F482969

General Info

Members Datasets Scaffolds Average Seq Length
838 300 1676 130

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10359396|Ga0065707_103593962
Length 132
Sequence VPATVEQTQSSSLVLLCVASWAIPGVGHLWLGRRSKGLILLIALPLMFAIGLAIHGRLFWPFPLDFSEPLAGLMAFADLGIGIPYFVATAFGYGAGDVRAVTYEYGNTYLIVAGLLNLLVVIDVYDVAVGRK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
194 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
279 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 23.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10359396 3300005295 Bacteria 906
2 Ga0058863_11152038 3300004799 Unclassified 543
3 Ga0065714_10247857 3300005288 Bacteria 781
4 Ga0065704_10588199 3300005289 Bacteria 614
5 Ga0065704_10813548 3300005289 Unclassified 521
6 Ga0065712_10021813 3300005290 Bacteria 1834
7 Ga0065712_10664021 3300005290 Unclassified 562
8 Ga0065715_10024371 3300005293 Bacteria 2014
9 Ga0065715_10204074 3300005293 Unclassified 1341
10 Ga0065707_10109671 3300005295 Bacteria 2461
11 Ga0065707_10549588 3300005295 Unclassified 722
12 Ga0070676_10029016 3300005328 Bacteria 3144
13 Ga0070676_10166653 3300005328 Bacteria 1422
14 Ga0070676_11217523 3300005328 Unclassified 573
15 Ga0070683_100205618 3300005329 Bacteria 1870
16 Ga0070683_100507917 3300005329 Bacteria 1152
17 Ga0070690_100098667 3300005330 Bacteria 1934
18 Ga0070690_100153204 3300005330 Bacteria 1574
19 Ga0070670_100069829 3300005331 Unclassified 3016
20 Ga0070670_100159469 3300005331 Bacteria 1955
21 Ga0068869_100505796 3300005334 Bacteria 1009
22 Ga0068869_101890933 3300005334 Unclassified 535
23 Ga0070666_10125593 3300005335 Bacteria 1781
24 Ga0070666_10177997 3300005335 Bacteria 1491
25 Ga0070666_10725018 3300005335 Unclassified 730
26 Ga0070680_100155780 3300005336 Bacteria 1919
27 Ga0070680_101318989 3300005336 Bacteria 625
28 Ga0070680_101549642 3300005336 Viruses 574
29 Ga0070682_100552867 3300005337 Unclassified 901
30 Ga0068868_100165228 3300005338 Bacteria 1830
31 Ga0068868_100268389 3300005338 Bacteria 1441
32 Ga0068868_100486661 3300005338 Bacteria 1079
33 Ga0068868_101546934 3300005338 Unclassified 622
34 Ga0070660_100283665 3300005339 Unclassified 1355
35 Ga0070660_100416000 3300005339 Bacteria 1113
36 Ga0070689_100203500 3300005340 Unclassified 1617
37 Ga0070689_101347342 3300005340 Bacteria 644
38 Ga0070691_10030411 3300005341 Bacteria 2529
39 Ga0070687_100059635 3300005343 Bacteria 2010
40 Ga0070687_100310474 3300005343 Bacteria 1004
41 Ga0070687_100521161 3300005343 Bacteria 804
42 Ga0070692_10441081 3300005345 Unclassified 831
43 Ga0070668_100128002 3300005347 Bacteria 2035
44 Ga0070668_101283400 3300005347 Bacteria 665
45 Ga0070669_100041941 3300005353 Bacteria 3330
46 Ga0070669_100090832 3300005353 Bacteria 2289
47 Ga0070669_100196269 3300005353 Bacteria 1586
48 Ga0070669_101723049 3300005353 Unclassified 546
49 Ga0070675_100000079 3300005354 Bacteria 56265
50 Ga0070675_100261038 3300005354 Bacteria 1518
51 Ga0070675_101557764 3300005354 Bacteria 610
52 Ga0070671_100039770 3300005355 Bacteria 3904
53 Ga0070671_100981125 3300005355 Unclassified 740
54 Ga0070674_100103622 3300005356 Bacteria 2078
55 Ga0070674_101263990 3300005356 Bacteria 657
56 Ga0070673_100143749 3300005364 Bacteria 2015
57 Ga0070688_100037301 3300005365 Bacteria 2961
58 Ga0070688_100488463 3300005365 Bacteria 927
59 Ga0070688_100537307 3300005365 Unclassified 887
60 Ga0070659_100358135 3300005366 Unclassified 1225
61 Ga0070667_100008544 3300005367 Bacteria 8489
62 Ga0070667_100836069 3300005367 Unclassified 856
63 Ga0070667_100874747 3300005367 Unclassified 836
64 Ga0070709_10439341 3300005434 Unclassified 981
65 Ga0070709_10586763 3300005434 Bacteria 857
66 Ga0070701_10026156 3300005438 Bacteria 2843
67 Ga0070705_100042493 3300005440 Bacteria 2599
68 Ga0070705_100057068 3300005440 Bacteria 2302
69 Ga0070705_101714664 3300005440 Bacteria 531
70 Ga0070700_100093356 3300005441 Bacteria 1968
71 Ga0070700_100162152 3300005441 Unclassified 1540
72 Ga0070700_100365881 3300005441 Bacteria 1074
73 Ga0070700_100594237 3300005441 Bacteria 866
74 Ga0070700_100937001 3300005441 Bacteria 708
75 Ga0070700_101085789 3300005441 Bacteria 662
76 Ga0070694_100005370 3300005444 Bacteria 7750
77 Ga0070694_100046979 3300005444 Bacteria 2900
78 Ga0070694_100109766 3300005444 Bacteria 1964
79 Ga0070708_100061910 3300005445 Bacteria 3345
80 Ga0070708_100273481 3300005445 Bacteria 1589
81 Ga0070708_100337629 3300005445 Bacteria 1420
82 Ga0070708_100561760 3300005445 Bacteria 1076
83 Ga0070708_101257356 3300005445 Bacteria 692
84 Ga0070663_101034680 3300005455 Bacteria 715
85 Ga0070662_100393022 3300005457 Bacteria 1143
86 Ga0070662_100533338 3300005457 Bacteria 982
87 Ga0070681_10008229 3300005458 Bacteria 10205
88 Ga0070681_11142272 3300005458 Bacteria 700
89 Ga0068867_100003841 3300005459 Bacteria 10558
90 Ga0068867_100126007 3300005459 Bacteria 1985
91 Ga0070685_10143988 3300005466 Bacteria 1504
92 Ga0070685_10195338 3300005466 Bacteria 1312
93 Ga0070706_100254329 3300005467 Bacteria 1640
94 Ga0070706_100341197 3300005467 Bacteria 1397
95 Ga0070706_100997645 3300005467 Unclassified 772
96 Ga0070706_101129767 3300005467 Bacteria 721
97 Ga0070706_101397042 3300005467 Bacteria 641
98 Ga0070706_101432054 3300005467 Unclassified 632
99 Ga0070707_100077010 3300005468 Bacteria 3218
100 Ga0070707_100104043 3300005468 Bacteria 2752
101 Ga0070707_100307259 3300005468 Bacteria 1541
102 Ga0070698_100341449 3300005471 Unclassified 1429
103 Ga0070698_100400983 3300005471 Bacteria 1305
104 Ga0070698_100902597 3300005471 Bacteria 829
105 Ga0070699_100028591 3300005518 Bacteria 4808
106 Ga0070699_100246152 3300005518 Bacteria 1597
107 Ga0070699_100602159 3300005518 Bacteria 1002
108 Ga0070699_101293628 3300005518 Unclassified 669
109 Ga0070679_100404308 3300005530 Bacteria 1311
110 Ga0070684_100039869 3300005535 Bacteria 4042
111 Ga0070684_100803885 3300005535 Unclassified 879
112 Ga0070684_101084973 3300005535 Unclassified 752
113 Ga0070697_100164252 3300005536 Bacteria 1877
114 Ga0070697_102042697 3300005536 Bacteria 513
115 Ga0068853_101807698 3300005539 Unclassified 592
116 Ga0068853_102237829 3300005539 Unclassified 530
117 Ga0070672_100047197 3300005543 Bacteria 3341
118 Ga0070672_100080670 3300005543 Bacteria 2607
119 Ga0070672_100792009 3300005543 Bacteria 834
120 Ga0070686_100000481 3300005544 Bacteria 24146
121 Ga0070686_100290080 3300005544 Unclassified 1210
122 Ga0070686_100368098 3300005544 Bacteria 1085
123 Ga0070686_100380139 3300005544 Bacteria 1069
124 Ga0070686_100404610 3300005544 Bacteria 1039
125 Ga0070686_100517371 3300005544 Unclassified 928
126 Ga0070695_100003133 3300005545 Bacteria 9639
127 Ga0070695_100004357 3300005545 Bacteria 8296
128 Ga0070695_100348288 3300005545 Unclassified 1109
129 Ga0070696_100021427 3300005546 Bacteria 4381
130 Ga0070696_100520664 3300005546 Bacteria 949
131 Ga0070693_100256337 3300005547 Bacteria 1162
132 Ga0070693_101096166 3300005547 Bacteria 607
133 Ga0070665_100001145 3300005548 Bacteria 32593
134 Ga0070665_100009496 3300005548 Bacteria 9838
135 Ga0070665_100082721 3300005548 Bacteria 3216
136 Ga0070665_101037234 3300005548 Bacteria 832
137 Ga0070704_100106789 3300005549 Bacteria 2122
138 Ga0070704_100122028 3300005549 Bacteria 2004
139 Ga0070704_100269646 3300005549 Bacteria 1406
140 Ga0070704_100278728 3300005549 Bacteria 1384
141 Ga0070704_100394656 3300005549 Bacteria 1179
142 Ga0070704_100901639 3300005549 Unclassified 795
143 Ga0070704_100932811 3300005549 Bacteria 782
144 Ga0068855_100808360 3300005563 Bacteria 996
145 Ga0070664_100265678 3300005564 Unclassified 1544
146 Ga0068857_100186387 3300005577 Bacteria 1889
147 Ga0068857_100829247 3300005577 Unclassified 884
148 Ga0068854_100160376 3300005578 Bacteria 1741
149 Ga0068856_100294464 3300005614 Bacteria 1640
150 Ga0068856_101080142 3300005614 Bacteria 820
151 Ga0070702_100242949 3300005615 Bacteria 1216
152 Ga0070702_101145801 3300005615 Bacteria 624
153 Ga0068859_100160350 3300005617 Bacteria 2328
154 Ga0068859_100337894 3300005617 Bacteria 1600
155 Ga0068859_101384407 3300005617 Unclassified 776
156 Ga0068859_102131529 3300005617 Bacteria 619
157 Ga0068859_102497352 3300005617 Bacteria 569
158 Ga0068864_100017150 3300005618 Bacteria 6039
159 Ga0068864_100049294 3300005618 Bacteria 3623
160 Ga0068864_100099067 3300005618 Bacteria 2582
161 Ga0068864_100187331 3300005618 Bacteria 1895
162 Ga0068864_100412526 3300005618 Bacteria 1285
163 Ga0068864_100739902 3300005618 Unclassified 963
164 Ga0068864_101167201 3300005618 Unclassified 768
165 Ga0068866_10006795 3300005718 Bacteria 4776
166 Ga0068866_10137282 3300005718 Bacteria 1399
167 Ga0068866_10324533 3300005718 Bacteria 970
168 Ga0068866_10566415 3300005718 Bacteria 762
169 Ga0068866_11159277 3300005718 Bacteria 556
170 Ga0068861_100021107 3300005719 Bacteria 4679
171 Ga0068861_100132387 3300005719 Bacteria 2025
172 Ga0068861_100140179 3300005719 Bacteria 1973
173 Ga0068861_100238853 3300005719 Bacteria 1545
174 Ga0068861_101009025 3300005719 Unclassified 795
175 Ga0068861_101264092 3300005719 Unclassified 716
176 Ga0068863_100002664 3300005841 Bacteria 17652
177 Ga0068863_100123536 3300005841 Bacteria 2470
178 Ga0068863_100790573 3300005841 Bacteria 946
179 Ga0068858_100008048 3300005842 Bacteria 10152
180 Ga0068858_100074660 3300005842 Bacteria 3148
181 Ga0068858_100388428 3300005842 Bacteria 1340
182 Ga0068858_100423595 3300005842 Bacteria 1280
183 Ga0068858_100617161 3300005842 Bacteria 1053
184 Ga0068858_102097008 3300005842 Unclassified 559
185 Ga0068858_102403002 3300005842 Bacteria 521
186 Ga0068860_100170347 3300005843 Bacteria 2103
187 Ga0068860_100370270 3300005843 Bacteria 1413
188 Ga0068860_100604949 3300005843 Unclassified 1102
189 Ga0068862_100011054 3300005844 Bacteria 7456
190 Ga0068862_100109236 3300005844 Bacteria 2426
191 Ga0068862_100219615 3300005844 Unclassified 1720
192 Ga0068862_100367921 3300005844 Bacteria 1337
193 Ga0068862_100756480 3300005844 Bacteria 946
194 Ga0081455_10102328 3300005937 Bacteria 2297
195 Ga0075432_10031883 3300006058 Bacteria 1825
196 Ga0075432_10252429 3300006058 Bacteria 716
197 Ga0070715_10182657 3300006163 Bacteria 1053
198 Ga0070715_10229584 3300006163 Bacteria 959
199 Ga0070716_100358798 3300006173 Bacteria 1034
200 Ga0070716_100396858 3300006173 Bacteria 991
201 Ga0070716_100813963 3300006173 Bacteria 724
202 Ga0097621_100004292 3300006237 Bacteria 9900
203 Ga0097621_100050602 3300006237 Bacteria 3379
204 Ga0097621_100074835 3300006237 Bacteria 2805
205 Ga0097621_100131530 3300006237 Bacteria 2131
206 Ga0097621_100647728 3300006237 Bacteria 969
207 Ga0097621_101490667 3300006237 Bacteria 642
208 Ga0068871_100003753 3300006358 Bacteria 10458
209 Ga0068871_100046892 3300006358 Bacteria 3482
210 Ga0068871_100206641 3300006358 Bacteria 1697
211 Ga0068871_101123919 3300006358 Unclassified 735
212 Ga0068871_101742918 3300006358 Unclassified 591
213 Ga0075428_100056377 3300006844 Bacteria 4304
214 Ga0075428_100340924 3300006844 Bacteria 1609
215 Ga0075428_101113551 3300006844 Unclassified 834
216 Ga0075431_100054678 3300006847 Bacteria 4116
217 Ga0075431_100124575 3300006847 Bacteria 2659
218 Ga0075433_10025454 3300006852 Bacteria 5002
219 Ga0075433_10166910 3300006852 Bacteria 1959
220 Ga0075433_10296167 3300006852 Unclassified 1433
221 Ga0075433_10303223 3300006852 Unclassified 1414
222 Ga0075433_10348301 3300006852 Unclassified 1309
223 Ga0075433_10416702 3300006852 Bacteria 1184
224 Ga0075433_10575353 3300006852 Bacteria 989
225 Ga0075433_10814458 3300006852 Unclassified 816
226 Ga0075433_11284986 3300006852 Bacteria 634
227 Ga0075434_100004125 3300006871 Bacteria 13026
228 Ga0075434_100025112 3300006871 Bacteria 5829
229 Ga0075434_100076044 3300006871 Bacteria 3352
230 Ga0075434_100096240 3300006871 Bacteria 2966
231 Ga0075434_100152859 3300006871 Bacteria 2328
232 Ga0075434_100375994 3300006871 Unclassified 1442
233 Ga0075434_100464052 3300006871 Bacteria 1287
234 Ga0075429_100122644 3300006880 Bacteria 2272
235 Ga0075429_100192717 3300006880 Bacteria 1785
236 Ga0075429_100829344 3300006880 Viruses 810
237 Ga0075429_101008672 3300006880 Unclassified 728
238 Ga0068865_100066210 3300006881 Bacteria 2548
239 Ga0068865_100571595 3300006881 Unclassified 952
240 Ga0075436_100002722 3300006914 Bacteria 12151
241 Ga0075436_100039696 3300006914 Bacteria 3248
242 Ga0075436_100054105 3300006914 Bacteria 2770
243 Ga0075436_100124185 3300006914 Bacteria 1808
244 Ga0075436_100136480 3300006914 Bacteria 1722
245 Ga0075436_100282579 3300006914 Bacteria 1187
246 Ga0075436_100422080 3300006914 Unclassified 968
247 Ga0075436_100551429 3300006914 Bacteria 846
248 Ga0075436_100918809 3300006914 Bacteria 655
249 Ga0097620_100160362 3300006931 Bacteria 2328
250 Ga0097620_100337929 3300006931 Bacteria 1600
251 Ga0097620_101384155 3300006931 Unclassified 776
252 Ga0097620_102131642 3300006931 Bacteria 619
253 Ga0097620_102498074 3300006931 Bacteria 569
254 Ga0075435_100000084 3300007076 Bacteria 49470
255 Ga0075435_100000725 3300007076 Bacteria 20435
256 Ga0075435_100003489 3300007076 Bacteria 10667
257 Ga0075435_100045342 3300007076 Bacteria 3524
258 Ga0075435_100166513 3300007076 Bacteria 1859
259 Ga0075435_100377277 3300007076 Unclassified 1218
260 Ga0099794_10172917 3300007265 Bacteria 1101
261 Ga0105251_10187034 3300009011 Unclassified 933
262 Ga0105250_10360495 3300009092 Bacteria 638
263 Ga0105240_10049334 3300009093 Bacteria 5314
264 Ga0105240_11225349 3300009093 Unclassified 794
265 Ga0111539_10010055 3300009094 Bacteria 11927
266 Ga0111539_10029326 3300009094 Bacteria 6704
267 Ga0111539_10119743 3300009094 Bacteria 3085
268 Ga0111539_10224436 3300009094 Bacteria 2188
269 Ga0111539_10243967 3300009094 Bacteria 2092
270 Ga0111539_10757855 3300009094 Unclassified 1130
271 Ga0111539_10896303 3300009094 Unclassified 1032
272 Ga0111539_11194229 3300009094 Bacteria 883
273 Ga0105245_10045287 3300009098 Bacteria 3929
274 Ga0105245_10062374 3300009098 Bacteria 3363
275 Ga0105245_10070349 3300009098 Bacteria 3175
276 Ga0105245_10478627 3300009098 Unclassified 1258
277 Ga0105245_11266680 3300009098 Bacteria 786
278 Ga0105245_12242566 3300009098 Unclassified 600
279 Ga0105247_10021551 3300009101 Bacteria 3878
280 Ga0114129_10004514 3300009147 Bacteria 19642
281 Ga0114129_10006992 3300009147 Bacteria 16064
282 Ga0114129_10012248 3300009147 Bacteria 12204
283 Ga0114129_10044666 3300009147 Bacteria 6233
284 Ga0114129_10059192 3300009147 Bacteria 5356
285 Ga0114129_10061431 3300009147 Bacteria 5251
286 Ga0114129_10109549 3300009147 Bacteria 3812
287 Ga0114129_10125005 3300009147 Bacteria 3537
288 Ga0114129_10164626 3300009147 Bacteria 3028
289 Ga0114129_10228141 3300009147 Bacteria 2509
290 Ga0114129_10338375 3300009147 Bacteria 1997
291 Ga0114129_10831408 3300009147 Bacteria 1176
292 Ga0105243_10022442 3300009148 Bacteria 4797
293 Ga0105243_10263768 3300009148 Bacteria 1543
294 Ga0105243_10534501 3300009148 Bacteria 1117
295 Ga0105243_10681523 3300009148 Bacteria 1000
296 Ga0105243_10699687 3300009148 Bacteria 988
297 Ga0105241_10513946 3300009174 Unclassified 1070
298 Ga0105241_11187707 3300009174 Unclassified 722
299 Ga0105241_12398641 3300009174 Bacteria 527
300 Ga0105242_10002352 3300009176 Bacteria 14918
301 Ga0105242_10012814 3300009176 Bacteria 6459
302 Ga0105242_10307120 3300009176 Bacteria 1450
303 Ga0105242_11199470 3300009176 Unclassified 778
304 Ga0105248_10003577 3300009177 Bacteria 17226
305 Ga0105248_10011730 3300009177 Bacteria 9664
306 Ga0105248_10039155 3300009177 Bacteria 5308
307 Ga0105248_10051904 3300009177 Bacteria 4602
308 Ga0105248_10073823 3300009177 Bacteria 3834
309 Ga0105248_10279377 3300009177 Bacteria 1880
310 Ga0105248_10309456 3300009177 Bacteria 1779
311 Ga0105248_10475447 3300009177 Bacteria 1409
312 Ga0105248_10833515 3300009177 Bacteria 1041
313 Ga0105248_11073731 3300009177 Bacteria 910
314 Ga0105248_11087139 3300009177 Unclassified 904
315 Ga0105248_11420788 3300009177 Unclassified 785
316 Ga0105237_10534041 3300009545 Unclassified 1179
317 Ga0105238_10054686 3300009551 Bacteria 4008
318 Ga0105238_10529016 3300009551 Bacteria 1182
319 Ga0105249_10364902 3300009553 Bacteria 1466
320 Ga0105249_10528930 3300009553 Bacteria 1227
321 Ga0105249_10721363 3300009553 Bacteria 1058
322 Ga0105249_11502230 3300009553 Bacteria 746
323 Ga0105249_11673511 3300009553 Bacteria 709
324 Ga0105239_11586705 3300010375 Bacteria 757
325 Ga0105246_10261107 3300011119 Bacteria 1380
326 Ga0105246_10335681 3300011119 Bacteria 1233
327 Ga0157336_1036296 3300012477 Unclassified 514
328 Ga0157369_10996920 3300013105 Bacteria 858
329 Ga0157374_10036446 3300013296 Bacteria 4505
330 Ga0157374_10279625 3300013296 Bacteria 1648
331 Ga0157374_10454032 3300013296 Bacteria 1283
332 Ga0157374_11469495 3300013296 Bacteria 705
333 Ga0157374_12177093 3300013296 Bacteria 581
334 Ga0157378_10019436 3300013297 Bacteria 5972
335 Ga0157378_10470262 3300013297 Bacteria 1251
336 Ga0157378_10697566 3300013297 Unclassified 1034
337 Ga0163162_10065887 3300013306 Bacteria 3671
338 Ga0163162_10096551 3300013306 Bacteria 3044
339 Ga0163162_10277876 3300013306 Unclassified 1807
340 Ga0163162_10587649 3300013306 Bacteria 1240
341 Ga0163162_11440605 3300013306 Unclassified 784
342 Ga0163162_11490080 3300013306 Bacteria 771
343 Ga0157375_10001923 3300013308 Bacteria 17871
344 Ga0157375_10225405 3300013308 Bacteria 2033
345 Ga0157375_11051958 3300013308 Bacteria 951
346 Ga0157375_11239856 3300013308 Unclassified 876
347 Ga0157375_11279155 3300013308 Bacteria 862
348 Ga0157375_11473407 3300013308 Unclassified 803
349 Ga0157375_12087705 3300013308 Bacteria 674
350 Ga0157375_12314584 3300013308 Bacteria 641
351 Ga0163163_10030557 3300014325 Bacteria 5191
352 Ga0163163_10108630 3300014325 Bacteria 2801
353 Ga0163163_10180062 3300014325 Bacteria 2161
354 Ga0163163_10444859 3300014325 Bacteria 1356
355 Ga0163163_11453942 3300014325 Unclassified 747
356 Ga0157380_10036562 3300014326 Bacteria 3800
357 Ga0157380_10584031 3300014326 Bacteria 1102
358 Ga0157380_10611895 3300014326 Unclassified 1080
359 Ga0157380_10842640 3300014326 Bacteria 938
360 Ga0157380_10882037 3300014326 Unclassified 919
361 Ga0157380_11382386 3300014326 Unclassified 754
362 Ga0182008_10872319 3300014497 Unclassified 528
363 Ga0157377_10076705 3300014745 Bacteria 1944
364 Ga0157379_10028453 3300014968 Bacteria 4970
365 Ga0157379_10149368 3300014968 Bacteria 2108
366 Ga0157379_10318931 3300014968 Bacteria 1419
367 Ga0157379_10492272 3300014968 Bacteria 1136
368 Ga0157379_10835345 3300014968 Bacteria 871
369 Ga0157379_10872463 3300014968 Bacteria 852
370 Ga0157379_11461398 3300014968 Bacteria 664
371 Ga0157376_10019114 3300014969 Bacteria 5272
372 Ga0157376_10037985 3300014969 Bacteria 3915
373 Ga0157376_10120095 3300014969 Bacteria 2328
374 Ga0157376_10364710 3300014969 Bacteria 1386
375 Ga0197907_10942820 3300020069 Bacteria 528
376 Ga0207697_10080386 3300025315 Unclassified 1373
377 Ga0207697_10458110 3300025315 Bacteria 565
378 Ga0207642_10036856 3300025899 Bacteria 2102
379 Ga0207642_10265020 3300025899 Bacteria 981
380 Ga0207642_10315778 3300025899 Unclassified 911
381 Ga0207642_10785488 3300025899 Bacteria 605
382 Ga0207710_10015139 3300025900 Bacteria 3257
383 Ga0207688_10559596 3300025901 Unclassified 719
384 Ga0207680_10033826 3300025903 Bacteria 2919
385 Ga0207680_10045734 3300025903 Bacteria 2583
386 Ga0207680_10855800 3300025903 Unclassified 652
387 Ga0207685_10552902 3300025905 Bacteria 612
388 Ga0207699_10308087 3300025906 Bacteria 1107
389 Ga0207645_10004065 3300025907 Bacteria 10903
390 Ga0207645_10305074 3300025907 Bacteria 1060
391 Ga0207645_10321961 3300025907 Bacteria 1031
392 Ga0207645_10418229 3300025907 Unclassified 903
393 Ga0207684_10151724 3300025910 Bacteria 1994
394 Ga0207684_10340873 3300025910 Unclassified 1291
395 Ga0207707_10030202 3300025912 Bacteria 4740
396 Ga0207707_10951269 3300025912 Bacteria 707
397 Ga0207671_11380147 3300025914 Unclassified 547
398 Ga0207663_10302149 3300025916 Bacteria 1196
399 Ga0207663_10946649 3300025916 Archaea 690
400 Ga0207663_11455952 3300025916 Bacteria 552
401 Ga0207660_10497884 3300025917 Unclassified 988
402 Ga0207660_10642665 3300025917 Bacteria 865
403 Ga0207662_10166660 3300025918 Bacteria 1411
404 Ga0207657_10086391 3300025919 Unclassified 2625
405 Ga0207657_10357304 3300025919 Bacteria 1152
406 Ga0207652_10303700 3300025921 Bacteria 1441
407 Ga0207652_10420854 3300025921 Bacteria 1205
408 Ga0207646_10063360 3300025922 Bacteria 3301
409 Ga0207646_10258689 3300025922 Bacteria 1573
410 Ga0207646_10421663 3300025922 Archaea 1204
411 Ga0207646_10639191 3300025922 Bacteria 954
412 Ga0207646_11523847 3300025922 Unclassified 578
413 Ga0207681_10009496 3300025923 Bacteria 5944
414 Ga0207681_10014584 3300025923 Bacteria 4889
415 Ga0207681_10022390 3300025923 Bacteria 4030
416 Ga0207681_10133129 3300025923 Unclassified 1841
417 Ga0207681_10353571 3300025923 Bacteria 1177
418 Ga0207694_10149147 3300025924 Bacteria 1883
419 Ga0207694_10492572 3300025924 Bacteria 1026
420 Ga0207694_11331226 3300025924 Unclassified 607
421 Ga0207650_10128897 3300025925 Unclassified 1978
422 Ga0207650_10144898 3300025925 Bacteria 1870
423 Ga0207650_10842038 3300025925 Unclassified 778
424 Ga0207659_10000628 3300025926 Bacteria 20952
425 Ga0207659_10239972 3300025926 Bacteria 1466
426 Ga0207659_10411656 3300025926 Bacteria 1133
427 Ga0207687_10039027 3300025927 Bacteria 3249
428 Ga0207687_10347424 3300025927 Bacteria 1208
429 Ga0207687_11066798 3300025927 Bacteria 693
430 Ga0207664_10186879 3300025929 Bacteria 1782
431 Ga0207644_10025908 3300025931 Bacteria 4036
432 Ga0207644_11045412 3300025931 Unclassified 686
433 Ga0207690_10032716 3300025932 Bacteria 3338
434 Ga0207690_10598489 3300025932 Bacteria 900
435 Ga0207706_10182930 3300025933 Bacteria 1841
436 Ga0207706_10627663 3300025933 Bacteria 922
437 Ga0207686_10017035 3300025934 Bacteria 4086
438 Ga0207686_10019084 3300025934 Bacteria 3893
439 Ga0207686_10120150 3300025934 Bacteria 1787
440 Ga0207686_10579188 3300025934 Bacteria 881
441 Ga0207709_10348522 3300025935 Bacteria 1117
442 Ga0207709_10506118 3300025935 Bacteria 943
443 Ga0207709_10563690 3300025935 Unclassified 897
444 Ga0207670_10051083 3300025936 Bacteria 2774
445 Ga0207670_10302610 3300025936 Unclassified 1252
446 Ga0207670_10412218 3300025936 Bacteria 1082
447 Ga0207670_10507998 3300025936 Bacteria 980
448 Ga0207670_10641997 3300025936 Bacteria 875
449 Ga0207670_11169190 3300025936 Bacteria 651
450 Ga0207669_10008518 3300025937 Bacteria 4820
451 Ga0207669_10132658 3300025937 Bacteria 1715
452 Ga0207704_10018853 3300025938 Bacteria 3612
453 Ga0207704_10713204 3300025938 Bacteria 831
454 Ga0207704_11330759 3300025938 Bacteria 615
455 Ga0207704_11378488 3300025938 Unclassified 604
456 Ga0207665_10083769 3300025939 Bacteria 2200
457 Ga0207665_10303384 3300025939 Bacteria 1194
458 Ga0207665_10304632 3300025939 Bacteria 1192
459 Ga0207691_10011005 3300025940 Bacteria 8679
460 Ga0207691_10120044 3300025940 Bacteria 2331
461 Ga0207691_10206736 3300025940 Bacteria 1707
462 Ga0207691_10317563 3300025940 Bacteria 1336
463 Ga0207691_11471554 3300025940 Unclassified 558
464 Ga0207691_11761295 3300025940 Unclassified 500
465 Ga0207711_10013249 3300025941 Bacteria 6851
466 Ga0207711_10066603 3300025941 Bacteria 3115
467 Ga0207711_10094408 3300025941 Bacteria 2636
468 Ga0207711_10205704 3300025941 Bacteria 1797
469 Ga0207711_10386317 3300025941 Bacteria 1299
470 Ga0207679_10326174 3300025945 Unclassified 1331
471 Ga0207679_10470092 3300025945 Bacteria 1118
472 Ga0207679_11016915 3300025945 Unclassified 760
473 Ga0207651_10068046 3300025960 Bacteria 2509
474 Ga0207651_10081429 3300025960 Bacteria 2334
475 Ga0207651_10584787 3300025960 Bacteria 974
476 Ga0207712_10044999 3300025961 Bacteria 3054
477 Ga0207712_10324192 3300025961 Bacteria 1272
478 Ga0207712_10528504 3300025961 Bacteria 1012
479 Ga0207668_10020013 3300025972 Bacteria 4245
480 Ga0207668_10874264 3300025972 Bacteria 799
481 Ga0207658_10285461 3300025986 Bacteria 1417
482 Ga0207658_10359137 3300025986 Bacteria 1270
483 Ga0207658_10794943 3300025986 Unclassified 859
484 Ga0207677_10073305 3300026023 Bacteria 2424
485 Ga0207677_10605706 3300026023 Unclassified 962
486 Ga0207677_10798304 3300026023 Bacteria 845
487 Ga0207677_11288148 3300026023 Unclassified 671
488 Ga0207703_10011917 3300026035 Bacteria 6770
489 Ga0207703_10030610 3300026035 Bacteria 4255
490 Ga0207703_10337759 3300026035 Bacteria 1384
491 Ga0207703_11428943 3300026035 Unclassified 665
492 Ga0207708_10006036 3300026075 Bacteria 8979
493 Ga0207708_10141789 3300026075 Bacteria 1886
494 Ga0207708_10165012 3300026075 Bacteria 1751
495 Ga0207708_10344290 3300026075 Unclassified 1221
496 Ga0207708_10523156 3300026075 Bacteria 997
497 Ga0207702_10108379 3300026078 Bacteria 2465
498 Ga0207702_11220983 3300026078 Bacteria 746
499 Ga0207641_10008679 3300026088 Bacteria 8391
500 Ga0207641_10063020 3300026088 Bacteria 3166
501 Ga0207641_10190207 3300026088 Bacteria 1886
502 Ga0207641_10622923 3300026088 Bacteria 1058
503 Ga0207648_10164487 3300026089 Bacteria 1960
504 Ga0207648_10359812 3300026089 Bacteria 1313
505 Ga0207676_10008874 3300026095 Bacteria 7151
506 Ga0207676_10192799 3300026095 Unclassified 1794
507 Ga0207676_10285086 3300026095 Bacteria 1501
508 Ga0207676_10297672 3300026095 Unclassified 1472
509 Ga0207676_10362851 3300026095 Bacteria 1343
510 Ga0207676_11367148 3300026095 Bacteria 704
511 Ga0207676_11787919 3300026095 Unclassified 613
512 Ga0207674_10553686 3300026116 Unclassified 1111
513 Ga0207674_10991823 3300026116 Bacteria 809
514 Ga0207674_11265955 3300026116 Bacteria 707
515 Ga0207675_100007372 3300026118 Bacteria 10395
516 Ga0207675_100054593 3300026118 Bacteria 3728
517 Ga0207675_100119081 3300026118 Bacteria 2497
518 Ga0207675_100210931 3300026118 Bacteria 1868
519 Ga0207675_100360069 3300026118 Unclassified 1427
520 Ga0207675_100422155 3300026118 Bacteria 1317
521 Ga0207675_100620991 3300026118 Bacteria 1085
522 Ga0207675_100707675 3300026118 Bacteria 1016
523 Ga0207683_10004558 3300026121 Bacteria 11935
524 Ga0207683_10103217 3300026121 Unclassified 2547
525 Ga0207428_10021799 3300027907 Bacteria 5420
526 Ga0207428_10172835 3300027907 Unclassified 1635
527 Ga0207428_10639713 3300027907 Bacteria 764
528 Ga0268266_10007803 3300028379 Bacteria 9598
529 Ga0268266_10119874 3300028379 Bacteria 2340
530 Ga0268266_11513436 3300028379 Bacteria 646
531 Ga0268265_10007584 3300028380 Bacteria 7318
532 Ga0268265_10030109 3300028380 Bacteria 3905
533 Ga0268265_10215975 3300028380 Bacteria 1674
534 Ga0268265_10492119 3300028380 Unclassified 1154
535 Ga0268265_10737093 3300028380 Bacteria 955
536 Ga0268265_11423624 3300028380 Bacteria 695
537 Ga0268265_12002169 3300028380 Unclassified 586
538 Ga0268265_12016246 3300028380 Bacteria 584
539 Ga0268264_10095204 3300028381 Bacteria 2576
540 Ga0268264_10241683 3300028381 Bacteria 1673
541 Ga0268264_10311989 3300028381 Bacteria 1484
542 Ga0268264_10618986 3300028381 Bacteria 1069
543 Ga0268264_10719733 3300028381 Unclassified 992
544 Ga0268264_10862099 3300028381 Unclassified 907
545 Ga0268264_11046466 3300028381 Unclassified 824
546 Ga0268264_12599804 3300028381 Unclassified 511
547 Ga0307416_100041684 3300032002 Bacteria 3578
548 Ga0307416_100619940 3300032002 Bacteria 1164
549 Ga0307411_10040104 3300032005 Unclassified 2968
550 Ga0307411_10834599 3300032005 Bacteria 814
551 Ga0373926_0272031 3300035083 Bacteria 659
552 Ga0373934_0014799 3300035086 Unclassified 2955
553 Ga0373944_0070045 3300035089 Bacteria 1141
554 Ga0373944_0226277 3300035089 Bacteria 684
555 Ga0373923_0153422 3300035111 Unclassified 1047
556 Ga0373923_0563684 3300035111 Unclassified 559
557 Ga0373936_0010960 3300035113 Bacteria 3426
558 Ga0373936_0199980 3300035113 Bacteria 882
559 Ga0373936_0342073 3300035113 Bacteria 680
560 Ga0373939_0046286 3300035114 Unclassified 1331
561 Ga0373939_0172731 3300035114 Bacteria 801
562 Ga0373953_0041002 3300035117 Bacteria 1841
563 Ga0373956_0270703 3300035119 Bacteria 808
564 Ga0373956_0304770 3300035119 Bacteria 759
565 Ga0373956_0311578 3300035119 Bacteria 750
566 Ga0373956_0508099 3300035119 Unclassified 575
567 Ga0373943_0529657 3300035170 Bacteria 690
568 Ga0373943_0723723 3300035170 Bacteria 590
569 Ga0373946_0048571 3300035171 Unclassified 1767
570 Ga0373955_0171912 3300035172 Bacteria 1283
571 Ga0373955_0236015 3300035172 Bacteria 1095
572 Ga0373955_0356002 3300035172 Bacteria 887
573 Ga0373955_0736355 3300035172 Unclassified 605
574 Ga0373942_0194248 3300035207 Unclassified 670
575 Ga0373961_0126693 3300035241 Bacteria 851
576 Ga0373961_0268078 3300035241 Unclassified 623
577 Ga0373924_0001943 3300035410 Bacteria 6877
578 Ga0373924_0278361 3300035410 Bacteria 742
579 Ga0373931_0187391 3300035691 Bacteria 1229
580 Ga0373935_0173049 3300035692 Bacteria 1478
581 Ga0373935_0298124 3300035692 Bacteria 1139
582 Ga0373927_0131685 3300035695 Bacteria 1634
583 Ga0373927_0424360 3300035695 Bacteria 878
584 Ga0373927_0826112 3300035695 Bacteria 612
585 Ga0373933_0228325 3300035724 Bacteria 1195
586 Ga0373933_0263387 3300035724 Bacteria 1112
587 Ga0373933_0460835 3300035724 Bacteria 832
588 Ga0373933_0595343 3300035724 Unclassified 726
589 Ga0373947_0034285 3300035725 Bacteria 3001
590 Ga0373947_0613145 3300035725 Unclassified 742
591 Ga0373947_0916291 3300035725 Bacteria 598
592 Ga0373937_0033054 3300036401 Bacteria 4695
593 Ga0373937_0059991 3300036401 Bacteria 3496
594 Ga0373937_0103272 3300036401 Bacteria 2647
595 Ga0373937_0285905 3300036401 Unclassified 1558
596 Ga0373937_0438612 3300036401 Bacteria 1240
597 Ga0373937_1087374 3300036401 Unclassified 748
598 Ga0373925_0066141 3300037068 Bacteria 2724
599 Ga0373925_0168961 3300037068 Bacteria 1726
600 Ga0373925_0844439 3300037068 Bacteria 755
601 Ga0436365_1084061 3300039437 Bacteria 819
602 Ga0451853_1694768 3300041512 Unclassified 782
603 Ga0439451_127115 3300042009 Unclassified 520
604 Ga0439454_060364 3300042011 Bacteria 657
605 Ga0439435_0012566 3300042436 Bacteria 2055
606 Ga0439435_0029522 3300042436 Bacteria 1481
607 Ga0439460_0055762 3300042461 Bacteria 1195
608 Ga0453683_0121833 3300044673 Bacteria 1642
609 Ga0466963_0446889 3300044694 Bacteria 912
610 Ga0466957_1080209 3300044842 Unclassified 578
611 Ga0451576_0203868 3300045051 Bacteria 2065
612 Ga0451576_0537637 3300045051 Bacteria 1228
613 Ga0466967_0596317 3300045976 Bacteria 1090
614 Ga0466967_0876433 3300045976 Bacteria 892
615 Ga0495592_0006655 3300046454 Bacteria 8616
616 Ga0495603_0447237 3300046455 Bacteria 740
617 Ga0495629_0158163 3300046459 Bacteria 1574
618 Ga0495651_0363516 3300046462 Bacteria 953
619 Ga0495580_0102885 3300046472 Unclassified 1986
620 Ga0495580_0226418 3300046472 Bacteria 1284
621 Ga0495580_0323542 3300046472 Bacteria 1048
622 Ga0495582_0087529 3300046473 Bacteria 1734
623 Ga0495582_0757771 3300046473 Bacteria 562
624 Ga0495639_0078555 3300046475 Bacteria 1534
625 Ga0495639_0574012 3300046475 Bacteria 579
626 Ga0495664_0435176 3300046477 Unclassified 786
627 Ga0495594_0314167 3300046499 Unclassified 893
628 Ga0495594_0359432 3300046499 Unclassified 829
629 Ga0495608_0167181 3300046511 Bacteria 1396
630 Ga0495618_0221613 3300046514 Bacteria 1193
631 Ga0495620_0274158 3300046515 Unclassified 642
632 Ga0495628_0044782 3300046516 Bacteria 3519
633 Ga0495628_0087790 3300046516 Bacteria 2411
634 Ga0495628_0299545 3300046516 Unclassified 1190
635 Ga0495628_0585784 3300046516 Unclassified 798
636 Ga0495630_0038555 3300046517 Bacteria 3574
637 Ga0495644_0312499 3300046523 Unclassified 616
638 Ga0495642_0164297 3300046528 Bacteria 963
639 Ga0495652_0806905 3300046529 Unclassified 624
640 Ga0495652_0922567 3300046529 Unclassified 575
641 Ga0495665_0456999 3300046531 Bacteria 645
642 Ga0495640_0136680 3300046533 Bacteria 1582
643 Ga0495640_0313523 3300046533 Bacteria 972
644 Ga0495640_0704261 3300046533 Bacteria 606
645 Ga0495586_0117047 3300046535 Bacteria 1487
646 Ga0495586_0445730 3300046535 Bacteria 746
647 Ga0495586_0923348 3300046535 Unclassified 503
648 Ga0495587_0078216 3300046536 Bacteria 1919
649 Ga0495587_0441614 3300046536 Bacteria 721
650 Ga0495621_0038415 3300046539 Bacteria 1670
651 Ga0495645_0027644 3300046543 Bacteria 4121
652 Ga0495645_0172935 3300046543 Bacteria 1486
653 Ga0495633_0332582 3300046558 Bacteria 689
654 Ga0495667_0060118 3300046559 Bacteria 2493
655 Ga0495656_0375072 3300046615 Unclassified 741
656 Ga0495634_0181947 3300046642 Bacteria 1315
657 Ga0495634_0364064 3300046642 Bacteria 864
658 Ga0495635_0134447 3300046663 Bacteria 1686
659 Ga0495635_0351145 3300046663 Unclassified 984
660 Ga0495635_0771104 3300046663 Unclassified 621
661 Ga0495659_0035717 3300046664 Bacteria 1753
662 Ga0495657_0237401 3300046675 Unclassified 1101
663 Ga0495647_0233407 3300046681 Unclassified 815
664 Ga0495647_0270021 3300046681 Bacteria 761
665 Ga0495658_0018967 3300046683 Bacteria 3585
666 Ga0495658_0532455 3300046683 Unclassified 752
667 Ga0495658_1010930 3300046683 Unclassified 531
668 Ga0495669_0003095 3300046684 Bacteria 6842
669 Ga0495669_0102978 3300046684 Bacteria 1327
670 Ga0495613_0003254 3300046689 Bacteria 12146
671 Ga0495613_0115298 3300046689 Bacteria 1934
672 Ga0495613_0657714 3300046689 Bacteria 693
673 Ga0495670_0407762 3300046691 Bacteria 735
674 Ga0495600_0122304 3300046809 Bacteria 1693
675 Ga0495581_0252286 3300047315 Unclassified 1032
676 Ga0495604_0047148 3300047317 Bacteria 3358
677 Ga0495674_0013936 3300047319 Bacteria 7542
678 Ga0495674_0115593 3300047319 Bacteria 2271
679 Ga0495674_0800148 3300047319 Bacteria 733
680 Ga0495676_0673171 3300047321 Bacteria 671
681 Ga0495676_0747995 3300047321 Unclassified 631
682 Ga0495680_0261189 3300047322 Bacteria 1225
683 Ga0495680_0396771 3300047322 Bacteria 953
684 Ga0495675_0120395 3300047444 Bacteria 1635
685 Ga0495675_0396067 3300047444 Bacteria 806
686 Ga0495684_0019925 3300047471 Bacteria 5168
687 Ga0495684_0071835 3300047471 Bacteria 2630
688 Ga0495684_0118829 3300047471 Bacteria 1992
689 Ga0495602_0198657 3300048088 Bacteria 1532
690 Ga0496102_0183398 3300048905 Bacteria 1972
691 Ga0496102_1929137 3300048905 Bacteria 507
692 Ga0496104_0262396 3300048907 Unclassified 1640
693 Ga0496104_0409733 3300048907 Bacteria 1268
694 Ga0496104_0432063 3300048907 Bacteria 1229
695 Ga0496105_0049514 3300048908 Bacteria 3470
696 Ga0496105_0168729 3300048908 Bacteria 1795
697 Ga0496106_0049220 3300048909 Bacteria 3175
698 Ga0496106_0343798 3300048909 Bacteria 1198
699 Ga0496106_0345383 3300048909 Bacteria 1195
700 Ga0496106_1209420 3300048909 Unclassified 589
701 Ga0496106_1565461 3300048909 Unclassified 506
702 Ga0496107_0305230 3300048910 Bacteria 1185
703 Ga0496107_1234058 3300048910 Bacteria 537
704 Ga0496108_0281478 3300048911 Bacteria 1448
705 Ga0496108_0518632 3300048911 Bacteria 1040
706 Ga0496108_1146255 3300048911 Unclassified 659
707 Ga0496108_1266805 3300048911 Archaea 621
708 Ga0496108_1331389 3300048911 Unclassified 603
709 Ga0496109_0078084 3300048912 Bacteria 3048
710 Ga0496110_0230331 3300048913 Bacteria 1685
711 Ga0496110_0729190 3300048913 Unclassified 894
712 Ga0496110_1168623 3300048913 Bacteria 678
713 Ga0496111_0313766 3300048914 Bacteria 1162
714 Ga0496112_0027573 3300048915 Bacteria 5477
715 Ga0496112_0043576 3300048915 Unclassified 4393
716 Ga0496112_0126633 3300048915 Unclassified 2525
717 Ga0496112_0784048 3300048915 Bacteria 878
718 Ga0496112_0927678 3300048915 Unclassified 792
719 Ga0496112_1645274 3300048915 Unclassified 555
720 Ga0496114_0055022 3300048917 Bacteria 3318
721 Ga0496114_0141095 3300048917 Bacteria 2086
722 Ga0496114_0380099 3300048917 Bacteria 1250
723 Ga0496114_0466433 3300048917 Bacteria 1118
724 Ga0496114_0526762 3300048917 Bacteria 1045
725 Ga0496115_0144503 3300048918 Bacteria 1963
726 Ga0501033_0022557 3300049570 Bacteria 4750
727 Ga0501034_0315082 3300049571 Bacteria 1498
728 Ga0501036_0009757 3300049572 Bacteria 7905
729 Ga0501037_0443567 3300049573 Unclassified 886
730 Ga0501039_0024336 3300049575 Unclassified 4650
731 Ga0501040_0001841 3300049576 Bacteria 13631
732 Ga0501041_0006887 3300049577 Bacteria 6663
733 Ga0501041_0872171 3300049577 Unclassified 578
734 Ga0501042_0002127 3300049578 Bacteria 12020
735 Ga0501043_0988475 3300049579 Unclassified 599
736 Ga0501046_0007208 3300049580 Bacteria 9775
737 Ga0501047_0008630 3300049581 Bacteria 9625
738 Ga0501067_0169381 3300049583 Bacteria 1217
739 Ga0501067_0621798 3300049583 Bacteria 606
740 Ga0501069_0308352 3300049585 Bacteria 929
741 Ga0501071_0025362 3300049587 Unclassified 4152
742 Ga0501072_0161020 3300049588 Bacteria 1790
743 Ga0501072_0659882 3300049588 Bacteria 823
744 Ga0501073_0648405 3300049589 Unclassified 729
745 Ga0501074_1075845 3300049590 Bacteria 565
746 Ga0501075_0000713 3300049591 Bacteria 20583
747 Ga0501076_0000324 3300049592 Bacteria 29536
748 Ga0501076_1353063 3300049592 Unclassified 585
749 Ga0501077_0010634 3300049593 Bacteria 5731
750 Ga0501077_0907835 3300049593 Unclassified 567
751 Ga0501251_046648 3300049681 Bacteria 674
752 Ga0501253_148174 3300049683 Bacteria 590
753 Ga0501079_0004744 3300049741 Bacteria 10072
754 Ga0501079_0659943 3300049741 Unclassified 823
755 Ga0501079_0921417 3300049741 Bacteria 688
756 Ga0501080_0062730 3300049742 Unclassified 3459
757 Ga0501081_0000289 3300049743 Bacteria 26773
758 Ga0501083_0257576 3300049744 Unclassified 1135
759 Ga0501083_0371738 3300049744 Unclassified 930
760 Ga0501035_0370170 3300049822 Bacteria 1196
761 Ga0501035_0491081 3300049822 Bacteria 1011
762 Ga0501035_0939271 3300049822 Bacteria 683
763 Ga0501044_0023611 3300049823 Bacteria 6539
764 Ga0501045_0000988 3300049824 Bacteria 18614
765 Ga0501045_0490022 3300049824 Bacteria 913
766 nmdc:mga05p37_16604_c1 3300050507 Bacteria 8868
767 nmdc:mga05p37_256441_c1 3300050507 Bacteria 2095
768 nmdc:mga05p37_307594_c1 3300050507 Bacteria 1880
769 nmdc:mga05p37_3632_c1 3300050507 Bacteria 18032
770 nmdc:mga05p37_42205_c1 3300050507 Bacteria 5604
771 nmdc:mga05p37_44508_c1 3300050507 Bacteria 5461
772 nmdc:mga05p37_62098_c1 3300050507 Bacteria 4599
773 nmdc:mga05p37_64861_c1 3300050507 Bacteria 4494
774 nmdc:mga05p37_98111_c1 3300050507 Bacteria 3609
775 nmdc:mga09592_1429212_c1 3300050508 Bacteria 565
776 nmdc:mga09592_299243_c1 3300050508 Bacteria 1395
777 nmdc:mga09592_422230_c1 3300050508 Bacteria 1152
778 nmdc:mga09592_768785_c1 3300050508 Bacteria 816
779 nmdc:mga06r32_98371_c1 3300050510 Bacteria 2868
780 nmdc:mga08y16_110466_c1 3300050511 Bacteria 2863
781 nmdc:mga08y16_1330976_c1 3300050511 Unclassified 684
782 nmdc:mga08y16_283314_c1 3300050511 Bacteria 1709
783 nmdc:mga08y16_46634_c1 3300050511 Bacteria 4537
784 nmdc:mga08y16_55188_c1 3300050511 Bacteria 4152
785 nmdc:mga08y16_628695_c1 3300050511 Bacteria 1080
786 nmdc:mga08y16_8640_c2 3300050511 Bacteria 9311
787 nmdc:mga0n895_10988_c1 3300050512 Bacteria 8047
788 nmdc:mga0n895_189451_c1 3300050512 Bacteria 2088
789 nmdc:mga0n895_191419_c1 3300050512 Unclassified 2076
790 nmdc:mga0n895_2018_c1 3300050512 Bacteria 15602
791 nmdc:mga0n895_291913_c1 3300050512 Unclassified 1653
792 nmdc:mga0n895_314261_c1 3300050512 Bacteria 1588
793 nmdc:mga0n895_333505_c1 3300050512 Bacteria 1537
794 nmdc:mga0n895_465294_c1 3300050512 Bacteria 1276
795 nmdc:mga0rr50_1699549_c1 3300050513 Unclassified 532
796 nmdc:mga0rr50_1756_c1 3300050513 Bacteria 11969
797 nmdc:mga0rr50_1781671_c1 3300050513 Unclassified 518
798 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
799 nmdc:mga0rr50_306489_c1 3300050513 Unclassified 1329
800 nmdc:mga0rr50_36173_c1 3300050513 Bacteria 3553
801 nmdc:mga0rr50_48885_c1 3300050513 Bacteria 3129
802 nmdc:mga0rr50_68249_c1 3300050513 Bacteria 2703
803 nmdc:mga0rr50_958753_c1 3300050513 Bacteria 729
804 nmdc:mga08x19_213179_c1 3300050514 Bacteria 1326
805 nmdc:mga08x19_219795_c1 3300050514 Bacteria 1305
806 nmdc:mga08x19_239148_c1 3300050514 Unclassified 1251
807 nmdc:mga08x19_29943_c1 3300050514 Bacteria 3417
808 nmdc:mga08x19_340_c1 3300050514 Bacteria 33767
809 nmdc:mga08x19_662171_c1 3300050514 Bacteria 741
810 nmdc:mga08x19_836264_c1 3300050514 Bacteria 654
811 nmdc:mga08x19_97895_c1 3300050514 Bacteria 1943
812 nmdc:mga0a205_110158_c1 3300050515 Bacteria 2652
813 nmdc:mga0a205_1385812_c1 3300050515 Unclassified 551
814 nmdc:mga0a205_186400_c1 3300050515 Unclassified 1968
815 nmdc:mga0a205_191167_c1 3300050515 Bacteria 1939
816 nmdc:mga0a205_24699_c1 3300050515 Bacteria 5717
817 nmdc:mga0a205_525492_c1 3300050515 Bacteria 1040
818 nmdc:mga0a205_55742_c1 3300050515 Bacteria 3817
819 Ga0495601_0004400 3300053077 Bacteria 8142
820 Ga0495601_0075085 3300053077 Bacteria 2164
821 Ga0495601_0113928 3300053077 Unclassified 1753
822 Ga0495601_0679745 3300053077 Unclassified 657
823 Ga0495595_0022038 3300053084 Bacteria 2792
824 Ga0495595_0185223 3300053084 Bacteria 1033
825 Ga0495619_0011548 3300053085 Bacteria 5567
826 Ga0495619_0161256 3300053085 Bacteria 1549
827 Ga0495619_0227124 3300053085 Bacteria 1293
828 Ga0495619_0474916 3300053085 Bacteria 861
829 Ga0495619_0574388 3300053085 Unclassified 772
830 Ga0495619_0594336 3300053085 Bacteria 757
831 Ga0495619_0676642 3300053085 Unclassified 703
832 Ga0495619_0719248 3300053085 Unclassified 678
833 Ga0495619_0967646 3300053085 Bacteria 570
834 Ga0501084_0014484 3300054114 Bacteria 6537
835 Ga0501084_0363614 3300054114 Bacteria 1223
836 Ga0501082_0001496 3300060353 Bacteria 20567
837 Ga0530510_0030055 3300061734 Unclassified 3901
838 Ga0530510_1074600 3300061734 Unclassified 616
839 Ga0065707_10359396
840 Ga0058863_11152038
841 Ga0065714_10247857
842 Ga0065704_10588199
843 Ga0065704_10813548
844 Ga0065712_10021813
845 Ga0065712_10664021
846 Ga0065715_10024371
847 Ga0065715_10204074
848 Ga0065707_10109671
849 Ga0065707_10549588
850 Ga0070676_10029016
851 Ga0070676_10166653
852 Ga0070676_11217523
853 Ga0070683_100205618
854 Ga0070683_100507917
855 Ga0070690_100098667
856 Ga0070690_100153204
857 Ga0070670_100069829
858 Ga0070670_100159469
859 Ga0068869_100505796
860 Ga0068869_101890933
861 Ga0070666_10125593
862 Ga0070666_10177997
863 Ga0070666_10725018
864 Ga0070680_100155780
865 Ga0070680_101318989
866 Ga0070680_101549642
867 Ga0070682_100552867
868 Ga0068868_100165228
869 Ga0068868_100268389
870 Ga0068868_100486661
871 Ga0068868_101546934
872 Ga0070660_100283665
873 Ga0070660_100416000
874 Ga0070689_100203500
875 Ga0070689_101347342
876 Ga0070691_10030411
877 Ga0070687_100059635
878 Ga0070687_100310474
879 Ga0070687_100521161
880 Ga0070692_10441081
881 Ga0070668_100128002
882 Ga0070668_101283400
883 Ga0070669_100041941
884 Ga0070669_100090832
885 Ga0070669_100196269
886 Ga0070669_101723049
887 Ga0070675_100000079
888 Ga0070675_100261038
889 Ga0070675_101557764
890 Ga0070671_100039770
891 Ga0070671_100981125
892 Ga0070674_100103622
893 Ga0070674_101263990
894 Ga0070673_100143749
895 Ga0070688_100037301
896 Ga0070688_100488463
897 Ga0070688_100537307
898 Ga0070659_100358135
899 Ga0070667_100008544
900 Ga0070667_100836069
901 Ga0070667_100874747
902 Ga0070709_10439341
903 Ga0070709_10586763
904 Ga0070701_10026156
905 Ga0070705_100042493
906 Ga0070705_100057068
907 Ga0070705_101714664
908 Ga0070700_100093356
909 Ga0070700_100162152
910 Ga0070700_100365881
911 Ga0070700_100594237
912 Ga0070700_100937001
913 Ga0070700_101085789
914 Ga0070694_100005370
915 Ga0070694_100046979
916 Ga0070694_100109766
917 Ga0070708_100061910
918 Ga0070708_100273481
919 Ga0070708_100337629
920 Ga0070708_100561760
921 Ga0070708_101257356
922 Ga0070663_101034680
923 Ga0070662_100393022
924 Ga0070662_100533338
925 Ga0070681_10008229
926 Ga0070681_11142272
927 Ga0068867_100003841
928 Ga0068867_100126007
929 Ga0070685_10143988
930 Ga0070685_10195338
931 Ga0070706_100254329
932 Ga0070706_100341197
933 Ga0070706_100997645
934 Ga0070706_101129767
935 Ga0070706_101397042
936 Ga0070706_101432054
937 Ga0070707_100077010
938 Ga0070707_100104043
939 Ga0070707_100307259
940 Ga0070698_100341449
941 Ga0070698_100400983
942 Ga0070698_100902597
943 Ga0070699_100028591
944 Ga0070699_100246152
945 Ga0070699_100602159
946 Ga0070699_101293628
947 Ga0070679_100404308
948 Ga0070684_100039869
949 Ga0070684_100803885
950 Ga0070684_101084973
951 Ga0070697_100164252
952 Ga0070697_102042697
953 Ga0068853_101807698
954 Ga0068853_102237829
955 Ga0070672_100047197
956 Ga0070672_100080670
957 Ga0070672_100792009
958 Ga0070686_100000481
959 Ga0070686_100290080
960 Ga0070686_100368098
961 Ga0070686_100380139
962 Ga0070686_100404610
963 Ga0070686_100517371
964 Ga0070695_100003133
965 Ga0070695_100004357
966 Ga0070695_100348288
967 Ga0070696_100021427
968 Ga0070696_100520664
969 Ga0070693_100256337
970 Ga0070693_101096166
971 Ga0070665_100001145
972 Ga0070665_100009496
973 Ga0070665_100082721
974 Ga0070665_101037234
975 Ga0070704_100106789
976 Ga0070704_100122028
977 Ga0070704_100269646
978 Ga0070704_100278728
979 Ga0070704_100394656
980 Ga0070704_100901639
981 Ga0070704_100932811
982 Ga0068855_100808360
983 Ga0070664_100265678
984 Ga0068857_100186387
985 Ga0068857_100829247
986 Ga0068854_100160376
987 Ga0068856_100294464
988 Ga0068856_101080142
989 Ga0070702_100242949
990 Ga0070702_101145801
991 Ga0068859_100160350
992 Ga0068859_100337894
993 Ga0068859_101384407
994 Ga0068859_102131529
995 Ga0068859_102497352
996 Ga0068864_100017150
997 Ga0068864_100049294
998 Ga0068864_100099067
999 Ga0068864_100187331
1000 Ga0068864_100412526
1001 Ga0068864_100739902
1002 Ga0068864_101167201
1003 Ga0068866_10006795
1004 Ga0068866_10137282
1005 Ga0068866_10324533
1006 Ga0068866_10566415
1007 Ga0068866_11159277
1008 Ga0068861_100021107
1009 Ga0068861_100132387
1010 Ga0068861_100140179
1011 Ga0068861_100238853
1012 Ga0068861_101009025
1013 Ga0068861_101264092
1014 Ga0068863_100002664
1015 Ga0068863_100123536
1016 Ga0068863_100790573
1017 Ga0068858_100008048
1018 Ga0068858_100074660
1019 Ga0068858_100388428
1020 Ga0068858_100423595
1021 Ga0068858_100617161
1022 Ga0068858_102097008
1023 Ga0068858_102403002
1024 Ga0068860_100170347
1025 Ga0068860_100370270
1026 Ga0068860_100604949
1027 Ga0068862_100011054
1028 Ga0068862_100109236
1029 Ga0068862_100219615
1030 Ga0068862_100367921
1031 Ga0068862_100756480
1032 Ga0081455_10102328
1033 Ga0075432_10031883
1034 Ga0075432_10252429
1035 Ga0070715_10182657
1036 Ga0070715_10229584
1037 Ga0070716_100358798
1038 Ga0070716_100396858
1039 Ga0070716_100813963
1040 Ga0097621_100004292
1041 Ga0097621_100050602
1042 Ga0097621_100074835
1043 Ga0097621_100131530
1044 Ga0097621_100647728
1045 Ga0097621_101490667
1046 Ga0068871_100003753
1047 Ga0068871_100046892
1048 Ga0068871_100206641
1049 Ga0068871_101123919
1050 Ga0068871_101742918
1051 Ga0075428_100056377
1052 Ga0075428_100340924
1053 Ga0075428_101113551
1054 Ga0075431_100054678
1055 Ga0075431_100124575
1056 Ga0075433_10025454
1057 Ga0075433_10166910
1058 Ga0075433_10296167
1059 Ga0075433_10303223
1060 Ga0075433_10348301
1061 Ga0075433_10416702
1062 Ga0075433_10575353
1063 Ga0075433_10814458
1064 Ga0075433_11284986
1065 Ga0075434_100004125
1066 Ga0075434_100025112
1067 Ga0075434_100076044
1068 Ga0075434_100096240
1069 Ga0075434_100152859
1070 Ga0075434_100375994
1071 Ga0075434_100464052
1072 Ga0075429_100122644
1073 Ga0075429_100192717
1074 Ga0075429_100829344
1075 Ga0075429_101008672
1076 Ga0068865_100066210
1077 Ga0068865_100571595
1078 Ga0075436_100002722
1079 Ga0075436_100039696
1080 Ga0075436_100054105
1081 Ga0075436_100124185
1082 Ga0075436_100136480
1083 Ga0075436_100282579
1084 Ga0075436_100422080
1085 Ga0075436_100551429
1086 Ga0075436_100918809
1087 Ga0097620_100160362
1088 Ga0097620_100337929
1089 Ga0097620_101384155
1090 Ga0097620_102131642
1091 Ga0097620_102498074
1092 Ga0075435_100000084
1093 Ga0075435_100000725
1094 Ga0075435_100003489
1095 Ga0075435_100045342
1096 Ga0075435_100166513
1097 Ga0075435_100377277
1098 Ga0099794_10172917
1099 Ga0105251_10187034
1100 Ga0105250_10360495
1101 Ga0105240_10049334
1102 Ga0105240_11225349
1103 Ga0111539_10010055
1104 Ga0111539_10029326
1105 Ga0111539_10119743
1106 Ga0111539_10224436
1107 Ga0111539_10243967
1108 Ga0111539_10757855
1109 Ga0111539_10896303
1110 Ga0111539_11194229
1111 Ga0105245_10045287
1112 Ga0105245_10062374
1113 Ga0105245_10070349
1114 Ga0105245_10478627
1115 Ga0105245_11266680
1116 Ga0105245_12242566
1117 Ga0105247_10021551
1118 Ga0114129_10004514
1119 Ga0114129_10006992
1120 Ga0114129_10012248
1121 Ga0114129_10044666
1122 Ga0114129_10059192
1123 Ga0114129_10061431
1124 Ga0114129_10109549
1125 Ga0114129_10125005
1126 Ga0114129_10164626
1127 Ga0114129_10228141
1128 Ga0114129_10338375
1129 Ga0114129_10831408
1130 Ga0105243_10022442
1131 Ga0105243_10263768
1132 Ga0105243_10534501
1133 Ga0105243_10681523
1134 Ga0105243_10699687
1135 Ga0105241_10513946
1136 Ga0105241_11187707
1137 Ga0105241_12398641
1138 Ga0105242_10002352
1139 Ga0105242_10012814
1140 Ga0105242_10307120
1141 Ga0105242_11199470
1142 Ga0105248_10003577
1143 Ga0105248_10011730
1144 Ga0105248_10039155
1145 Ga0105248_10051904
1146 Ga0105248_10073823
1147 Ga0105248_10279377
1148 Ga0105248_10309456
1149 Ga0105248_10475447
1150 Ga0105248_10833515
1151 Ga0105248_11073731
1152 Ga0105248_11087139
1153 Ga0105248_11420788
1154 Ga0105237_10534041
1155 Ga0105238_10054686
1156 Ga0105238_10529016
1157 Ga0105249_10364902
1158 Ga0105249_10528930
1159 Ga0105249_10721363
1160 Ga0105249_11502230
1161 Ga0105249_11673511
1162 Ga0105239_11586705
1163 Ga0105246_10261107
1164 Ga0105246_10335681
1165 Ga0157336_1036296
1166 Ga0157369_10996920
1167 Ga0157374_10036446
1168 Ga0157374_10279625
1169 Ga0157374_10454032
1170 Ga0157374_11469495
1171 Ga0157374_12177093
1172 Ga0157378_10019436
1173 Ga0157378_10470262
1174 Ga0157378_10697566
1175 Ga0163162_10065887
1176 Ga0163162_10096551
1177 Ga0163162_10277876
1178 Ga0163162_10587649
1179 Ga0163162_11440605
1180 Ga0163162_11490080
1181 Ga0157375_10001923
1182 Ga0157375_10225405
1183 Ga0157375_11051958
1184 Ga0157375_11239856
1185 Ga0157375_11279155
1186 Ga0157375_11473407
1187 Ga0157375_12087705
1188 Ga0157375_12314584
1189 Ga0163163_10030557
1190 Ga0163163_10108630
1191 Ga0163163_10180062
1192 Ga0163163_10444859
1193 Ga0163163_11453942
1194 Ga0157380_10036562
1195 Ga0157380_10584031
1196 Ga0157380_10611895
1197 Ga0157380_10842640
1198 Ga0157380_10882037
1199 Ga0157380_11382386
1200 Ga0182008_10872319
1201 Ga0157377_10076705
1202 Ga0157379_10028453
1203 Ga0157379_10149368
1204 Ga0157379_10318931
1205 Ga0157379_10492272
1206 Ga0157379_10835345
1207 Ga0157379_10872463
1208 Ga0157379_11461398
1209 Ga0157376_10019114
1210 Ga0157376_10037985
1211 Ga0157376_10120095
1212 Ga0157376_10364710
1213 Ga0197907_10942820
1214 Ga0207697_10080386
1215 Ga0207697_10458110
1216 Ga0207642_10036856
1217 Ga0207642_10265020
1218 Ga0207642_10315778
1219 Ga0207642_10785488
1220 Ga0207710_10015139
1221 Ga0207688_10559596
1222 Ga0207680_10033826
1223 Ga0207680_10045734
1224 Ga0207680_10855800
1225 Ga0207685_10552902
1226 Ga0207699_10308087
1227 Ga0207645_10004065
1228 Ga0207645_10305074
1229 Ga0207645_10321961
1230 Ga0207645_10418229
1231 Ga0207684_10151724
1232 Ga0207684_10340873
1233 Ga0207707_10030202
1234 Ga0207707_10951269
1235 Ga0207671_11380147
1236 Ga0207663_10302149
1237 Ga0207663_10946649
1238 Ga0207663_11455952
1239 Ga0207660_10497884
1240 Ga0207660_10642665
1241 Ga0207662_10166660
1242 Ga0207657_10086391
1243 Ga0207657_10357304
1244 Ga0207652_10303700
1245 Ga0207652_10420854
1246 Ga0207646_10063360
1247 Ga0207646_10258689
1248 Ga0207646_10421663
1249 Ga0207646_10639191
1250 Ga0207646_11523847
1251 Ga0207681_10009496
1252 Ga0207681_10014584
1253 Ga0207681_10022390
1254 Ga0207681_10133129
1255 Ga0207681_10353571
1256 Ga0207694_10149147
1257 Ga0207694_10492572
1258 Ga0207694_11331226
1259 Ga0207650_10128897
1260 Ga0207650_10144898
1261 Ga0207650_10842038
1262 Ga0207659_10000628
1263 Ga0207659_10239972
1264 Ga0207659_10411656
1265 Ga0207687_10039027
1266 Ga0207687_10347424
1267 Ga0207687_11066798
1268 Ga0207664_10186879
1269 Ga0207644_10025908
1270 Ga0207644_11045412
1271 Ga0207690_10032716
1272 Ga0207690_10598489
1273 Ga0207706_10182930
1274 Ga0207706_10627663
1275 Ga0207686_10017035
1276 Ga0207686_10019084
1277 Ga0207686_10120150
1278 Ga0207686_10579188
1279 Ga0207709_10348522
1280 Ga0207709_10506118
1281 Ga0207709_10563690
1282 Ga0207670_10051083
1283 Ga0207670_10302610
1284 Ga0207670_10412218
1285 Ga0207670_10507998
1286 Ga0207670_10641997
1287 Ga0207670_11169190
1288 Ga0207669_10008518
1289 Ga0207669_10132658
1290 Ga0207704_10018853
1291 Ga0207704_10713204
1292 Ga0207704_11330759
1293 Ga0207704_11378488
1294 Ga0207665_10083769
1295 Ga0207665_10303384
1296 Ga0207665_10304632
1297 Ga0207691_10011005
1298 Ga0207691_10120044
1299 Ga0207691_10206736
1300 Ga0207691_10317563
1301 Ga0207691_11471554
1302 Ga0207691_11761295
1303 Ga0207711_10013249
1304 Ga0207711_10066603
1305 Ga0207711_10094408
1306 Ga0207711_10205704
1307 Ga0207711_10386317
1308 Ga0207679_10326174
1309 Ga0207679_10470092
1310 Ga0207679_11016915
1311 Ga0207651_10068046
1312 Ga0207651_10081429
1313 Ga0207651_10584787
1314 Ga0207712_10044999
1315 Ga0207712_10324192
1316 Ga0207712_10528504
1317 Ga0207668_10020013
1318 Ga0207668_10874264
1319 Ga0207658_10285461
1320 Ga0207658_10359137
1321 Ga0207658_10794943
1322 Ga0207677_10073305
1323 Ga0207677_10605706
1324 Ga0207677_10798304
1325 Ga0207677_11288148
1326 Ga0207703_10011917
1327 Ga0207703_10030610
1328 Ga0207703_10337759
1329 Ga0207703_11428943
1330 Ga0207708_10006036
1331 Ga0207708_10141789
1332 Ga0207708_10165012
1333 Ga0207708_10344290
1334 Ga0207708_10523156
1335 Ga0207702_10108379
1336 Ga0207702_11220983
1337 Ga0207641_10008679
1338 Ga0207641_10063020
1339 Ga0207641_10190207
1340 Ga0207641_10622923
1341 Ga0207648_10164487
1342 Ga0207648_10359812
1343 Ga0207676_10008874
1344 Ga0207676_10192799
1345 Ga0207676_10285086
1346 Ga0207676_10297672
1347 Ga0207676_10362851
1348 Ga0207676_11367148
1349 Ga0207676_11787919
1350 Ga0207674_10553686
1351 Ga0207674_10991823
1352 Ga0207674_11265955
1353 Ga0207675_100007372
1354 Ga0207675_100054593
1355 Ga0207675_100119081
1356 Ga0207675_100210931
1357 Ga0207675_100360069
1358 Ga0207675_100422155
1359 Ga0207675_100620991
1360 Ga0207675_100707675
1361 Ga0207683_10004558
1362 Ga0207683_10103217
1363 Ga0207428_10021799
1364 Ga0207428_10172835
1365 Ga0207428_10639713
1366 Ga0268266_10007803
1367 Ga0268266_10119874
1368 Ga0268266_11513436
1369 Ga0268265_10007584
1370 Ga0268265_10030109
1371 Ga0268265_10215975
1372 Ga0268265_10492119
1373 Ga0268265_10737093
1374 Ga0268265_11423624
1375 Ga0268265_12002169
1376 Ga0268265_12016246
1377 Ga0268264_10095204
1378 Ga0268264_10241683
1379 Ga0268264_10311989
1380 Ga0268264_10618986
1381 Ga0268264_10719733
1382 Ga0268264_10862099
1383 Ga0268264_11046466
1384 Ga0268264_12599804
1385 Ga0307416_100041684
1386 Ga0307416_100619940
1387 Ga0307411_10040104
1388 Ga0307411_10834599
1389 Ga0373926_0272031
1390 Ga0373934_0014799
1391 Ga0373944_0070045
1392 Ga0373944_0226277
1393 Ga0373923_0153422
1394 Ga0373923_0563684
1395 Ga0373936_0010960
1396 Ga0373936_0199980
1397 Ga0373936_0342073
1398 Ga0373939_0046286
1399 Ga0373939_0172731
1400 Ga0373953_0041002
1401 Ga0373956_0270703
1402 Ga0373956_0304770
1403 Ga0373956_0311578
1404 Ga0373956_0508099
1405 Ga0373943_0529657
1406 Ga0373943_0723723
1407 Ga0373946_0048571
1408 Ga0373955_0171912
1409 Ga0373955_0236015
1410 Ga0373955_0356002
1411 Ga0373955_0736355
1412 Ga0373942_0194248
1413 Ga0373961_0126693
1414 Ga0373961_0268078
1415 Ga0373924_0001943
1416 Ga0373924_0278361
1417 Ga0373931_0187391
1418 Ga0373935_0173049
1419 Ga0373935_0298124
1420 Ga0373927_0131685
1421 Ga0373927_0424360
1422 Ga0373927_0826112
1423 Ga0373933_0228325
1424 Ga0373933_0263387
1425 Ga0373933_0460835
1426 Ga0373933_0595343
1427 Ga0373947_0034285
1428 Ga0373947_0613145
1429 Ga0373947_0916291
1430 Ga0373937_0033054
1431 Ga0373937_0059991
1432 Ga0373937_0103272
1433 Ga0373937_0285905
1434 Ga0373937_0438612
1435 Ga0373937_1087374
1436 Ga0373925_0066141
1437 Ga0373925_0168961
1438 Ga0373925_0844439
1439 Ga0436365_1084061
1440 Ga0451853_1694768
1441 Ga0439451_127115
1442 Ga0439454_060364
1443 Ga0439435_0012566
1444 Ga0439435_0029522
1445 Ga0439460_0055762
1446 Ga0453683_0121833
1447 Ga0466963_0446889
1448 Ga0466957_1080209
1449 Ga0451576_0203868
1450 Ga0451576_0537637
1451 Ga0466967_0596317
1452 Ga0466967_0876433
1453 Ga0495592_0006655
1454 Ga0495603_0447237
1455 Ga0495629_0158163
1456 Ga0495651_0363516
1457 Ga0495580_0102885
1458 Ga0495580_0226418
1459 Ga0495580_0323542
1460 Ga0495582_0087529
1461 Ga0495582_0757771
1462 Ga0495639_0078555
1463 Ga0495639_0574012
1464 Ga0495664_0435176
1465 Ga0495594_0314167
1466 Ga0495594_0359432
1467 Ga0495608_0167181
1468 Ga0495618_0221613
1469 Ga0495620_0274158
1470 Ga0495628_0044782
1471 Ga0495628_0087790
1472 Ga0495628_0299545
1473 Ga0495628_0585784
1474 Ga0495630_0038555
1475 Ga0495644_0312499
1476 Ga0495642_0164297
1477 Ga0495652_0806905
1478 Ga0495652_0922567
1479 Ga0495665_0456999
1480 Ga0495640_0136680
1481 Ga0495640_0313523
1482 Ga0495640_0704261
1483 Ga0495586_0117047
1484 Ga0495586_0445730
1485 Ga0495586_0923348
1486 Ga0495587_0078216
1487 Ga0495587_0441614
1488 Ga0495621_0038415
1489 Ga0495645_0027644
1490 Ga0495645_0172935
1491 Ga0495633_0332582
1492 Ga0495667_0060118
1493 Ga0495656_0375072
1494 Ga0495634_0181947
1495 Ga0495634_0364064
1496 Ga0495635_0134447
1497 Ga0495635_0351145
1498 Ga0495635_0771104
1499 Ga0495659_0035717
1500 Ga0495657_0237401
1501 Ga0495647_0233407
1502 Ga0495647_0270021
1503 Ga0495658_0018967
1504 Ga0495658_0532455
1505 Ga0495658_1010930
1506 Ga0495669_0003095
1507 Ga0495669_0102978
1508 Ga0495613_0003254
1509 Ga0495613_0115298
1510 Ga0495613_0657714
1511 Ga0495670_0407762
1512 Ga0495600_0122304
1513 Ga0495581_0252286
1514 Ga0495604_0047148
1515 Ga0495674_0013936
1516 Ga0495674_0115593
1517 Ga0495674_0800148
1518 Ga0495676_0673171
1519 Ga0495676_0747995
1520 Ga0495680_0261189
1521 Ga0495680_0396771
1522 Ga0495675_0120395
1523 Ga0495675_0396067
1524 Ga0495684_0019925
1525 Ga0495684_0071835
1526 Ga0495684_0118829
1527 Ga0495602_0198657
1528 Ga0496102_0183398
1529 Ga0496102_1929137
1530 Ga0496104_0262396
1531 Ga0496104_0409733
1532 Ga0496104_0432063
1533 Ga0496105_0049514
1534 Ga0496105_0168729
1535 Ga0496106_0049220
1536 Ga0496106_0343798
1537 Ga0496106_0345383
1538 Ga0496106_1209420
1539 Ga0496106_1565461
1540 Ga0496107_0305230
1541 Ga0496107_1234058
1542 Ga0496108_0281478
1543 Ga0496108_0518632
1544 Ga0496108_1146255
1545 Ga0496108_1266805
1546 Ga0496108_1331389
1547 Ga0496109_0078084
1548 Ga0496110_0230331
1549 Ga0496110_0729190
1550 Ga0496110_1168623
1551 Ga0496111_0313766
1552 Ga0496112_0027573
1553 Ga0496112_0043576
1554 Ga0496112_0126633
1555 Ga0496112_0784048
1556 Ga0496112_0927678
1557 Ga0496112_1645274
1558 Ga0496114_0055022
1559 Ga0496114_0141095
1560 Ga0496114_0380099
1561 Ga0496114_0466433
1562 Ga0496114_0526762
1563 Ga0496115_0144503
1564 Ga0501033_0022557
1565 Ga0501034_0315082
1566 Ga0501036_0009757
1567 Ga0501037_0443567
1568 Ga0501039_0024336
1569 Ga0501040_0001841
1570 Ga0501041_0006887
1571 Ga0501041_0872171
1572 Ga0501042_0002127
1573 Ga0501043_0988475
1574 Ga0501046_0007208
1575 Ga0501047_0008630
1576 Ga0501067_0169381
1577 Ga0501067_0621798
1578 Ga0501069_0308352
1579 Ga0501071_0025362
1580 Ga0501072_0161020
1581 Ga0501072_0659882
1582 Ga0501073_0648405
1583 Ga0501074_1075845
1584 Ga0501075_0000713
1585 Ga0501076_0000324
1586 Ga0501076_1353063
1587 Ga0501077_0010634
1588 Ga0501077_0907835
1589 Ga0501251_046648
1590 Ga0501253_148174
1591 Ga0501079_0004744
1592 Ga0501079_0659943
1593 Ga0501079_0921417
1594 Ga0501080_0062730
1595 Ga0501081_0000289
1596 Ga0501083_0257576
1597 Ga0501083_0371738
1598 Ga0501035_0370170
1599 Ga0501035_0491081
1600 Ga0501035_0939271
1601 Ga0501044_0023611
1602 Ga0501045_0000988
1603 Ga0501045_0490022
1604 nmdc:mga05p37_16604_c1
1605 nmdc:mga05p37_256441_c1
1606 nmdc:mga05p37_307594_c1
1607 nmdc:mga05p37_3632_c1
1608 nmdc:mga05p37_42205_c1
1609 nmdc:mga05p37_44508_c1
1610 nmdc:mga05p37_62098_c1
1611 nmdc:mga05p37_64861_c1
1612 nmdc:mga05p37_98111_c1
1613 nmdc:mga09592_1429212_c1
1614 nmdc:mga09592_299243_c1
1615 nmdc:mga09592_422230_c1
1616 nmdc:mga09592_768785_c1
1617 nmdc:mga06r32_98371_c1
1618 nmdc:mga08y16_110466_c1
1619 nmdc:mga08y16_1330976_c1
1620 nmdc:mga08y16_283314_c1
1621 nmdc:mga08y16_46634_c1
1622 nmdc:mga08y16_55188_c1
1623 nmdc:mga08y16_628695_c1
1624 nmdc:mga08y16_8640_c2
1625 nmdc:mga0n895_10988_c1
1626 nmdc:mga0n895_189451_c1
1627 nmdc:mga0n895_191419_c1
1628 nmdc:mga0n895_2018_c1
1629 nmdc:mga0n895_291913_c1
1630 nmdc:mga0n895_314261_c1
1631 nmdc:mga0n895_333505_c1
1632 nmdc:mga0n895_465294_c1
1633 nmdc:mga0rr50_1699549_c1
1634 nmdc:mga0rr50_1756_c1
1635 nmdc:mga0rr50_1781671_c1
1636 nmdc:mga0rr50_2_c1
1637 nmdc:mga0rr50_306489_c1
1638 nmdc:mga0rr50_36173_c1
1639 nmdc:mga0rr50_48885_c1
1640 nmdc:mga0rr50_68249_c1
1641 nmdc:mga0rr50_958753_c1
1642 nmdc:mga08x19_213179_c1
1643 nmdc:mga08x19_219795_c1
1644 nmdc:mga08x19_239148_c1
1645 nmdc:mga08x19_29943_c1
1646 nmdc:mga08x19_340_c1
1647 nmdc:mga08x19_662171_c1
1648 nmdc:mga08x19_836264_c1
1649 nmdc:mga08x19_97895_c1
1650 nmdc:mga0a205_110158_c1
1651 nmdc:mga0a205_1385812_c1
1652 nmdc:mga0a205_186400_c1
1653 nmdc:mga0a205_191167_c1
1654 nmdc:mga0a205_24699_c1
1655 nmdc:mga0a205_525492_c1
1656 nmdc:mga0a205_55742_c1
1657 Ga0495601_0004400
1658 Ga0495601_0075085
1659 Ga0495601_0113928
1660 Ga0495601_0679745
1661 Ga0495595_0022038
1662 Ga0495595_0185223
1663 Ga0495619_0011548
1664 Ga0495619_0161256
1665 Ga0495619_0227124
1666 Ga0495619_0474916
1667 Ga0495619_0574388
1668 Ga0495619_0594336
1669 Ga0495619_0676642
1670 Ga0495619_0719248
1671 Ga0495619_0967646
1672 Ga0501084_0014484
1673 Ga0501084_0363614
1674 Ga0501082_0001496
1675 Ga0530510_0030055
1676 Ga0530510_1074600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20382

DUF6677

Family of unknown function (DUF6677)

15

132

0.95

Map