga0495646_0607026
1578 Ga0495658_0308277
1579 Ga0495613_0451442
1580 Ga0495600_0276015
1581 Ga0495600_0525195
1582 Ga0495581_0359650
1583 Ga0495604_0027293
1584 Ga0495674_0456706
1585 Ga0495672_0003234
1586 Ga0495680_0690046
1587 Ga0495675_0011938
1588 Ga0495684_0027923
1589 Ga0495602_0023674
1590 Ga0496107_0680936
1591 Ga0496108_0260263
1592 Ga0496109_0033603
1593 Ga0496109_0942303
1594 Ga0496112_0156876
1595 Ga0496112_0225344
1596 Ga0496113_0995392
1597 Ga0496114_0622760
1598 Ga0501293_019551
1599 Ga0501299_014174
1600 Ga0501033_0492034
1601 Ga0501034_0545993
1602 Ga0501040_0053786
1603 Ga0501070_0172029
1604 Ga0501072_0177280
1605 Ga0501209_136838
1606 Ga0501209_202000
1607 Ga0501216_171811
1608 Ga0501217_112813
1609 Ga0501217_157981
1610 Ga0501217_280476
1611 Ga0501224_036404
1612 Ga0501227_109925
1613 Ga0501239_020262
1614 Ga0501249_064142
1615 Ga0501249_115220
1616 Ga0501249_212449
1617 Ga0501253_039871
1618 Ga0501259_077772
1619 Ga0501259_163090
1620 Ga0501225_0091337
1621 Ga0501225_0207100
1622 Ga0501234_031615
1623 Ga0501263_046188
1624 Ga0501267_014565
1625 Ga0501270_124989
1626 Ga0501270_127444
1627 Ga0501274_021062
1628 Ga0501035_0783216
1629 Ga0501044_0880454
1630 nmdc:mga05p37_1094301_c1
1631 nmdc:mga05p37_206624_c1
1632 nmdc:mga05p37_28658_c1
1633 nmdc:mga05p37_564185_c1
1634 nmdc:mga09592_296110_c1
1635 nmdc:mga09592_43274_c1
1636 nmdc:mga09592_43548_c1
1637 nmdc:mga09592_537086_c1
1638 nmdc:mga09592_739055_c1
1639 nmdc:mga0qj67_1375033_c1
1640 nmdc:mga0qj67_1490860_c1
1641 nmdc:mga0qj67_229841_c1
1642 nmdc:mga0qj67_33383_c1
1643 nmdc:mga0qj67_342075_c1
1644 nmdc:mga0qj67_3812_c1
1645 nmdc:mga0qj67_40350_c1
1646 nmdc:mga0qj67_43781_c1
1647 nmdc:mga06r32_103951_c1
1648 nmdc:mga06r32_139390_c1
1649 nmdc:mga06r32_323874_c1
1650 nmdc:mga06r32_44040_c1
1651 nmdc:mga06r32_679465_c1
1652 nmdc:mga06r32_756267_c1
1653 nmdc:mga06r32_820683_c1
1654 nmdc:mga08y16_1379255_c1
1655 nmdc:mga08y16_14949_c1
1656 nmdc:mga08y16_1499639_c1
1657 nmdc:mga08y16_259683_c1
1658 nmdc:mga08y16_476807_c1
1659 nmdc:mga08y16_61903_c1
1660 nmdc:mga08y16_99901_c1
1661 nmdc:mga0n895_3580_c1
1662 nmdc:mga0n895_37263_c1
1663 nmdc:mga0n895_4241_c1
1664 nmdc:mga0rr50_950168_c1
1665 nmdc:mga0a205_37285_c1
1666 nmdc:mga0a205_47632_c1
1667 nmdc:mga0a205_48243_c1
1668 nmdc:mga0a205_879922_c1
1669 Ga0495612_0106106
1670 Ga0495595_0027449
1671 Ga0495619_0204462
1672 Ga0500641_0278523
1673 Ga0590071_027639
1674 Ga0590075_022552
1675 Ga0590077_035243
1676 Ga0501082_0915460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9361 10 108
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9358 13 108
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9276 10 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9013 9 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8939 2 107
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9415 10 106 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9276 10 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8937 13 94 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8838 10 108 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8651 13 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y3IAF1-F1-model_v4 PadR family transcriptional regulator 1.001 9 107
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.993 10 88
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9904 10 107
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9885 4 107
AF-A0A7V0Y143-F1-model_v4 PadR family transcriptional regulator 0.9867 10 110

Map