F482867
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 313 | 1672 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_101973227|Ga0070682_1019732271 |
| Length | 125 |
| Sequence | MGRPVRKGRINMASPVVHFEIRSEDPDATRAFFGDLFGWTYPEGAFPGYSYVETGAQTIPGGIGPLQGGNEMVTFFVGVEDMDASLAAAKKLGGRVVQEPVGVPGVTFALIADPQGHVVGLAQQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 101 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 103 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 104 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 106 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 107 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 108 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.27 |
| Nodule | 0 |
| Rhizoplane | 14 |
| Rhizosphere | 83.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070682_101973227 | 3300005337 | Unclassified | 513 |
| 2 | rootH1_10158853 | 3300003316 | Bacteria | 1283 |
| 3 | JGI25404J52841_10020890 | 3300003659 | Bacteria | 1417 |
| 4 | Ga0065707_10657283 | 3300005295 | Bacteria | 660 |
| 5 | Ga0070658_10017013 | 3300005327 | Bacteria | 5819 |
| 6 | Ga0070658_10106611 | 3300005327 | Bacteria | 2318 |
| 7 | Ga0070683_100002777 | 3300005329 | Bacteria | 14001 |
| 8 | Ga0070683_100193780 | 3300005329 | Bacteria | 1930 |
| 9 | Ga0070683_100760310 | 3300005329 | Bacteria | 928 |
| 10 | Ga0070690_100051285 | 3300005330 | Bacteria | 2633 |
| 11 | Ga0070670_100555957 | 3300005331 | Bacteria | 1024 |
| 12 | Ga0068869_100499772 | 3300005334 | Bacteria | 1015 |
| 13 | Ga0068869_101643608 | 3300005334 | Unclassified | 572 |
| 14 | Ga0070666_10999097 | 3300005335 | Unclassified | 620 |
| 15 | Ga0070682_100034351 | 3300005337 | Bacteria | 3088 |
| 16 | Ga0070682_100209735 | 3300005337 | Bacteria | 1380 |
| 17 | Ga0070682_100735952 | 3300005337 | Unclassified | 794 |
| 18 | Ga0068868_100175630 | 3300005338 | Bacteria | 1775 |
| 19 | Ga0068868_100368288 | 3300005338 | Bacteria | 1234 |
| 20 | Ga0068868_100637676 | 3300005338 | Bacteria | 947 |
| 21 | Ga0068868_100705503 | 3300005338 | Bacteria | 903 |
| 22 | Ga0068868_100961134 | 3300005338 | Bacteria | 779 |
| 23 | Ga0068868_100966464 | 3300005338 | Bacteria | 777 |
| 24 | Ga0070660_100160486 | 3300005339 | Bacteria | 1811 |
| 25 | Ga0070660_101511170 | 3300005339 | Bacteria | 571 |
| 26 | Ga0070689_100161259 | 3300005340 | Bacteria | 1813 |
| 27 | Ga0070689_100661449 | 3300005340 | Bacteria | 909 |
| 28 | Ga0070691_10333176 | 3300005341 | Bacteria | 838 |
| 29 | Ga0070687_100039240 | 3300005343 | Bacteria | 2378 |
| 30 | Ga0070687_101137085 | 3300005343 | Bacteria | 573 |
| 31 | Ga0070661_100024614 | 3300005344 | Bacteria | 4319 |
| 32 | Ga0070661_100042198 | 3300005344 | Bacteria | 3329 |
| 33 | Ga0070692_10234971 | 3300005345 | Bacteria | 1090 |
| 34 | Ga0070692_10302861 | 3300005345 | Bacteria | 976 |
| 35 | Ga0070668_100183215 | 3300005347 | Bacteria | 1712 |
| 36 | Ga0070671_100097364 | 3300005355 | Bacteria | 2467 |
| 37 | Ga0070671_100804176 | 3300005355 | Unclassified | 819 |
| 38 | Ga0070671_101840212 | 3300005355 | Bacteria | 538 |
| 39 | Ga0070674_101273229 | 3300005356 | Unclassified | 655 |
| 40 | Ga0070673_100090049 | 3300005364 | Bacteria | 2506 |
| 41 | Ga0070688_100876388 | 3300005365 | Bacteria | 707 |
| 42 | Ga0070659_100128946 | 3300005366 | Bacteria | 2053 |
| 43 | Ga0070659_100132079 | 3300005366 | Bacteria | 2028 |
| 44 | Ga0070667_100319123 | 3300005367 | Bacteria | 1402 |
| 45 | Ga0070667_100989544 | 3300005367 | Unclassified | 784 |
| 46 | Ga0070667_101320605 | 3300005367 | Bacteria | 676 |
| 47 | Ga0070667_101568585 | 3300005367 | Bacteria | 619 |
| 48 | Ga0070667_101909367 | 3300005367 | Bacteria | 559 |
| 49 | Ga0070703_10019810 | 3300005406 | Bacteria | 1953 |
| 50 | Ga0070709_10283712 | 3300005434 | Bacteria | 1204 |
| 51 | Ga0070709_10378020 | 3300005434 | Unclassified | 1052 |
| 52 | Ga0070714_100235461 | 3300005435 | Bacteria | 1688 |
| 53 | Ga0070713_102395072 | 3300005436 | Unclassified | 510 |
| 54 | Ga0070710_10335661 | 3300005437 | Bacteria | 996 |
| 55 | Ga0070710_10694668 | 3300005437 | Bacteria | 717 |
| 56 | Ga0070710_10769581 | 3300005437 | Bacteria | 685 |
| 57 | Ga0070701_10125107 | 3300005438 | Bacteria | 1454 |
| 58 | Ga0070711_100538183 | 3300005439 | Unclassified | 967 |
| 59 | Ga0070711_100668055 | 3300005439 | Bacteria | 872 |
| 60 | Ga0070711_100689172 | 3300005439 | Unclassified | 859 |
| 61 | Ga0070705_100028447 | 3300005440 | Unclassified | 3061 |
| 62 | Ga0070705_100423069 | 3300005440 | Bacteria | 992 |
| 63 | Ga0070700_100169265 | 3300005441 | Bacteria | 1512 |
| 64 | Ga0070694_100054366 | 3300005444 | Bacteria | 2712 |
| 65 | Ga0070708_100560614 | 3300005445 | Unclassified | 1077 |
| 66 | Ga0070708_101135067 | 3300005445 | Unclassified | 732 |
| 67 | Ga0070663_100473643 | 3300005455 | Bacteria | 1036 |
| 68 | Ga0070678_100204928 | 3300005456 | Bacteria | 1630 |
| 69 | Ga0070678_102407749 | 3300005456 | Bacteria | 500 |
| 70 | Ga0070662_100405564 | 3300005457 | Bacteria | 1126 |
| 71 | Ga0070681_10198546 | 3300005458 | Bacteria | 1924 |
| 72 | Ga0070681_10457842 | 3300005458 | Bacteria | 1188 |
| 73 | Ga0070681_10655181 | 3300005458 | Unclassified | 965 |
| 74 | Ga0068867_100559395 | 3300005459 | Bacteria | 992 |
| 75 | Ga0070685_10143721 | 3300005466 | Bacteria | 1505 |
| 76 | Ga0070685_11371272 | 3300005466 | Unclassified | 542 |
| 77 | Ga0070706_100411672 | 3300005467 | Bacteria | 1259 |
| 78 | Ga0070706_100959045 | 3300005467 | Unclassified | 789 |
| 79 | Ga0070707_100199949 | 3300005468 | Bacteria | 1948 |
| 80 | Ga0070698_100212619 | 3300005471 | Bacteria | 1868 |
| 81 | Ga0070698_100604634 | 3300005471 | Bacteria | 1037 |
| 82 | Ga0070679_100077935 | 3300005530 | Bacteria | 3303 |
| 83 | Ga0070679_100698957 | 3300005530 | Unclassified | 957 |
| 84 | Ga0070684_100004109 | 3300005535 | Bacteria | 11007 |
| 85 | Ga0070684_100070363 | 3300005535 | Bacteria | 3079 |
| 86 | Ga0068853_100400470 | 3300005539 | Bacteria | 1284 |
| 87 | Ga0068853_100514534 | 3300005539 | Bacteria | 1131 |
| 88 | Ga0070672_101057179 | 3300005543 | Unclassified | 721 |
| 89 | Ga0070686_100117007 | 3300005544 | Bacteria | 1825 |
| 90 | Ga0070695_101154019 | 3300005545 | Bacteria | 636 |
| 91 | Ga0070696_100026859 | 3300005546 | Bacteria | 3918 |
| 92 | Ga0070696_100790664 | 3300005546 | Unclassified | 780 |
| 93 | Ga0070696_101328225 | 3300005546 | Bacteria | 611 |
| 94 | Ga0070693_100049318 | 3300005547 | Bacteria | 2401 |
| 95 | Ga0070665_100000454 | 3300005548 | Bacteria | 59667 |
| 96 | Ga0070665_100352612 | 3300005548 | Bacteria | 1477 |
| 97 | Ga0070704_100465046 | 3300005549 | Bacteria | 1092 |
| 98 | Ga0068855_100048549 | 3300005563 | Bacteria | 5009 |
| 99 | Ga0070664_100008592 | 3300005564 | Bacteria | 8263 |
| 100 | Ga0070664_100076583 | 3300005564 | Bacteria | 2875 |
| 101 | Ga0070664_102266846 | 3300005564 | Unclassified | 515 |
| 102 | Ga0068857_100050320 | 3300005577 | Bacteria | 3697 |
| 103 | Ga0068857_100087245 | 3300005577 | Bacteria | 2791 |
| 104 | Ga0068857_101988364 | 3300005577 | Bacteria | 570 |
| 105 | Ga0068854_100044673 | 3300005578 | Bacteria | 3146 |
| 106 | Ga0068856_100026056 | 3300005614 | Bacteria | 5702 |
| 107 | Ga0068856_100761888 | 3300005614 | Bacteria | 988 |
| 108 | Ga0070702_100021100 | 3300005615 | Bacteria | 3422 |
| 109 | Ga0070702_100044869 | 3300005615 | Bacteria | 2498 |
| 110 | Ga0070702_100605588 | 3300005615 | Bacteria | 822 |
| 111 | Ga0070702_100764115 | 3300005615 | Bacteria | 743 |
| 112 | Ga0070702_101397767 | 3300005615 | Bacteria | 572 |
| 113 | Ga0068852_100300499 | 3300005616 | Bacteria | 1553 |
| 114 | Ga0068852_100673686 | 3300005616 | Bacteria | 1043 |
| 115 | Ga0068859_100379305 | 3300005617 | Bacteria | 1509 |
| 116 | Ga0068859_102872236 | 3300005617 | Unclassified | 528 |
| 117 | Ga0068864_100008792 | 3300005618 | Bacteria | 8327 |
| 118 | Ga0068864_100034777 | 3300005618 | Bacteria | 4287 |
| 119 | Ga0068864_100368308 | 3300005618 | Bacteria | 1359 |
| 120 | Ga0068864_100483642 | 3300005618 | Bacteria | 1189 |
| 121 | Ga0068866_10044525 | 3300005718 | Bacteria | 2221 |
| 122 | Ga0068866_11429310 | 3300005718 | Unclassified | 506 |
| 123 | Ga0068861_100252382 | 3300005719 | Unclassified | 1506 |
| 124 | Ga0068861_100316319 | 3300005719 | Bacteria | 1358 |
| 125 | Ga0068861_100921594 | 3300005719 | Bacteria | 829 |
| 126 | Ga0068861_101894599 | 3300005719 | Bacteria | 593 |
| 127 | Ga0068851_10066951 | 3300005834 | Bacteria | 1851 |
| 128 | Ga0068870_10080129 | 3300005840 | Bacteria | 1803 |
| 129 | Ga0068863_100041626 | 3300005841 | Bacteria | 4369 |
| 130 | Ga0068858_100197110 | 3300005842 | Bacteria | 1903 |
| 131 | Ga0068858_100307555 | 3300005842 | Bacteria | 1513 |
| 132 | Ga0068860_100042001 | 3300005843 | Bacteria | 4369 |
| 133 | Ga0068860_100312123 | 3300005843 | Bacteria | 1542 |
| 134 | Ga0068860_100336634 | 3300005843 | Bacteria | 1483 |
| 135 | Ga0068862_100736240 | 3300005844 | Bacteria | 958 |
| 136 | Ga0081540_1000511 | 3300005983 | Bacteria | 38044 |
| 137 | Ga0081540_1295139 | 3300005983 | Bacteria | 558 |
| 138 | Ga0070717_10871629 | 3300006028 | Bacteria | 819 |
| 139 | Ga0075365_10011417 | 3300006038 | Bacteria | 5222 |
| 140 | Ga0075365_10025856 | 3300006038 | Bacteria | 3720 |
| 141 | Ga0075365_10031223 | 3300006038 | Bacteria | 3417 |
| 142 | Ga0075365_10087628 | 3300006038 | Bacteria | 2117 |
| 143 | Ga0075365_10147243 | 3300006038 | Bacteria | 1637 |
| 144 | Ga0075365_11169898 | 3300006038 | Bacteria | 541 |
| 145 | Ga0075363_100471937 | 3300006048 | Bacteria | 743 |
| 146 | Ga0075364_10064194 | 3300006051 | Bacteria | 2410 |
| 147 | Ga0075364_10510047 | 3300006051 | Bacteria | 822 |
| 148 | Ga0075432_10052081 | 3300006058 | Bacteria | 1446 |
| 149 | Ga0070715_10013333 | 3300006163 | Bacteria | 3016 |
| 150 | Ga0070715_10271235 | 3300006163 | Unclassified | 895 |
| 151 | Ga0070716_100134774 | 3300006173 | Bacteria | 1566 |
| 152 | Ga0070716_100314008 | 3300006173 | Unclassified | 1095 |
| 153 | Ga0070712_100395861 | 3300006175 | Unclassified | 1140 |
| 154 | Ga0070712_100690509 | 3300006175 | Unclassified | 869 |
| 155 | Ga0070712_100912665 | 3300006175 | Bacteria | 758 |
| 156 | Ga0097621_100156961 | 3300006237 | Bacteria | 1953 |
| 157 | Ga0068871_100257938 | 3300006358 | Bacteria | 1520 |
| 158 | Ga0068871_101856580 | 3300006358 | Unclassified | 572 |
| 159 | Ga0068871_102157574 | 3300006358 | Bacteria | 531 |
| 160 | Ga0075428_101124778 | 3300006844 | Unclassified | 829 |
| 161 | Ga0075434_100711685 | 3300006871 | Bacteria | 1021 |
| 162 | Ga0075434_101494250 | 3300006871 | Bacteria | 685 |
| 163 | Ga0068865_100309903 | 3300006881 | Bacteria | 1266 |
| 164 | Ga0068865_100375236 | 3300006881 | Bacteria | 1158 |
| 165 | Ga0075436_100265941 | 3300006914 | Unclassified | 1224 |
| 166 | Ga0075436_100836534 | 3300006914 | Bacteria | 687 |
| 167 | Ga0097620_100379294 | 3300006931 | Bacteria | 1509 |
| 168 | Ga0097620_102872544 | 3300006931 | Unclassified | 528 |
| 169 | Ga0105244_10215167 | 3300009036 | Bacteria | 903 |
| 170 | Ga0105245_10000507 | 3300009098 | Bacteria | 35762 |
| 171 | Ga0105245_10003390 | 3300009098 | Bacteria | 14272 |
| 172 | Ga0105245_10180198 | 3300009098 | Bacteria | 2018 |
| 173 | Ga0105245_10458120 | 3300009098 | Unclassified | 1285 |
| 174 | Ga0105245_10628436 | 3300009098 | Bacteria | 1102 |
| 175 | Ga0105245_11549452 | 3300009098 | Bacteria | 714 |
| 176 | Ga0105245_12709298 | 3300009098 | Bacteria | 549 |
| 177 | Ga0105247_10092010 | 3300009101 | Bacteria | 1927 |
| 178 | Ga0105247_10388421 | 3300009101 | Bacteria | 991 |
| 179 | Ga0105247_10461591 | 3300009101 | Bacteria | 918 |
| 180 | Ga0105247_11154540 | 3300009101 | Unclassified | 614 |
| 181 | Ga0105243_10066434 | 3300009148 | Bacteria | 2900 |
| 182 | Ga0105243_10113757 | 3300009148 | Bacteria | 2270 |
| 183 | Ga0105241_10409039 | 3300009174 | Bacteria | 1192 |
| 184 | Ga0105241_11500802 | 3300009174 | Bacteria | 649 |
| 185 | Ga0105242_10035942 | 3300009176 | Bacteria | 3972 |
| 186 | Ga0105242_10452914 | 3300009176 | Bacteria | 1210 |
| 187 | Ga0105242_10528375 | 3300009176 | Bacteria | 1127 |
| 188 | Ga0105242_10541896 | 3300009176 | Bacteria | 1114 |
| 189 | Ga0105242_10715277 | 3300009176 | Bacteria | 982 |
| 190 | Ga0105242_13269090 | 3300009176 | Unclassified | 504 |
| 191 | Ga0105248_10068019 | 3300009177 | Bacteria | 3999 |
| 192 | Ga0105248_10101079 | 3300009177 | Bacteria | 3250 |
| 193 | Ga0105248_10326803 | 3300009177 | Bacteria | 1727 |
| 194 | Ga0105237_10658689 | 3300009545 | Bacteria | 1054 |
| 195 | Ga0105237_11522722 | 3300009545 | Bacteria | 676 |
| 196 | Ga0105238_10125857 | 3300009551 | Bacteria | 2541 |
| 197 | Ga0105238_10269752 | 3300009551 | Bacteria | 1682 |
| 198 | Ga0105238_10742587 | 3300009551 | Unclassified | 995 |
| 199 | Ga0105238_10915319 | 3300009551 | Unclassified | 896 |
| 200 | Ga0105238_11364068 | 3300009551 | Bacteria | 736 |
| 201 | Ga0105249_10083011 | 3300009553 | Bacteria | 2982 |
| 202 | Ga0105249_10634891 | 3300009553 | Bacteria | 1125 |
| 203 | Ga0105249_11631544 | 3300009553 | Bacteria | 717 |
| 204 | Ga0105249_11897479 | 3300009553 | Bacteria | 668 |
| 205 | Ga0105239_10003323 | 3300010375 | Bacteria | 19789 |
| 206 | Ga0105239_11331788 | 3300010375 | Bacteria | 828 |
| 207 | Ga0105239_11356405 | 3300010375 | Bacteria | 821 |
| 208 | Ga0105239_11793038 | 3300010375 | Unclassified | 711 |
| 209 | Ga0105246_10002642 | 3300011119 | Bacteria | 10859 |
| 210 | Ga0105246_10248110 | 3300011119 | Bacteria | 1411 |
| 211 | Ga0157321_1007050 | 3300012487 | Bacteria | 782 |
| 212 | Ga0157329_1030771 | 3300012491 | Bacteria | 557 |
| 213 | Ga0157341_1034637 | 3300012494 | Unclassified | 561 |
| 214 | Ga0157319_1004395 | 3300012497 | Bacteria | 925 |
| 215 | Ga0157347_1024527 | 3300012502 | Bacteria | 725 |
| 216 | Ga0157342_1008070 | 3300012507 | Bacteria | 1035 |
| 217 | Ga0157315_1040902 | 3300012508 | Unclassified | 587 |
| 218 | Ga0157326_1031470 | 3300012513 | Unclassified | 705 |
| 219 | Ga0157338_1008470 | 3300012515 | Bacteria | 997 |
| 220 | Ga0157373_10811167 | 3300013100 | Unclassified | 690 |
| 221 | Ga0157371_10050824 | 3300013102 | Bacteria | 2946 |
| 222 | Ga0157370_10871986 | 3300013104 | Bacteria | 817 |
| 223 | Ga0157370_11830590 | 3300013104 | Unclassified | 545 |
| 224 | Ga0157369_10105011 | 3300013105 | Bacteria | 3007 |
| 225 | Ga0157369_10410743 | 3300013105 | Bacteria | 1404 |
| 226 | Ga0157369_10528344 | 3300013105 | Bacteria | 1220 |
| 227 | Ga0157369_10867312 | 3300013105 | Bacteria | 926 |
| 228 | Ga0157369_11878462 | 3300013105 | Bacteria | 608 |
| 229 | Ga0157369_11913527 | 3300013105 | Bacteria | 602 |
| 230 | Ga0157374_10840809 | 3300013296 | Bacteria | 934 |
| 231 | Ga0157374_11450350 | 3300013296 | Bacteria | 709 |
| 232 | Ga0163162_10052280 | 3300013306 | Bacteria | 4103 |
| 233 | Ga0163162_10167959 | 3300013306 | Bacteria | 2318 |
| 234 | Ga0163162_10767235 | 3300013306 | Bacteria | 1083 |
| 235 | Ga0163162_10832251 | 3300013306 | Bacteria | 1039 |
| 236 | Ga0163162_11627860 | 3300013306 | Unclassified | 737 |
| 237 | Ga0157372_10001454 | 3300013307 | Bacteria | 25656 |
| 238 | Ga0157372_10518031 | 3300013307 | Bacteria | 1390 |
| 239 | Ga0157372_11659274 | 3300013307 | Bacteria | 736 |
| 240 | Ga0157372_12297833 | 3300013307 | Unclassified | 619 |
| 241 | Ga0157372_13433854 | 3300013307 | Bacteria | 504 |
| 242 | Ga0157375_10023644 | 3300013308 | Bacteria | 5673 |
| 243 | Ga0157375_10050509 | 3300013308 | Bacteria | 4079 |
| 244 | Ga0157375_10763685 | 3300013308 | Bacteria | 1117 |
| 245 | Ga0157375_10923426 | 3300013308 | Unclassified | 1016 |
| 246 | Ga0157375_11034154 | 3300013308 | Unclassified | 960 |
| 247 | Ga0163163_10026127 | 3300014325 | Bacteria | 5576 |
| 248 | Ga0163163_10038578 | 3300014325 | Unclassified | 4657 |
| 249 | Ga0163163_10045078 | 3300014325 | Bacteria | 4328 |
| 250 | Ga0163163_10122930 | 3300014325 | Unclassified | 2630 |
| 251 | Ga0163163_10817832 | 3300014325 | Bacteria | 995 |
| 252 | Ga0163163_11145524 | 3300014325 | Bacteria | 840 |
| 253 | Ga0157377_10155318 | 3300014745 | Bacteria | 1418 |
| 254 | Ga0157377_10177223 | 3300014745 | Bacteria | 1338 |
| 255 | Ga0157379_10022699 | 3300014968 | Bacteria | 5561 |
| 256 | Ga0157376_10238908 | 3300014969 | Bacteria | 1692 |
| 257 | Ga0157376_10432794 | 3300014969 | Unclassified | 1279 |
| 258 | Ga0157376_10654969 | 3300014969 | Bacteria | 1051 |
| 259 | Ga0157376_11523544 | 3300014969 | Bacteria | 702 |
| 260 | Ga0163161_10129903 | 3300017792 | Bacteria | 1899 |
| 261 | Ga0163161_10445235 | 3300017792 | Bacteria | 1046 |
| 262 | Ga0206356_11334568 | 3300020070 | Bacteria | 1078 |
| 263 | Ga0206353_10987813 | 3300020082 | Bacteria | 1398 |
| 264 | Ga0206353_11910781 | 3300020082 | Bacteria | 1232 |
| 265 | Ga0207697_10449167 | 3300025315 | Unclassified | 571 |
| 266 | Ga0207656_10096879 | 3300025321 | Bacteria | 1347 |
| 267 | Ga0207713_1133944 | 3300025735 | Bacteria | 816 |
| 268 | Ga0207653_10004486 | 3300025885 | Bacteria | 4378 |
| 269 | Ga0207692_10479506 | 3300025898 | Bacteria | 787 |
| 270 | Ga0207642_10346712 | 3300025899 | Bacteria | 875 |
| 271 | Ga0207710_10222177 | 3300025900 | Bacteria | 938 |
| 272 | Ga0207688_10008202 | 3300025901 | Bacteria | 5676 |
| 273 | Ga0207688_10066926 | 3300025901 | Bacteria | 2033 |
| 274 | Ga0207688_10482074 | 3300025901 | Bacteria | 775 |
| 275 | Ga0207688_10672897 | 3300025901 | Bacteria | 654 |
| 276 | Ga0207680_10326895 | 3300025903 | Bacteria | 1073 |
| 277 | Ga0207647_10064422 | 3300025904 | Unclassified | 2227 |
| 278 | Ga0207685_10012045 | 3300025905 | Bacteria | 2626 |
| 279 | Ga0207699_10134705 | 3300025906 | Bacteria | 1616 |
| 280 | Ga0207699_10429996 | 3300025906 | Unclassified | 944 |
| 281 | Ga0207699_10864917 | 3300025906 | Unclassified | 666 |
| 282 | Ga0207645_10506588 | 3300025907 | Bacteria | 818 |
| 283 | Ga0207643_10010619 | 3300025908 | Bacteria | 4962 |
| 284 | Ga0207705_10756903 | 3300025909 | Bacteria | 755 |
| 285 | Ga0207705_10870355 | 3300025909 | Unclassified | 698 |
| 286 | Ga0207684_10499489 | 3300025910 | Unclassified | 1043 |
| 287 | Ga0207684_10501376 | 3300025910 | Unclassified | 1040 |
| 288 | Ga0207707_10259122 | 3300025912 | Bacteria | 1509 |
| 289 | Ga0207707_10384219 | 3300025912 | Bacteria | 1207 |
| 290 | Ga0207707_10683852 | 3300025912 | Bacteria | 863 |
| 291 | Ga0207695_10180348 | 3300025913 | Bacteria | 2033 |
| 292 | Ga0207693_10075020 | 3300025915 | Bacteria | 2648 |
| 293 | Ga0207693_10401995 | 3300025915 | Unclassified | 1071 |
| 294 | Ga0207663_10304935 | 3300025916 | Unclassified | 1191 |
| 295 | Ga0207663_10359577 | 3300025916 | Bacteria | 1104 |
| 296 | Ga0207663_10627798 | 3300025916 | Bacteria | 846 |
| 297 | Ga0207662_10017649 | 3300025918 | Bacteria | 4039 |
| 298 | Ga0207662_10109933 | 3300025918 | Bacteria | 1717 |
| 299 | Ga0207662_11282698 | 3300025918 | Bacteria | 520 |
| 300 | Ga0207657_10041435 | 3300025919 | Bacteria | 4072 |
| 301 | Ga0207649_10248589 | 3300025920 | Bacteria | 1280 |
| 302 | Ga0207652_10244952 | 3300025921 | Bacteria | 1616 |
| 303 | Ga0207646_11119264 | 3300025922 | Bacteria | 692 |
| 304 | Ga0207694_10316871 | 3300025924 | Bacteria | 1286 |
| 305 | Ga0207694_10930675 | 3300025924 | Unclassified | 735 |
| 306 | Ga0207687_10023515 | 3300025927 | Bacteria | 4109 |
| 307 | Ga0207687_10111018 | 3300025927 | Bacteria | 2035 |
| 308 | Ga0207687_10971060 | 3300025927 | Bacteria | 728 |
| 309 | Ga0207700_10019697 | 3300025928 | Bacteria | 4562 |
| 310 | Ga0207700_10136131 | 3300025928 | Bacteria | 2012 |
| 311 | Ga0207700_11533811 | 3300025928 | Unclassified | 591 |
| 312 | Ga0207664_10006036 | 3300025929 | Bacteria | 8295 |
| 313 | Ga0207664_10298236 | 3300025929 | Bacteria | 1417 |
| 314 | Ga0207664_10584366 | 3300025929 | Bacteria | 1003 |
| 315 | Ga0207644_10513359 | 3300025931 | Bacteria | 989 |
| 316 | Ga0207644_10757572 | 3300025931 | Bacteria | 811 |
| 317 | Ga0207690_10115881 | 3300025932 | Bacteria | 1937 |
| 318 | Ga0207690_10120595 | 3300025932 | Bacteria | 1904 |
| 319 | Ga0207706_10044432 | 3300025933 | Bacteria | 3937 |
| 320 | Ga0207706_10193729 | 3300025933 | Bacteria | 1783 |
| 321 | Ga0207686_10490592 | 3300025934 | Bacteria | 951 |
| 322 | Ga0207686_10787646 | 3300025934 | Bacteria | 761 |
| 323 | Ga0207709_10081727 | 3300025935 | Bacteria | 2084 |
| 324 | Ga0207709_10270770 | 3300025935 | Bacteria | 1250 |
| 325 | Ga0207709_10929046 | 3300025935 | Unclassified | 708 |
| 326 | Ga0207669_10401747 | 3300025937 | Unclassified | 1074 |
| 327 | Ga0207669_10740505 | 3300025937 | Bacteria | 811 |
| 328 | Ga0207669_11229800 | 3300025937 | Unclassified | 635 |
| 329 | Ga0207704_10036924 | 3300025938 | Bacteria | 2816 |
| 330 | Ga0207704_11430150 | 3300025938 | Bacteria | 593 |
| 331 | Ga0207665_10011778 | 3300025939 | Bacteria | 5748 |
| 332 | Ga0207711_10372316 | 3300025941 | Unclassified | 1325 |
| 333 | Ga0207711_10901137 | 3300025941 | Bacteria | 822 |
| 334 | Ga0207689_10479299 | 3300025942 | Bacteria | 1041 |
| 335 | Ga0207689_11121737 | 3300025942 | Unclassified | 663 |
| 336 | Ga0207661_10030249 | 3300025944 | Bacteria | 4169 |
| 337 | Ga0207661_10035726 | 3300025944 | Bacteria | 3875 |
| 338 | Ga0207661_10102164 | 3300025944 | Bacteria | 2410 |
| 339 | Ga0207661_10730888 | 3300025944 | Bacteria | 911 |
| 340 | Ga0207667_10650611 | 3300025949 | Bacteria | 1059 |
| 341 | Ga0207667_11469205 | 3300025949 | Bacteria | 653 |
| 342 | Ga0207651_10099613 | 3300025960 | Bacteria | 2153 |
| 343 | Ga0207712_10118944 | 3300025961 | Bacteria | 1995 |
| 344 | Ga0207668_10289040 | 3300025972 | Bacteria | 1348 |
| 345 | Ga0207658_10103451 | 3300025986 | Bacteria | 2236 |
| 346 | Ga0207658_10851416 | 3300025986 | Unclassified | 829 |
| 347 | Ga0207677_10138864 | 3300026023 | Bacteria | 1857 |
| 348 | Ga0207677_10552365 | 3300026023 | Bacteria | 1004 |
| 349 | Ga0207677_10718101 | 3300026023 | Bacteria | 888 |
| 350 | Ga0207703_10027357 | 3300026035 | Bacteria | 4491 |
| 351 | Ga0207639_10022237 | 3300026041 | Bacteria | 4565 |
| 352 | Ga0207639_10081429 | 3300026041 | Bacteria | 2564 |
| 353 | Ga0207678_10006761 | 3300026067 | Bacteria | 10170 |
| 354 | Ga0207708_10147472 | 3300026075 | Bacteria | 1850 |
| 355 | Ga0207702_10143150 | 3300026078 | Bacteria | 2166 |
| 356 | Ga0207702_10294748 | 3300026078 | Bacteria | 1538 |
| 357 | Ga0207702_10367667 | 3300026078 | Bacteria | 1380 |
| 358 | Ga0207702_10454039 | 3300026078 | Bacteria | 1244 |
| 359 | Ga0207702_11402060 | 3300026078 | Unclassified | 692 |
| 360 | Ga0207641_10064133 | 3300026088 | Bacteria | 3139 |
| 361 | Ga0207648_12012055 | 3300026089 | Bacteria | 539 |
| 362 | Ga0207676_10725502 | 3300026095 | Bacteria | 965 |
| 363 | Ga0207674_10013926 | 3300026116 | Bacteria | 8897 |
| 364 | Ga0207674_10029558 | 3300026116 | Bacteria | 5769 |
| 365 | Ga0207675_100011145 | 3300026118 | Bacteria | 8420 |
| 366 | Ga0207675_100504087 | 3300026118 | Bacteria | 1205 |
| 367 | Ga0207675_100790741 | 3300026118 | Bacteria | 962 |
| 368 | Ga0207683_10042923 | 3300026121 | Bacteria | 3949 |
| 369 | Ga0207683_11419244 | 3300026121 | Bacteria | 642 |
| 370 | Ga0207683_11794931 | 3300026121 | Unclassified | 562 |
| 371 | Ga0207698_10610869 | 3300026142 | Bacteria | 1076 |
| 372 | Ga0268266_10002426 | 3300028379 | Bacteria | 20068 |
| 373 | Ga0268266_10987103 | 3300028379 | Bacteria | 815 |
| 374 | Ga0268265_10342554 | 3300028380 | Bacteria | 1362 |
| 375 | Ga0268265_10606665 | 3300028380 | Bacteria | 1047 |
| 376 | Ga0268265_11347412 | 3300028380 | Bacteria | 715 |
| 377 | Ga0268264_10046222 | 3300028381 | Bacteria | 3615 |
| 378 | Ga0268264_10305489 | 3300028381 | Bacteria | 1499 |
| 379 | Ga0265336_10003154 | 3300028666 | Bacteria | 6560 |
| 380 | Ga0265338_10013289 | 3300028800 | Bacteria | 9309 |
| 381 | Ga0265328_10169373 | 3300031239 | Bacteria | 825 |
| 382 | Ga0265316_10191250 | 3300031344 | Bacteria | 1520 |
| 383 | Ga0307405_10000521 | 3300031731 | Bacteria | 14517 |
| 384 | Ga0307413_10278852 | 3300031824 | Bacteria | 1256 |
| 385 | Ga0307406_10410633 | 3300031901 | Unclassified | 1076 |
| 386 | Ga0307407_10004634 | 3300031903 | Bacteria | 5866 |
| 387 | Ga0307409_100002261 | 3300031995 | Bacteria | 9966 |
| 388 | Ga0307415_100000320 | 3300032126 | Bacteria | 20808 |
| 389 | Ga0373950_0098097 | 3300034818 | Unclassified | 629 |
| 390 | Ga0373959_0138781 | 3300034820 | Bacteria | 607 |
| 391 | Ga0373938_0208901 | 3300034957 | Unclassified | 544 |
| 392 | Ga0373926_0000166 | 3300035083 | Bacteria | 14543 |
| 393 | Ga0373926_0144176 | 3300035083 | Bacteria | 905 |
| 394 | Ga0373929_0170024 | 3300035085 | Unclassified | 595 |
| 395 | Ga0373934_0019215 | 3300035086 | Bacteria | 2621 |
| 396 | Ga0373934_0026766 | 3300035086 | Bacteria | 2237 |
| 397 | Ga0373934_0043382 | 3300035086 | Bacteria | 1777 |
| 398 | Ga0373934_0090305 | 3300035086 | Bacteria | 1234 |
| 399 | Ga0373940_0140728 | 3300035088 | Bacteria | 763 |
| 400 | Ga0373944_0000832 | 3300035089 | Bacteria | 7580 |
| 401 | Ga0373944_0266316 | 3300035089 | Bacteria | 636 |
| 402 | Ga0373949_0070805 | 3300035090 | Unclassified | 913 |
| 403 | Ga0373951_0013761 | 3300035091 | Bacteria | 1818 |
| 404 | Ga0373952_0030402 | 3300035092 | Bacteria | 1196 |
| 405 | Ga0373923_0015161 | 3300035111 | Bacteria | 2906 |
| 406 | Ga0373923_0065268 | 3300035111 | Bacteria | 1553 |
| 407 | Ga0373932_0018462 | 3300035112 | Bacteria | 1804 |
| 408 | Ga0373932_0308192 | 3300035112 | Unclassified | 592 |
| 409 | Ga0373936_0000370 | 3300035113 | Bacteria | 15234 |
| 410 | Ga0373936_0002034 | 3300035113 | Bacteria | 7484 |
| 411 | Ga0373941_0068059 | 3300035115 | Bacteria | 1175 |
| 412 | Ga0373945_0000457 | 3300035116 | Bacteria | 11510 |
| 413 | Ga0373945_0037511 | 3300035116 | Bacteria | 1740 |
| 414 | Ga0373953_0000247 | 3300035117 | Bacteria | 14687 |
| 415 | Ga0373953_0010251 | 3300035117 | Bacteria | 3253 |
| 416 | Ga0373953_0024201 | 3300035117 | Bacteria | 2307 |
| 417 | Ga0373953_0059604 | 3300035117 | Bacteria | 1558 |
| 418 | Ga0373953_0303088 | 3300035117 | Bacteria | 697 |
| 419 | Ga0373954_0009828 | 3300035118 | Bacteria | 4210 |
| 420 | Ga0373954_0045688 | 3300035118 | Bacteria | 2046 |
| 421 | Ga0373954_0219507 | 3300035118 | Bacteria | 935 |
| 422 | Ga0373954_0352807 | 3300035118 | Bacteria | 726 |
| 423 | Ga0373954_0671405 | 3300035118 | Bacteria | 514 |
| 424 | Ga0373956_0002403 | 3300035119 | Bacteria | 7642 |
| 425 | Ga0373956_0009246 | 3300035119 | Bacteria | 4001 |
| 426 | Ga0373956_0012780 | 3300035119 | Bacteria | 3485 |
| 427 | Ga0373956_0046501 | 3300035119 | Bacteria | 1939 |
| 428 | Ga0373957_0000304 | 3300035120 | Bacteria | 12323 |
| 429 | Ga0373957_0000360 | 3300035120 | Bacteria | 11609 |
| 430 | Ga0373957_0109859 | 3300035120 | Bacteria | 1110 |
| 431 | Ga0373957_0119187 | 3300035120 | Bacteria | 1067 |
| 432 | Ga0373957_0159997 | 3300035120 | Bacteria | 927 |
| 433 | Ga0373957_0334606 | 3300035120 | Bacteria | 645 |
| 434 | Ga0373960_0109282 | 3300035121 | Unclassified | 905 |
| 435 | Ga0373943_0000067 | 3300035170 | Bacteria | 36676 |
| 436 | Ga0373943_0023869 | 3300035170 | Plasmid | 2847 |
| 437 | Ga0373946_0000440 | 3300035171 | Bacteria | 13618 |
| 438 | Ga0373946_0024508 | 3300035171 | Bacteria | 2365 |
| 439 | Ga0373955_0016960 | 3300035172 | Bacteria | 3592 |
| 440 | Ga0373955_0044551 | 3300035172 | Bacteria | 2390 |
| 441 | Ga0373955_0195523 | 3300035172 | Bacteria | 1203 |
| 442 | Ga0373955_0474892 | 3300035172 | Bacteria | 763 |
| 443 | Ga0373942_0105845 | 3300035207 | Unclassified | 865 |
| 444 | Ga0373942_0377515 | 3300035207 | Bacteria | 505 |
| 445 | Ga0373961_0210240 | 3300035241 | Bacteria | 690 |
| 446 | Ga0373961_0400329 | 3300035241 | Unclassified | 527 |
| 447 | Ga0373924_0000135 | 3300035410 | Bacteria | 21359 |
| 448 | Ga0373924_0000415 | 3300035410 | Bacteria | 13089 |
| 449 | Ga0373924_0001322 | 3300035410 | Bacteria | 7976 |
| 450 | Ga0373924_0043596 | 3300035410 | Bacteria | 1843 |
| 451 | Ga0373931_0051796 | 3300035691 | Bacteria | 2187 |
| 452 | Ga0373931_0147990 | 3300035691 | Bacteria | 1366 |
| 453 | Ga0373931_1260198 | 3300035691 | Bacteria | 508 |
| 454 | Ga0373935_0031649 | 3300035692 | Bacteria | 3284 |
| 455 | Ga0373935_0637472 | 3300035692 | Bacteria | 781 |
| 456 | Ga0373927_0001544 | 3300035695 | Bacteria | 17283 |
| 457 | Ga0373927_0173696 | 3300035695 | Bacteria | 1413 |
| 458 | Ga0373927_0904243 | 3300035695 | Bacteria | 583 |
| 459 | Ga0373933_0000003 | 3300035724 | Bacteria | 150420 |
| 460 | Ga0373933_0065897 | 3300035724 | Bacteria | 2193 |
| 461 | Ga0373933_0109663 | 3300035724 | Bacteria | 1720 |
| 462 | Ga0373933_1059056 | 3300035724 | Bacteria | 534 |
| 463 | Ga0373933_1091139 | 3300035724 | Bacteria | 526 |
| 464 | Ga0373947_0007085 | 3300035725 | Bacteria | 6498 |
| 465 | Ga0373947_0079368 | 3300035725 | Bacteria | 2028 |
| 466 | Ga0373947_0321073 | 3300035725 | Bacteria | 1035 |
| 467 | Ga0373947_0383648 | 3300035725 | Bacteria | 946 |
| 468 | Ga0373937_0000016 | 3300036401 | Bacteria | 145523 |
| 469 | Ga0373937_0002125 | 3300036401 | Bacteria | 16562 |
| 470 | Ga0373937_0090703 | 3300036401 | Bacteria | 2830 |
| 471 | Ga0373937_0135144 | 3300036401 | Bacteria | 2305 |
| 472 | Ga0373937_0205630 | 3300036401 | Bacteria | 1851 |
| 473 | Ga0373925_0007534 | 3300037068 | Bacteria | 7936 |
| 474 | Ga0373925_0015037 | 3300037068 | Bacteria | 5594 |
| 475 | Ga0373925_0029048 | 3300037068 | Bacteria | 4055 |
| 476 | Ga0373925_0102584 | 3300037068 | Bacteria | 2201 |
| 477 | Ga0451789_0881630 | 3300041443 | Bacteria | 820 |
| 478 | Ga0451804_0805710 | 3300041463 | Bacteria | 569 |
| 479 | Ga0451849_0698324 | 3300041505 | Bacteria | 516 |
| 480 | Ga0451853_1874758 | 3300041512 | Bacteria | 1592 |
| 481 | Ga0451853_2678561 | 3300041512 | Bacteria | 680 |
| 482 | Ga0451853_2682677 | 3300041512 | Bacteria | 1013 |
| 483 | Ga0451577_0358532 | 3300042876 | Unclassified | 1323 |
| 484 | Ga0466963_0244432 | 3300044694 | Unclassified | 1259 |
| 485 | Ga0451576_0264268 | 3300045051 | Bacteria | 1799 |
| 486 | Ga0495592_0000116 | 3300046454 | Bacteria | 70091 |
| 487 | Ga0495592_0015971 | 3300046454 | Bacteria | 5696 |
| 488 | Ga0495592_0054550 | 3300046454 | Bacteria | 2961 |
| 489 | Ga0495592_0232250 | 3300046454 | Bacteria | 1227 |
| 490 | Ga0495592_0391860 | 3300046454 | Bacteria | 882 |
| 491 | Ga0495592_0529405 | 3300046454 | Bacteria | 727 |
| 492 | Ga0495603_0001523 | 3300046455 | Bacteria | 13527 |
| 493 | Ga0495603_0045820 | 3300046455 | Bacteria | 2607 |
| 494 | Ga0495629_0003493 | 3300046459 | Bacteria | 11888 |
| 495 | Ga0495629_0064070 | 3300046459 | Bacteria | 2566 |
| 496 | Ga0495629_0169881 | 3300046459 | Bacteria | 1513 |
| 497 | Ga0495629_0365901 | 3300046459 | Bacteria | 982 |
| 498 | Ga0495641_0003782 | 3300046461 | Bacteria | 11100 |
| 499 | Ga0495641_0007807 | 3300046461 | Bacteria | 6623 |
| 500 | Ga0495641_0008033 | 3300046461 | Bacteria | 6495 |
| 501 | Ga0495641_0062768 | 3300046461 | Bacteria | 1675 |
| 502 | Ga0495641_0165956 | 3300046461 | Bacteria | 988 |
| 503 | Ga0495641_0184160 | 3300046461 | Bacteria | 935 |
| 504 | Ga0495651_0000009 | 3300046462 | Bacteria | 150455 |
| 505 | Ga0495651_0009543 | 3300046462 | Bacteria | 7455 |
| 506 | Ga0495651_0039359 | 3300046462 | Bacteria | 3681 |
| 507 | Ga0495651_0060369 | 3300046462 | Bacteria | 2904 |
| 508 | Ga0495651_0113575 | 3300046462 | Bacteria | 1999 |
| 509 | Ga0495653_0001057 | 3300046463 | Bacteria | 21196 |
| 510 | Ga0495653_0024626 | 3300046463 | Bacteria | 4846 |
| 511 | Ga0495653_0173953 | 3300046463 | Bacteria | 1483 |
| 512 | Ga0495653_0877904 | 3300046463 | Unclassified | 535 |
| 513 | Ga0495653_0908170 | 3300046463 | Bacteria | 524 |
| 514 | Ga0495580_0035745 | 3300046472 | Bacteria | 3571 |
| 515 | Ga0495580_0089073 | 3300046472 | Bacteria | 2148 |
| 516 | Ga0495582_0000375 | 3300046473 | Bacteria | 24407 |
| 517 | Ga0495582_0002790 | 3300046473 | Bacteria | 9756 |
| 518 | Ga0495582_0142355 | 3300046473 | Bacteria | 1359 |
| 519 | Ga0495582_0316946 | 3300046473 | Bacteria | 897 |
| 520 | Ga0495582_0395227 | 3300046473 | Bacteria | 797 |
| 521 | Ga0495639_0000548 | 3300046475 | Bacteria | 17449 |
| 522 | Ga0495639_0040452 | 3300046475 | Bacteria | 2097 |
| 523 | Ga0495639_0305244 | 3300046475 | Unclassified | 794 |
| 524 | Ga0495639_0342680 | 3300046475 | Bacteria | 749 |
| 525 | Ga0495662_0004647 | 3300046476 | Bacteria | 6891 |
| 526 | Ga0495662_0007763 | 3300046476 | Bacteria | 5283 |
| 527 | Ga0495662_0018685 | 3300046476 | Bacteria | 3356 |
| 528 | Ga0495664_0004540 | 3300046477 | Bacteria | 7594 |
| 529 | Ga0495664_0007915 | 3300046477 | Bacteria | 5916 |
| 530 | Ga0495594_0136825 | 3300046499 | Bacteria | 1389 |
| 531 | Ga0495594_0171907 | 3300046499 | Bacteria | 1233 |
| 532 | Ga0495608_0000019 | 3300046511 | Bacteria | 180119 |
| 533 | Ga0495608_0015096 | 3300046511 | Bacteria | 5358 |
| 534 | Ga0495608_0035914 | 3300046511 | Bacteria | 3338 |
| 535 | Ga0495608_0378966 | 3300046511 | Bacteria | 867 |
| 536 | Ga0495608_0396924 | 3300046511 | Unclassified | 844 |
| 537 | Ga0495608_0897605 | 3300046511 | Bacteria | 519 |
| 538 | Ga0495618_0001073 | 3300046514 | Bacteria | 18665 |
| 539 | Ga0495618_0410798 | 3300046514 | Bacteria | 826 |
| 540 | Ga0495628_0000487 | 3300046516 | Bacteria | 36399 |
| 541 | Ga0495628_0178455 | 3300046516 | Bacteria | 1607 |
| 542 | Ga0495628_0241658 | 3300046516 | Bacteria | 1350 |
| 543 | Ga0495628_0313640 | 3300046516 | Bacteria | 1158 |
| 544 | Ga0495628_0512736 | 3300046516 | Bacteria | 865 |
| 545 | Ga0495630_0004836 | 3300046517 | Bacteria | 9447 |
| 546 | Ga0495630_0044423 | 3300046517 | Bacteria | 3320 |
| 547 | Ga0495630_0049458 | 3300046517 | Bacteria | 3146 |
| 548 | Ga0495666_0025075 | 3300046526 | Bacteria | 2946 |
| 549 | Ga0495666_0141735 | 3300046526 | Bacteria | 1120 |
| 550 | Ga0495652_0000430 | 3300046529 | Bacteria | 49080 |
| 551 | Ga0495652_0035590 | 3300046529 | Bacteria | 4333 |
| 552 | Ga0495652_0037892 | 3300046529 | Bacteria | 4180 |
| 553 | Ga0495652_0306386 | 3300046529 | Bacteria | 1152 |
| 554 | Ga0495652_0373095 | 3300046529 | Bacteria | 1016 |
| 555 | Ga0495652_0713384 | 3300046529 | Bacteria | 674 |
| 556 | Ga0495665_0000236 | 3300046531 | Bacteria | 27659 |
| 557 | Ga0495665_0008820 | 3300046531 | Bacteria | 5473 |
| 558 | Ga0495665_0041157 | 3300046531 | Bacteria | 2459 |
| 559 | Ga0495640_0008891 | 3300046533 | Bacteria | 7846 |
| 560 | Ga0495640_0017655 | 3300046533 | Bacteria | 5311 |
| 561 | Ga0495640_0022194 | 3300046533 | Bacteria | 4644 |
| 562 | Ga0495640_0568740 | 3300046533 | Bacteria | 686 |
| 563 | Ga0495586_0008635 | 3300046535 | Bacteria | 5423 |
| 564 | Ga0495587_0000041 | 3300046536 | Bacteria | 110168 |
| 565 | Ga0495587_0080415 | 3300046536 | Bacteria | 1889 |
| 566 | Ga0495587_0138878 | 3300046536 | Bacteria | 1387 |
| 567 | Ga0495587_0218624 | 3300046536 | Bacteria | 1075 |
| 568 | Ga0495587_0376772 | 3300046536 | Bacteria | 789 |
| 569 | Ga0495645_0029423 | 3300046543 | Bacteria | 3994 |
| 570 | Ga0495645_0110029 | 3300046543 | Bacteria | 1950 |
| 571 | Ga0495645_0176939 | 3300046543 | Bacteria | 1465 |
| 572 | Ga0495645_0471893 | 3300046543 | Bacteria | 788 |
| 573 | Ga0495645_0493386 | 3300046543 | Bacteria | 766 |
| 574 | Ga0495622_0061572 | 3300046557 | Bacteria | 1737 |
| 575 | Ga0495667_0000037 | 3300046559 | Bacteria | 133780 |
| 576 | Ga0495667_0000557 | 3300046559 | Bacteria | 23816 |
| 577 | Ga0495667_0005966 | 3300046559 | Bacteria | 8237 |
| 578 | Ga0495667_0032678 | 3300046559 | Bacteria | 3485 |
| 579 | Ga0495667_0216908 | 3300046559 | Bacteria | 1222 |
| 580 | Ga0495667_0448152 | 3300046559 | Bacteria | 811 |
| 581 | Ga0495656_0448327 | 3300046615 | Bacteria | 680 |
| 582 | Ga0495634_0003394 | 3300046642 | Bacteria | 12784 |
| 583 | Ga0495634_0020321 | 3300046642 | Bacteria | 4711 |
| 584 | Ga0495634_0034577 | 3300046642 | Bacteria | 3467 |
| 585 | Ga0495634_0166102 | 3300046642 | Bacteria | 1389 |
| 586 | Ga0495635_0010520 | 3300046663 | Bacteria | 6476 |
| 587 | Ga0495635_0024939 | 3300046663 | Bacteria | 4166 |
| 588 | Ga0495635_0046089 | 3300046663 | Bacteria | 3007 |
| 589 | Ga0495588_0211382 | 3300046674 | Unclassified | 1024 |
| 590 | Ga0495657_0000094 | 3300046675 | Bacteria | 78779 |
| 591 | Ga0495657_0006691 | 3300046675 | Bacteria | 8996 |
| 592 | Ga0495657_0012007 | 3300046675 | Bacteria | 6448 |
| 593 | Ga0495657_0018831 | 3300046675 | Bacteria | 4990 |
| 594 | Ga0495657_0227015 | 3300046675 | Bacteria | 1130 |
| 595 | Ga0495657_0454480 | 3300046675 | Unclassified | 750 |
| 596 | Ga0495599_0000040 | 3300046678 | Bacteria | 97423 |
| 597 | Ga0495599_0028865 | 3300046678 | Bacteria | 3476 |
| 598 | Ga0495599_0139720 | 3300046678 | Bacteria | 1503 |
| 599 | Ga0495599_0243266 | 3300046678 | Bacteria | 1096 |
| 600 | Ga0495599_0305225 | 3300046678 | Unclassified | 960 |
| 601 | Ga0495599_0603583 | 3300046678 | Unclassified | 639 |
| 602 | Ga0495623_0000284 | 3300046679 | Bacteria | 32990 |
| 603 | Ga0495623_0017741 | 3300046679 | Bacteria | 4597 |
| 604 | Ga0495623_0091013 | 3300046679 | Bacteria | 1872 |
| 605 | Ga0495623_0220134 | 3300046679 | Bacteria | 1082 |
| 606 | Ga0495646_0006814 | 3300046680 | Bacteria | 7251 |
| 607 | Ga0495646_0016988 | 3300046680 | Bacteria | 4620 |
| 608 | Ga0495646_0141043 | 3300046680 | Bacteria | 1347 |
| 609 | Ga0495646_0228716 | 3300046680 | Bacteria | 1003 |
| 610 | Ga0495647_0003459 | 3300046681 | Bacteria | 5050 |
| 611 | Ga0495647_0038703 | 3300046681 | Bacteria | 1804 |
| 612 | Ga0495658_0004141 | 3300046683 | Bacteria | 7144 |
| 613 | Ga0495658_0047633 | 3300046683 | Bacteria | 2414 |
| 614 | Ga0495658_0079721 | 3300046683 | Bacteria | 1919 |
| 615 | Ga0495658_0260449 | 3300046683 | Unclassified | 1092 |
| 616 | Ga0495658_0375546 | 3300046683 | Bacteria | 905 |
| 617 | Ga0495613_0003464 | 3300046689 | Bacteria | 11801 |
| 618 | Ga0495613_0016362 | 3300046689 | Bacteria | 5526 |
| 619 | Ga0495613_0048337 | 3300046689 | Bacteria | 3141 |
| 620 | Ga0495613_0131034 | 3300046689 | Bacteria | 1796 |
| 621 | Ga0495624_0007166 | 3300046690 | Bacteria | 7848 |
| 622 | Ga0495624_0009694 | 3300046690 | Bacteria | 6666 |
| 623 | Ga0495624_0022917 | 3300046690 | Bacteria | 4120 |
| 624 | Ga0495624_0200386 | 3300046690 | Unclassified | 1213 |
| 625 | Ga0495600_0002749 | 3300046809 | Bacteria | 10193 |
| 626 | Ga0495600_0003484 | 3300046809 | Bacteria | 9248 |
| 627 | Ga0495600_0012423 | 3300046809 | Bacteria | 5324 |
| 628 | Ga0495600_0074799 | 3300046809 | Bacteria | 2212 |
| 629 | Ga0495600_0108435 | 3300046809 | Bacteria | 1808 |
| 630 | Ga0495600_0246810 | 3300046809 | Bacteria | 1136 |
| 631 | Ga0495600_0369644 | 3300046809 | Unclassified | 896 |
| 632 | Ga0495600_0467442 | 3300046809 | Unclassified | 778 |
| 633 | Ga0495600_0888438 | 3300046809 | Unclassified | 526 |
| 634 | Ga0495581_0001463 | 3300047315 | Bacteria | 13122 |
| 635 | Ga0495581_0014631 | 3300047315 | Bacteria | 4549 |
| 636 | Ga0495604_0000040 | 3300047317 | Bacteria | 120837 |
| 637 | Ga0495604_0011031 | 3300047317 | Bacteria | 7172 |
| 638 | Ga0495604_0136708 | 3300047317 | Bacteria | 1755 |
| 639 | Ga0495604_0456142 | 3300047317 | Bacteria | 834 |
| 640 | Ga0495604_0645470 | 3300047317 | Bacteria | 675 |
| 641 | Ga0495674_0013104 | 3300047319 | Bacteria | 7798 |
| 642 | Ga0495674_0021106 | 3300047319 | Bacteria | 6026 |
| 643 | Ga0495674_0030767 | 3300047319 | Bacteria | 4878 |
| 644 | Ga0495674_0293455 | 3300047319 | Bacteria | 1329 |
| 645 | Ga0495674_0399258 | 3300047319 | Bacteria | 1110 |
| 646 | Ga0495674_0799749 | 3300047319 | Bacteria | 733 |
| 647 | Ga0495676_0002726 | 3300047321 | Bacteria | 15847 |
| 648 | Ga0495676_0021095 | 3300047321 | Bacteria | 5701 |
| 649 | Ga0495676_0135210 | 3300047321 | Bacteria | 1774 |
| 650 | Ga0495676_0582863 | 3300047321 | Bacteria | 729 |
| 651 | Ga0495676_0908765 | 3300047321 | Unclassified | 564 |
| 652 | Ga0495680_0000010 | 3300047322 | Bacteria | 142931 |
| 653 | Ga0495680_0018534 | 3300047322 | Bacteria | 5902 |
| 654 | Ga0495680_0022123 | 3300047322 | Bacteria | 5308 |
| 655 | Ga0495680_0044621 | 3300047322 | Bacteria | 3504 |
| 656 | Ga0495680_0068326 | 3300047322 | Bacteria | 2715 |
| 657 | Ga0495675_0000111 | 3300047444 | Bacteria | 58822 |
| 658 | Ga0495675_0002537 | 3300047444 | Bacteria | 10930 |
| 659 | Ga0495675_0051392 | 3300047444 | Bacteria | 2617 |
| 660 | Ga0495675_0113964 | 3300047444 | Bacteria | 1686 |
| 661 | Ga0495675_0438768 | 3300047444 | Unclassified | 757 |
| 662 | Ga0495684_0004232 | 3300047471 | Bacteria | 11206 |
| 663 | Ga0495684_0015780 | 3300047471 | Bacteria | 5813 |
| 664 | Ga0495684_0016426 | 3300047471 | Bacteria | 5700 |
| 665 | Ga0495684_0556643 | 3300047471 | Bacteria | 780 |
| 666 | Ga0495684_0564922 | 3300047471 | Bacteria | 772 |
| 667 | Ga0495684_0970435 | 3300047471 | Bacteria | 542 |
| 668 | Ga0495593_0000748 | 3300047673 | Bacteria | 18892 |
| 669 | Ga0495593_0003299 | 3300047673 | Bacteria | 9671 |
| 670 | Ga0495593_0004950 | 3300047673 | Bacteria | 7897 |
| 671 | Ga0495593_0122801 | 3300047673 | Bacteria | 1321 |
| 672 | Ga0495593_0164877 | 3300047673 | Bacteria | 1118 |
| 673 | Ga0495602_0000130 | 3300048088 | Bacteria | 71178 |
| 674 | Ga0495602_0025325 | 3300048088 | Bacteria | 5743 |
| 675 | Ga0495602_0034481 | 3300048088 | Bacteria | 4734 |
| 676 | Ga0495602_0034592 | 3300048088 | Bacteria | 4725 |
| 677 | Ga0495602_0141296 | 3300048088 | Bacteria | 1905 |
| 678 | Ga0495602_0219624 | 3300048088 | Bacteria | 1436 |
| 679 | Ga0495614_0003721 | 3300048089 | Bacteria | 6850 |
| 680 | Ga0495614_0040358 | 3300048089 | Bacteria | 2003 |
| 681 | Ga0495614_0060127 | 3300048089 | Bacteria | 1633 |
| 682 | Ga0495614_0210571 | 3300048089 | Bacteria | 881 |
| 683 | Ga0496100_0086796 | 3300048903 | Bacteria | 2126 |
| 684 | Ga0496100_0223727 | 3300048903 | Bacteria | 1382 |
| 685 | Ga0496100_0249072 | 3300048903 | Bacteria | 1313 |
| 686 | Ga0496100_0321410 | 3300048903 | Bacteria | 1163 |
| 687 | Ga0496100_0785305 | 3300048903 | Unclassified | 746 |
| 688 | Ga0496101_0020018 | 3300048904 | Bacteria | 4576 |
| 689 | Ga0496101_0029417 | 3300048904 | Bacteria | 3842 |
| 690 | Ga0496101_0057538 | 3300048904 | Bacteria | 2812 |
| 691 | Ga0496101_0098092 | 3300048904 | Bacteria | 2189 |
| 692 | Ga0496101_0262629 | 3300048904 | Bacteria | 1347 |
| 693 | Ga0496101_0287842 | 3300048904 | Bacteria | 1285 |
| 694 | Ga0496101_0295243 | 3300048904 | Bacteria | 1268 |
| 695 | Ga0496101_0300065 | 3300048904 | Bacteria | 1258 |
| 696 | Ga0496101_0526594 | 3300048904 | Bacteria | 934 |
| 697 | Ga0496101_0706886 | 3300048904 | Bacteria | 796 |
| 698 | Ga0496102_0009708 | 3300048905 | Bacteria | 8274 |
| 699 | Ga0496102_0059975 | 3300048905 | Bacteria | 3481 |
| 700 | Ga0496102_0091475 | 3300048905 | Bacteria | 2816 |
| 701 | Ga0496102_0250319 | 3300048905 | Bacteria | 1670 |
| 702 | Ga0496102_0344125 | 3300048905 | Bacteria | 1404 |
| 703 | Ga0496102_0580986 | 3300048905 | Unclassified | 1043 |
| 704 | Ga0496102_1036932 | 3300048905 | Bacteria | 740 |
| 705 | Ga0496102_1307321 | 3300048905 | Bacteria | 644 |
| 706 | Ga0496103_0018216 | 3300048906 | Bacteria | 4211 |
| 707 | Ga0496103_0025374 | 3300048906 | Bacteria | 3582 |
| 708 | Ga0496103_0062758 | 3300048906 | Bacteria | 2313 |
| 709 | Ga0496103_0170749 | 3300048906 | Bacteria | 1396 |
| 710 | Ga0496103_0612477 | 3300048906 | Unclassified | 693 |
| 711 | Ga0496104_0002197 | 3300048907 | Bacteria | 16889 |
| 712 | Ga0496104_0015592 | 3300048907 | Bacteria | 6888 |
| 713 | Ga0496104_0134688 | 3300048907 | Bacteria | 2373 |
| 714 | Ga0496104_0154922 | 3300048907 | Bacteria | 2199 |
| 715 | Ga0496104_0174713 | 3300048907 | Bacteria | 2059 |
| 716 | Ga0496104_0200979 | 3300048907 | Bacteria | 1905 |
| 717 | Ga0496104_0254828 | 3300048907 | Bacteria | 1667 |
| 718 | Ga0496104_0522908 | 3300048907 | Bacteria | 1098 |
| 719 | Ga0496104_1192540 | 3300048907 | Unclassified | 664 |
| 720 | Ga0496104_1642480 | 3300048907 | Bacteria | 545 |
| 721 | Ga0496104_1779265 | 3300048907 | Bacteria | 518 |
| 722 | Ga0496105_0010699 | 3300048908 | Bacteria | 7220 |
| 723 | Ga0496105_0014649 | 3300048908 | Bacteria | 6245 |
| 724 | Ga0496105_0055896 | 3300048908 | Bacteria | 3258 |
| 725 | Ga0496105_0062139 | 3300048908 | Bacteria | 3082 |
| 726 | Ga0496105_0111417 | 3300048908 | Bacteria | 2258 |
| 727 | Ga0496105_0118027 | 3300048908 | Bacteria | 2188 |
| 728 | Ga0496105_0269572 | 3300048908 | Bacteria | 1375 |
| 729 | Ga0496105_0730977 | 3300048908 | Bacteria | 757 |
| 730 | Ga0496105_1304391 | 3300048908 | Bacteria | 530 |
| 731 | Ga0496106_0042703 | 3300048909 | Bacteria | 3400 |
| 732 | Ga0496106_0067644 | 3300048909 | Bacteria | 2724 |
| 733 | Ga0496106_0301784 | 3300048909 | Bacteria | 1284 |
| 734 | Ga0496106_0344588 | 3300048909 | Bacteria | 1197 |
| 735 | Ga0496106_0703858 | 3300048909 | Bacteria | 805 |
| 736 | Ga0496106_1465020 | 3300048909 | Bacteria | 526 |
| 737 | Ga0496107_0018491 | 3300048910 | Bacteria | 4906 |
| 738 | Ga0496107_0081962 | 3300048910 | Bacteria | 2353 |
| 739 | Ga0496107_0260863 | 3300048910 | Bacteria | 1289 |
| 740 | Ga0496107_0368553 | 3300048910 | Bacteria | 1068 |
| 741 | Ga0496107_0477028 | 3300048910 | Bacteria | 926 |
| 742 | Ga0496107_0591793 | 3300048910 | Bacteria | 820 |
| 743 | Ga0496108_0031548 | 3300048911 | Bacteria | 4397 |
| 744 | Ga0496108_0093760 | 3300048911 | Bacteria | 2554 |
| 745 | Ga0496108_0280808 | 3300048911 | Bacteria | 1450 |
| 746 | Ga0496108_0329399 | 3300048911 | Bacteria | 1331 |
| 747 | Ga0496108_0503250 | 3300048911 | Bacteria | 1058 |
| 748 | Ga0496108_1241057 | 3300048911 | Unclassified | 629 |
| 749 | Ga0496108_1502620 | 3300048911 | Unclassified | 560 |
| 750 | Ga0496109_0038823 | 3300048912 | Bacteria | 4306 |
| 751 | Ga0496109_0063231 | 3300048912 | Bacteria | 3385 |
| 752 | Ga0496109_0113931 | 3300048912 | Bacteria | 2515 |
| 753 | Ga0496109_0117794 | 3300048912 | Bacteria | 2472 |
| 754 | Ga0496109_0233942 | 3300048912 | Bacteria | 1729 |
| 755 | Ga0496109_0258192 | 3300048912 | Bacteria | 1641 |
| 756 | Ga0496109_0520549 | 3300048912 | Bacteria | 1122 |
| 757 | Ga0496109_0988618 | 3300048912 | Unclassified | 779 |
| 758 | Ga0496110_0034862 | 3300048913 | Bacteria | 4362 |
| 759 | Ga0496110_0132252 | 3300048913 | Bacteria | 2253 |
| 760 | Ga0496110_0271824 | 3300048913 | Bacteria | 1543 |
| 761 | Ga0496110_0331843 | 3300048913 | Bacteria | 1385 |
| 762 | Ga0496110_0375496 | 3300048913 | Bacteria | 1296 |
| 763 | Ga0496110_0733714 | 3300048913 | Bacteria | 890 |
| 764 | Ga0496110_1619813 | 3300048913 | Bacteria | 557 |
| 765 | Ga0496111_0006666 | 3300048914 | Bacteria | 7511 |
| 766 | Ga0496111_0007652 | 3300048914 | Bacteria | 7102 |
| 767 | Ga0496111_0073398 | 3300048914 | Bacteria | 2492 |
| 768 | Ga0496111_0088925 | 3300048914 | Bacteria | 2262 |
| 769 | Ga0496111_0632182 | 3300048914 | Bacteria | 782 |
| 770 | Ga0496112_0263149 | 3300048915 | Bacteria | 1674 |
| 771 | Ga0496112_0937989 | 3300048915 | Unclassified | 787 |
| 772 | Ga0496112_1476332 | 3300048915 | Unclassified | 594 |
| 773 | Ga0496113_0142671 | 3300048916 | Bacteria | 1885 |
| 774 | Ga0496113_0371904 | 3300048916 | Bacteria | 1147 |
| 775 | Ga0496113_0515793 | 3300048916 | Unclassified | 959 |
| 776 | Ga0496113_0569793 | 3300048916 | Bacteria | 908 |
| 777 | Ga0496113_0790045 | 3300048916 | Unclassified | 754 |
| 778 | Ga0496113_0809524 | 3300048916 | Bacteria | 744 |
| 779 | Ga0496113_0999174 | 3300048916 | Unclassified | 659 |
| 780 | Ga0496114_0002893 | 3300048917 | Bacteria | 13150 |
| 781 | Ga0496114_0011607 | 3300048917 | Bacteria | 7043 |
| 782 | Ga0496114_0011773 | 3300048917 | Bacteria | 6999 |
| 783 | Ga0496114_0018715 | 3300048917 | Bacteria | 5604 |
| 784 | Ga0496114_0023056 | 3300048917 | Bacteria | 5074 |
| 785 | Ga0496114_0078641 | 3300048917 | Bacteria | 2783 |
| 786 | Ga0496114_0085181 | 3300048917 | Bacteria | 2677 |
| 787 | Ga0496114_0126510 | 3300048917 | Bacteria | 2203 |
| 788 | Ga0496114_0128959 | 3300048917 | Bacteria | 2182 |
| 789 | Ga0496114_0138221 | 3300048917 | Bacteria | 2107 |
| 790 | Ga0496114_0150024 | 3300048917 | Bacteria | 2022 |
| 791 | Ga0496114_0946779 | 3300048917 | Bacteria | 743 |
| 792 | Ga0496114_1095147 | 3300048917 | Bacteria | 681 |
| 793 | Ga0496115_0008844 | 3300048918 | Bacteria | 7464 |
| 794 | Ga0496115_0029783 | 3300048918 | Bacteria | 4290 |
| 795 | Ga0496115_0043772 | 3300048918 | Bacteria | 3570 |
| 796 | Ga0496115_0060803 | 3300048918 | Bacteria | 3044 |
| 797 | Ga0496115_0413364 | 3300048918 | Bacteria | 1093 |
| 798 | Ga0496126_0136749 | 3300048929 | Bacteria | 2113 |
| 799 | Ga0501069_0173729 | 3300049585 | Bacteria | 1244 |
| 800 | nmdc:mga00v17_129809_c1 | 3300050491 | Bacteria | 1610 |
| 801 | nmdc:mga0yw44_14258_c2 | 3300050492 | Bacteria | 2600 |
| 802 | nmdc:mga0yw44_197472_c1 | 3300050492 | Unclassified | 1328 |
| 803 | nmdc:mga0yw44_74778_c1 | 3300050492 | Bacteria | 2111 |
| 804 | nmdc:mga0yw44_81377_c1 | 3300050492 | Bacteria | 2030 |
| 805 | nmdc:mga0yw44_8868_c1 | 3300050492 | Bacteria | 5040 |
| 806 | nmdc:mga0yw44_890176_c1 | 3300050492 | Bacteria | 604 |
| 807 | nmdc:mga06z11_756092_c1 | 3300050494 | Bacteria | 592 |
| 808 | nmdc:mga08y16_1013887_c1 | 3300050511 | Bacteria | 809 |
| 809 | nmdc:mga08y16_96490_c1 | 3300050511 | Bacteria | 3079 |
| 810 | nmdc:mga0n895_353574_c1 | 3300050512 | Unclassified | 1488 |
| 811 | nmdc:mga08x19_315563_c1 | 3300050514 | Unclassified | 1087 |
| 812 | nmdc:mga08x19_59232_c1 | 3300050514 | Bacteria | 2478 |
| 813 | Ga0495601_0038506 | 3300053077 | Bacteria | 2991 |
| 814 | Ga0495601_0050898 | 3300053077 | Bacteria | 2614 |
| 815 | Ga0495601_0207982 | 3300053077 | Bacteria | 1278 |
| 816 | Ga0495601_0222607 | 3300053077 | Bacteria | 1233 |
| 817 | Ga0495601_0268240 | 3300053077 | Bacteria | 1114 |
| 818 | Ga0495612_0029167 | 3300053078 | Bacteria | 2221 |
| 819 | Ga0495612_0099332 | 3300053078 | Bacteria | 1238 |
| 820 | Ga0495612_0114955 | 3300053078 | Bacteria | 1154 |
| 821 | Ga0495595_0003683 | 3300053084 | Bacteria | 6095 |
| 822 | Ga0495595_0037451 | 3300053084 | Bacteria | 2205 |
| 823 | Ga0495595_0099765 | 3300053084 | Bacteria | 1400 |
| 824 | Ga0495595_0162465 | 3300053084 | Bacteria | 1103 |
| 825 | Ga0495619_0023709 | 3300053085 | Bacteria | 3934 |
| 826 | Ga0495619_0065986 | 3300053085 | Bacteria | 2415 |
| 827 | Ga0495619_0132948 | 3300053085 | Bacteria | 1710 |
| 828 | Ga0495619_0203513 | 3300053085 | Bacteria | 1371 |
| 829 | Ga0495619_0334187 | 3300053085 | Bacteria | 1049 |
| 830 | Ga0495619_0346137 | 3300053085 | Bacteria | 1028 |
| 831 | Ga0495619_0604716 | 3300053085 | Unclassified | 750 |
| 832 | Ga0495619_0690966 | 3300053085 | Unclassified | 694 |
| 833 | Ga0495619_1025858 | 3300053085 | Unclassified | 551 |
| 834 | Ga0495619_1072403 | 3300053085 | Bacteria | 537 |
| 835 | Ga0500641_0019102 | 3300053096 | Bacteria | 2587 |
| 836 | Ga0500554_033823 | 3300053102 | Bacteria | 1527 |
| 837 | Ga0070682_101973227 | |||
| 838 | rootH1_10158853 | |||
| 839 | JGI25404J52841_10020890 | |||
| 840 | Ga0065707_10657283 | |||
| 841 | Ga0070658_10017013 | |||
| 842 | Ga0070658_10106611 | |||
| 843 | Ga0070683_100002777 | |||
| 844 | Ga0070683_100193780 | |||
| 845 | Ga0070683_100760310 | |||
| 846 | Ga0070690_100051285 | |||
| 847 | Ga0070670_100555957 | |||
| 848 | Ga0068869_100499772 | |||
| 849 | Ga0068869_101643608 | |||
| 850 | Ga0070666_10999097 | |||
| 851 | Ga0070682_100034351 | |||
| 852 | Ga0070682_100209735 | |||
| 853 | Ga0070682_100735952 | |||
| 854 | Ga0068868_100175630 | |||
| 855 | Ga0068868_100368288 | |||
| 856 | Ga0068868_100637676 | |||
| 857 | Ga0068868_100705503 | |||
| 858 | Ga0068868_100961134 | |||
| 859 | Ga0068868_100966464 | |||
| 860 | Ga0070660_100160486 | |||
| 861 | Ga0070660_101511170 | |||
| 862 | Ga0070689_100161259 | |||
| 863 | Ga0070689_100661449 | |||
| 864 | Ga0070691_10333176 | |||
| 865 | Ga0070687_100039240 | |||
| 866 | Ga0070687_101137085 | |||
| 867 | Ga0070661_100024614 | |||
| 868 | Ga0070661_100042198 | |||
| 869 | Ga0070692_10234971 | |||
| 870 | Ga0070692_10302861 | |||
| 871 | Ga0070668_100183215 | |||
| 872 | Ga0070671_100097364 | |||
| 873 | Ga0070671_100804176 | |||
| 874 | Ga0070671_101840212 | |||
| 875 | Ga0070674_101273229 | |||
| 876 | Ga0070673_100090049 | |||
| 877 | Ga0070688_100876388 | |||
| 878 | Ga0070659_100128946 | |||
| 879 | Ga0070659_100132079 | |||
| 880 | Ga0070667_100319123 | |||
| 881 | Ga0070667_100989544 | |||
| 882 | Ga0070667_101320605 | |||
| 883 | Ga0070667_101568585 | |||
| 884 | Ga0070667_101909367 | |||
| 885 | Ga0070703_10019810 | |||
| 886 | Ga0070709_10283712 | |||
| 887 | Ga0070709_10378020 | |||
| 888 | Ga0070714_100235461 | |||
| 889 | Ga0070713_102395072 | |||
| 890 | Ga0070710_10335661 | |||
| 891 | Ga0070710_10694668 | |||
| 892 | Ga0070710_10769581 | |||
| 893 | Ga0070701_10125107 | |||
| 894 | Ga0070711_100538183 | |||
| 895 | Ga0070711_100668055 | |||
| 896 | Ga0070711_100689172 | |||
| 897 | Ga0070705_100028447 | |||
| 898 | Ga0070705_100423069 | |||
| 899 | Ga0070700_100169265 | |||
| 900 | Ga0070694_100054366 | |||
| 901 | Ga0070708_100560614 | |||
| 902 | Ga0070708_101135067 | |||
| 903 | Ga0070663_100473643 | |||
| 904 | Ga0070678_100204928 | |||
| 905 | Ga0070678_102407749 | |||
| 906 | Ga0070662_100405564 | |||
| 907 | Ga0070681_10198546 | |||
| 908 | Ga0070681_10457842 | |||
| 909 | Ga0070681_10655181 | |||
| 910 | Ga0068867_100559395 | |||
| 911 | Ga0070685_10143721 | |||
| 912 | Ga0070685_11371272 | |||
| 913 | Ga0070706_100411672 | |||
| 914 | Ga0070706_100959045 | |||
| 915 | Ga0070707_100199949 | |||
| 916 | Ga0070698_100212619 | |||
| 917 | Ga0070698_100604634 | |||
| 918 | Ga0070679_100077935 | |||
| 919 | Ga0070679_100698957 | |||
| 920 | Ga0070684_100004109 | |||
| 921 | Ga0070684_100070363 | |||
| 922 | Ga0068853_100400470 | |||
| 923 | Ga0068853_100514534 | |||
| 924 | Ga0070672_101057179 | |||
| 925 | Ga0070686_100117007 | |||
| 926 | Ga0070695_101154019 | |||
| 927 | Ga0070696_100026859 | |||
| 928 | Ga0070696_100790664 | |||
| 929 | Ga0070696_101328225 | |||
| 930 | Ga0070693_100049318 | |||
| 931 | Ga0070665_100000454 | |||
| 932 | Ga0070665_100352612 | |||
| 933 | Ga0070704_100465046 | |||
| 934 | Ga0068855_100048549 | |||
| 935 | Ga0070664_100008592 | |||
| 936 | Ga0070664_100076583 | |||
| 937 | Ga0070664_102266846 | |||
| 938 | Ga0068857_100050320 | |||
| 939 | Ga0068857_100087245 | |||
| 940 | Ga0068857_101988364 | |||
| 941 | Ga0068854_100044673 | |||
| 942 | Ga0068856_100026056 | |||
| 943 | Ga0068856_100761888 | |||
| 944 | Ga0070702_100021100 | |||
| 945 | Ga0070702_100044869 | |||
| 946 | Ga0070702_100605588 | |||
| 947 | Ga0070702_100764115 | |||
| 948 | Ga0070702_101397767 | |||
| 949 | Ga0068852_100300499 | |||
| 950 | Ga0068852_100673686 | |||
| 951 | Ga0068859_100379305 | |||
| 952 | Ga0068859_102872236 | |||
| 953 | Ga0068864_100008792 | |||
| 954 | Ga0068864_100034777 | |||
| 955 | Ga0068864_100368308 | |||
| 956 | Ga0068864_100483642 | |||
| 957 | Ga0068866_10044525 | |||
| 958 | Ga0068866_11429310 | |||
| 959 | Ga0068861_100252382 | |||
| 960 | Ga0068861_100316319 | |||
| 961 | Ga0068861_100921594 | |||
| 962 | Ga0068861_101894599 | |||
| 963 | Ga0068851_10066951 | |||
| 964 | Ga0068870_10080129 | |||
| 965 | Ga0068863_100041626 | |||
| 966 | Ga0068858_100197110 | |||
| 967 | Ga0068858_100307555 | |||
| 968 | Ga0068860_100042001 | |||
| 969 | Ga0068860_100312123 | |||
| 970 | Ga0068860_100336634 | |||
| 971 | Ga0068862_100736240 | |||
| 972 | Ga0081540_1000511 | |||
| 973 | Ga0081540_1295139 | |||
| 974 | Ga0070717_10871629 | |||
| 975 | Ga0075365_10011417 | |||
| 976 | Ga0075365_10025856 | |||
| 977 | Ga0075365_10031223 | |||
| 978 | Ga0075365_10087628 | |||
| 979 | Ga0075365_10147243 | |||
| 980 | Ga0075365_11169898 | |||
| 981 | Ga0075363_100471937 | |||
| 982 | Ga0075364_10064194 | |||
| 983 | Ga0075364_10510047 | |||
| 984 | Ga0075432_10052081 | |||
| 985 | Ga0070715_10013333 | |||
| 986 | Ga0070715_10271235 | |||
| 987 | Ga0070716_100134774 | |||
| 988 | Ga0070716_100314008 | |||
| 989 | Ga0070712_100395861 | |||
| 990 | Ga0070712_100690509 | |||
| 991 | Ga0070712_100912665 | |||
| 992 | Ga0097621_100156961 | |||
| 993 | Ga0068871_100257938 | |||
| 994 | Ga0068871_101856580 | |||
| 995 | Ga0068871_102157574 | |||
| 996 | Ga0075428_101124778 | |||
| 997 | Ga0075434_100711685 | |||
| 998 | Ga0075434_101494250 | |||
| 999 | Ga0068865_100309903 | |||
| 1000 | Ga0068865_100375236 | |||
| 1001 | Ga0075436_100265941 | |||
| 1002 | Ga0075436_100836534 | |||
| 1003 | Ga0097620_100379294 | |||
| 1004 | Ga0097620_102872544 | |||
| 1005 | Ga0105244_10215167 | |||
| 1006 | Ga0105245_10000507 | |||
| 1007 | Ga0105245_10003390 | |||
| 1008 | Ga0105245_10180198 | |||
| 1009 | Ga0105245_10458120 | |||
| 1010 | Ga0105245_10628436 | |||
| 1011 | Ga0105245_11549452 | |||
| 1012 | Ga0105245_12709298 | |||
| 1013 | Ga0105247_10092010 | |||
| 1014 | Ga0105247_10388421 | |||
| 1015 | Ga0105247_10461591 | |||
| 1016 | Ga0105247_11154540 | |||
| 1017 | Ga0105243_10066434 | |||
| 1018 | Ga0105243_10113757 | |||
| 1019 | Ga0105241_10409039 | |||
| 1020 | Ga0105241_11500802 | |||
| 1021 | Ga0105242_10035942 | |||
| 1022 | Ga0105242_10452914 | |||
| 1023 | Ga0105242_10528375 | |||
| 1024 | Ga0105242_10541896 | |||
| 1025 | Ga0105242_10715277 | |||
| 1026 | Ga0105242_13269090 | |||
| 1027 | Ga0105248_10068019 | |||
| 1028 | Ga0105248_10101079 | |||
| 1029 | Ga0105248_10326803 | |||
| 1030 | Ga0105237_10658689 | |||
| 1031 | Ga0105237_11522722 | |||
| 1032 | Ga0105238_10125857 | |||
| 1033 | Ga0105238_10269752 | |||
| 1034 | Ga0105238_10742587 | |||
| 1035 | Ga0105238_10915319 | |||
| 1036 | Ga0105238_11364068 | |||
| 1037 | Ga0105249_10083011 | |||
| 1038 | Ga0105249_10634891 | |||
| 1039 | Ga0105249_11631544 | |||
| 1040 | Ga0105249_11897479 | |||
| 1041 | Ga0105239_10003323 | |||
| 1042 | Ga0105239_11331788 | |||
| 1043 | Ga0105239_11356405 | |||
| 1044 | Ga0105239_11793038 | |||
| 1045 | Ga0105246_10002642 | |||
| 1046 | Ga0105246_10248110 | |||
| 1047 | Ga0157321_1007050 | |||
| 1048 | Ga0157329_1030771 | |||
| 1049 | Ga0157341_1034637 | |||
| 1050 | Ga0157319_1004395 | |||
| 1051 | Ga0157347_1024527 | |||
| 1052 | Ga0157342_1008070 | |||
| 1053 | Ga0157315_1040902 | |||
| 1054 | Ga0157326_1031470 | |||
| 1055 | Ga0157338_1008470 | |||
| 1056 | Ga0157373_10811167 | |||
| 1057 | Ga0157371_10050824 | |||
| 1058 | Ga0157370_10871986 | |||
| 1059 | Ga0157370_11830590 | |||
| 1060 | Ga0157369_10105011 | |||
| 1061 | Ga0157369_10410743 | |||
| 1062 | Ga0157369_10528344 | |||
| 1063 | Ga0157369_10867312 | |||
| 1064 | Ga0157369_11878462 | |||
| 1065 | Ga0157369_11913527 | |||
| 1066 | Ga0157374_10840809 | |||
| 1067 | Ga0157374_11450350 | |||
| 1068 | Ga0163162_10052280 | |||
| 1069 | Ga0163162_10167959 | |||
| 1070 | Ga0163162_10767235 | |||
| 1071 | Ga0163162_10832251 | |||
| 1072 | Ga0163162_11627860 | |||
| 1073 | Ga0157372_10001454 | |||
| 1074 | Ga0157372_10518031 | |||
| 1075 | Ga0157372_11659274 | |||
| 1076 | Ga0157372_12297833 | |||
| 1077 | Ga0157372_13433854 | |||
| 1078 | Ga0157375_10023644 | |||
| 1079 | Ga0157375_10050509 | |||
| 1080 | Ga0157375_10763685 | |||
| 1081 | Ga0157375_10923426 | |||
| 1082 | Ga0157375_11034154 | |||
| 1083 | Ga0163163_10026127 | |||
| 1084 | Ga0163163_10038578 | |||
| 1085 | Ga0163163_10045078 | |||
| 1086 | Ga0163163_10122930 | |||
| 1087 | Ga0163163_10817832 | |||
| 1088 | Ga0163163_11145524 | |||
| 1089 | Ga0157377_10155318 | |||
| 1090 | Ga0157377_10177223 | |||
| 1091 | Ga0157379_10022699 | |||
| 1092 | Ga0157376_10238908 | |||
| 1093 | Ga0157376_10432794 | |||
| 1094 | Ga0157376_10654969 | |||
| 1095 | Ga0157376_11523544 | |||
| 1096 | Ga0163161_10129903 | |||
| 1097 | Ga0163161_10445235 | |||
| 1098 | Ga0206356_11334568 | |||
| 1099 | Ga0206353_10987813 | |||
| 1100 | Ga0206353_11910781 | |||
| 1101 | Ga0207697_10449167 | |||
| 1102 | Ga0207656_10096879 | |||
| 1103 | Ga0207713_1133944 | |||
| 1104 | Ga0207653_10004486 | |||
| 1105 | Ga0207692_10479506 | |||
| 1106 | Ga0207642_10346712 | |||
| 1107 | Ga0207710_10222177 | |||
| 1108 | Ga0207688_10008202 | |||
| 1109 | Ga0207688_10066926 | |||
| 1110 | Ga0207688_10482074 | |||
| 1111 | Ga0207688_10672897 | |||
| 1112 | Ga0207680_10326895 | |||
| 1113 | Ga0207647_10064422 | |||
| 1114 | Ga0207685_10012045 | |||
| 1115 | Ga0207699_10134705 | |||
| 1116 | Ga0207699_10429996 | |||
| 1117 | Ga0207699_10864917 | |||
| 1118 | Ga0207645_10506588 | |||
| 1119 | Ga0207643_10010619 | |||
| 1120 | Ga0207705_10756903 | |||
| 1121 | Ga0207705_10870355 | |||
| 1122 | Ga0207684_10499489 | |||
| 1123 | Ga0207684_10501376 | |||
| 1124 | Ga0207707_10259122 | |||
| 1125 | Ga0207707_10384219 | |||
| 1126 | Ga0207707_10683852 | |||
| 1127 | Ga0207695_10180348 | |||
| 1128 | Ga0207693_10075020 | |||
| 1129 | Ga0207693_10401995 | |||
| 1130 | Ga0207663_10304935 | |||
| 1131 | Ga0207663_10359577 | |||
| 1132 | Ga0207663_10627798 | |||
| 1133 | Ga0207662_10017649 | |||
| 1134 | Ga0207662_10109933 | |||
| 1135 | Ga0207662_11282698 | |||
| 1136 | Ga0207657_10041435 | |||
| 1137 | Ga0207649_10248589 | |||
| 1138 | Ga0207652_10244952 | |||
| 1139 | Ga0207646_11119264 | |||
| 1140 | Ga0207694_10316871 | |||
| 1141 | Ga0207694_10930675 | |||
| 1142 | Ga0207687_10023515 | |||
| 1143 | Ga0207687_10111018 | |||
| 1144 | Ga0207687_10971060 | |||
| 1145 | Ga0207700_10019697 | |||
| 1146 | Ga0207700_10136131 | |||
| 1147 | Ga0207700_11533811 | |||
| 1148 | Ga0207664_10006036 | |||
| 1149 | Ga0207664_10298236 | |||
| 1150 | Ga0207664_10584366 | |||
| 1151 | Ga0207644_10513359 | |||
| 1152 | Ga0207644_10757572 | |||
| 1153 | Ga0207690_10115881 | |||
| 1154 | Ga0207690_10120595 | |||
| 1155 | Ga0207706_10044432 | |||
| 1156 | Ga0207706_10193729 | |||
| 1157 | Ga0207686_10490592 | |||
| 1158 | Ga0207686_10787646 | |||
| 1159 | Ga0207709_10081727 | |||
| 1160 | Ga0207709_10270770 | |||
| 1161 | Ga0207709_10929046 | |||
| 1162 | Ga0207669_10401747 | |||
| 1163 | Ga0207669_10740505 | |||
| 1164 | Ga0207669_11229800 | |||
| 1165 | Ga0207704_10036924 | |||
| 1166 | Ga0207704_11430150 | |||
| 1167 | Ga0207665_10011778 | |||
| 1168 | Ga0207711_10372316 | |||
| 1169 | Ga0207711_10901137 | |||
| 1170 | Ga0207689_10479299 | |||
| 1171 | Ga0207689_11121737 | |||
| 1172 | Ga0207661_10030249 | |||
| 1173 | Ga0207661_10035726 | |||
| 1174 | Ga0207661_10102164 | |||
| 1175 | Ga0207661_10730888 | |||
| 1176 | Ga0207667_10650611 | |||
| 1177 | Ga0207667_11469205 | |||
| 1178 | Ga0207651_10099613 | |||
| 1179 | Ga0207712_10118944 | |||
| 1180 | Ga0207668_10289040 | |||
| 1181 | Ga0207658_10103451 | |||
| 1182 | Ga0207658_10851416 | |||
| 1183 | Ga0207677_10138864 | |||
| 1184 | Ga0207677_10552365 | |||
| 1185 | Ga0207677_10718101 | |||
| 1186 | Ga0207703_10027357 | |||
| 1187 | Ga0207639_10022237 | |||
| 1188 | Ga0207639_10081429 | |||
| 1189 | Ga0207678_10006761 | |||
| 1190 | Ga0207708_10147472 | |||
| 1191 | Ga0207702_10143150 | |||
| 1192 | Ga0207702_10294748 | |||
| 1193 | Ga0207702_10367667 | |||
| 1194 | Ga0207702_10454039 | |||
| 1195 | Ga0207702_11402060 | |||
| 1196 | Ga0207641_10064133 | |||
| 1197 | Ga0207648_12012055 | |||
| 1198 | Ga0207676_10725502 | |||
| 1199 | Ga0207674_10013926 | |||
| 1200 | Ga0207674_10029558 | |||
| 1201 | Ga0207675_100011145 | |||
| 1202 | Ga0207675_100504087 | |||
| 1203 | Ga0207675_100790741 | |||
| 1204 | Ga0207683_10042923 | |||
| 1205 | Ga0207683_11419244 | |||
| 1206 | Ga0207683_11794931 | |||
| 1207 | Ga0207698_10610869 | |||
| 1208 | Ga0268266_10002426 | |||
| 1209 | Ga0268266_10987103 | |||
| 1210 | Ga0268265_10342554 | |||
| 1211 | Ga0268265_10606665 | |||
| 1212 | Ga0268265_11347412 | |||
| 1213 | Ga0268264_10046222 | |||
| 1214 | Ga0268264_10305489 | |||
| 1215 | Ga0265336_10003154 | |||
| 1216 | Ga0265338_10013289 | |||
| 1217 | Ga0265328_10169373 | |||
| 1218 | Ga0265316_10191250 | |||
| 1219 | Ga0307405_10000521 | |||
| 1220 | Ga0307413_10278852 | |||
| 1221 | Ga0307406_10410633 | |||
| 1222 | Ga0307407_10004634 | |||
| 1223 | Ga0307409_100002261 | |||
| 1224 | Ga0307415_100000320 | |||
| 1225 | Ga0373950_0098097 | |||
| 1226 | Ga0373959_0138781 | |||
| 1227 | Ga0373938_0208901 | |||
| 1228 | Ga0373926_0000166 | |||
| 1229 | Ga0373926_0144176 | |||
| 1230 | Ga0373929_0170024 | |||
| 1231 | Ga0373934_0019215 | |||
| 1232 | Ga0373934_0026766 | |||
| 1233 | Ga0373934_0043382 | |||
| 1234 | Ga0373934_0090305 | |||
| 1235 | Ga0373940_0140728 | |||
| 1236 | Ga0373944_0000832 | |||
| 1237 | Ga0373944_0266316 | |||
| 1238 | Ga0373949_0070805 | |||
| 1239 | Ga0373951_0013761 | |||
| 1240 | Ga0373952_0030402 | |||
| 1241 | Ga0373923_0015161 | |||
| 1242 | Ga0373923_0065268 | |||
| 1243 | Ga0373932_0018462 | |||
| 1244 | Ga0373932_0308192 | |||
| 1245 | Ga0373936_0000370 | |||
| 1246 | Ga0373936_0002034 | |||
| 1247 | Ga0373941_0068059 | |||
| 1248 | Ga0373945_0000457 | |||
| 1249 | Ga0373945_0037511 | |||
| 1250 | Ga0373953_0000247 | |||
| 1251 | Ga0373953_0010251 | |||
| 1252 | Ga0373953_0024201 | |||
| 1253 | Ga0373953_0059604 | |||
| 1254 | Ga0373953_0303088 | |||
| 1255 | Ga0373954_0009828 | |||
| 1256 | Ga0373954_0045688 | |||
| 1257 | Ga0373954_0219507 | |||
| 1258 | Ga0373954_0352807 | |||
| 1259 | Ga0373954_0671405 | |||
| 1260 | Ga0373956_0002403 | |||
| 1261 | Ga0373956_0009246 | |||
| 1262 | Ga0373956_0012780 | |||
| 1263 | Ga0373956_0046501 | |||
| 1264 | Ga0373957_0000304 | |||
| 1265 | Ga0373957_0000360 | |||
| 1266 | Ga0373957_0109859 | |||
| 1267 | Ga0373957_0119187 | |||
| 1268 | Ga0373957_0159997 | |||
| 1269 | Ga0373957_0334606 | |||
| 1270 | Ga0373960_0109282 | |||
| 1271 | Ga0373943_0000067 | |||
| 1272 | Ga0373943_0023869 | |||
| 1273 | Ga0373946_0000440 | |||
| 1274 | Ga0373946_0024508 | |||
| 1275 | Ga0373955_0016960 | |||
| 1276 | Ga0373955_0044551 | |||
| 1277 | Ga0373955_0195523 | |||
| 1278 | Ga0373955_0474892 | |||
| 1279 | Ga0373942_0105845 | |||
| 1280 | Ga0373942_0377515 | |||
| 1281 | Ga0373961_0210240 | |||
| 1282 | Ga0373961_0400329 | |||
| 1283 | Ga0373924_0000135 | |||
| 1284 | Ga0373924_0000415 | |||
| 1285 | Ga0373924_0001322 | |||
| 1286 | Ga0373924_0043596 | |||
| 1287 | Ga0373931_0051796 | |||
| 1288 | Ga0373931_0147990 | |||
| 1289 | Ga0373931_1260198 | |||
| 1290 | Ga0373935_0031649 | |||
| 1291 | Ga0373935_0637472 | |||
| 1292 | Ga0373927_0001544 | |||
| 1293 | Ga0373927_0173696 | |||
| 1294 | Ga0373927_0904243 | |||
| 1295 | Ga0373933_0000003 | |||
| 1296 | Ga0373933_0065897 | |||
| 1297 | Ga0373933_0109663 | |||
| 1298 | Ga0373933_1059056 | |||
| 1299 | Ga0373933_1091139 | |||
| 1300 | Ga0373947_0007085 | |||
| 1301 | Ga0373947_0079368 | |||
| 1302 | Ga0373947_0321073 | |||
| 1303 | Ga0373947_0383648 | |||
| 1304 | Ga0373937_0000016 | |||
| 1305 | Ga0373937_0002125 | |||
| 1306 | Ga0373937_0090703 | |||
| 1307 | Ga0373937_0135144 | |||
| 1308 | Ga0373937_0205630 | |||
| 1309 | Ga0373925_0007534 | |||
| 1310 | Ga0373925_0015037 | |||
| 1311 | Ga0373925_0029048 | |||
| 1312 | Ga0373925_0102584 | |||
| 1313 | Ga0451789_0881630 | |||
| 1314 | Ga0451804_0805710 | |||
| 1315 | Ga0451849_0698324 | |||
| 1316 | Ga0451853_1874758 | |||
| 1317 | Ga0451853_2678561 | |||
| 1318 | Ga0451853_2682677 | |||
| 1319 | Ga0451577_0358532 | |||
| 1320 | Ga0466963_0244432 | |||
| 1321 | Ga0451576_0264268 | |||
| 1322 | Ga0495592_0000116 | |||
| 1323 | Ga0495592_0015971 | |||
| 1324 | Ga0495592_0054550 | |||
| 1325 | Ga0495592_0232250 | |||
| 1326 | Ga0495592_0391860 | |||
| 1327 | Ga0495592_0529405 | |||
| 1328 | Ga0495603_0001523 | |||
| 1329 | Ga0495603_0045820 | |||
| 1330 | Ga0495629_0003493 | |||
| 1331 | Ga0495629_0064070 | |||
| 1332 | Ga0495629_0169881 | |||
| 1333 | Ga0495629_0365901 | |||
| 1334 | Ga0495641_0003782 | |||
| 1335 | Ga0495641_0007807 | |||
| 1336 | Ga0495641_0008033 | |||
| 1337 | Ga0495641_0062768 | |||
| 1338 | Ga0495641_0165956 | |||
| 1339 | Ga0495641_0184160 | |||
| 1340 | Ga0495651_0000009 | |||
| 1341 | Ga0495651_0009543 | |||
| 1342 | Ga0495651_0039359 | |||
| 1343 | Ga0495651_0060369 | |||
| 1344 | Ga0495651_0113575 | |||
| 1345 | Ga0495653_0001057 | |||
| 1346 | Ga0495653_0024626 | |||
| 1347 | Ga0495653_0173953 | |||
| 1348 | Ga0495653_0877904 | |||
| 1349 | Ga0495653_0908170 | |||
| 1350 | Ga0495580_0035745 | |||
| 1351 | Ga0495580_0089073 | |||
| 1352 | Ga0495582_0000375 | |||
| 1353 | Ga0495582_0002790 | |||
| 1354 | Ga0495582_0142355 | |||
| 1355 | Ga0495582_0316946 | |||
| 1356 | Ga0495582_0395227 | |||
| 1357 | Ga0495639_0000548 | |||
| 1358 | Ga0495639_0040452 | |||
| 1359 | Ga0495639_0305244 | |||
| 1360 | Ga0495639_0342680 | |||
| 1361 | Ga0495662_0004647 | |||
| 1362 | Ga0495662_0007763 | |||
| 1363 | Ga0495662_0018685 | |||
| 1364 | Ga0495664_0004540 | |||
| 1365 | Ga0495664_0007915 | |||
| 1366 | Ga0495594_0136825 | |||
| 1367 | Ga0495594_0171907 | |||
| 1368 | Ga0495608_0000019 | |||
| 1369 | Ga0495608_0015096 | |||
| 1370 | Ga0495608_0035914 | |||
| 1371 | Ga0495608_0378966 | |||
| 1372 | Ga0495608_0396924 | |||
| 1373 | Ga0495608_0897605 | |||
| 1374 | Ga0495618_0001073 | |||
| 1375 | Ga0495618_0410798 | |||
| 1376 | Ga0495628_0000487 | |||
| 1377 | Ga0495628_0178455 | |||
| 1378 | Ga0495628_0241658 | |||
| 1379 | Ga0495628_0313640 | |||
| 1380 | Ga0495628_0512736 | |||
| 1381 | Ga0495630_0004836 | |||
| 1382 | Ga0495630_0044423 | |||
| 1383 | Ga0495630_0049458 | |||
| 1384 | Ga0495666_0025075 | |||
| 1385 | Ga0495666_0141735 | |||
| 1386 | Ga0495652_0000430 | |||
| 1387 | Ga0495652_0035590 | |||
| 1388 | Ga0495652_0037892 | |||
| 1389 | Ga0495652_0306386 | |||
| 1390 | Ga0495652_0373095 | |||
| 1391 | Ga0495652_0713384 | |||
| 1392 | Ga0495665_0000236 | |||
| 1393 | Ga0495665_0008820 | |||
| 1394 | Ga0495665_0041157 | |||
| 1395 | Ga0495640_0008891 | |||
| 1396 | Ga0495640_0017655 | |||
| 1397 | Ga0495640_0022194 | |||
| 1398 | Ga0495640_0568740 | |||
| 1399 | Ga0495586_0008635 | |||
| 1400 | Ga0495587_0000041 | |||
| 1401 | Ga0495587_0080415 | |||
| 1402 | Ga0495587_0138878 | |||
| 1403 | Ga0495587_0218624 | |||
| 1404 | Ga0495587_0376772 | |||
| 1405 | Ga0495645_0029423 | |||
| 1406 | Ga0495645_0110029 | |||
| 1407 | Ga0495645_0176939 | |||
| 1408 | Ga0495645_0471893 | |||
| 1409 | Ga0495645_0493386 | |||
| 1410 | Ga0495622_0061572 | |||
| 1411 | Ga0495667_0000037 | |||
| 1412 | Ga0495667_0000557 | |||
| 1413 | Ga0495667_0005966 | |||
| 1414 | Ga0495667_0032678 | |||
| 1415 | Ga0495667_0216908 | |||
| 1416 | Ga0495667_0448152 | |||
| 1417 | Ga0495656_0448327 | |||
| 1418 | Ga0495634_0003394 | |||
| 1419 | Ga0495634_0020321 | |||
| 1420 | Ga0495634_0034577 | |||
| 1421 | Ga0495634_0166102 | |||
| 1422 | Ga0495635_0010520 | |||
| 1423 | Ga0495635_0024939 | |||
| 1424 | Ga0495635_0046089 | |||
| 1425 | Ga0495588_0211382 | |||
| 1426 | Ga0495657_0000094 | |||
| 1427 | Ga0495657_0006691 | |||
| 1428 | Ga0495657_0012007 | |||
| 1429 | Ga0495657_0018831 | |||
| 1430 | Ga0495657_0227015 | |||
| 1431 | Ga0495657_0454480 | |||
| 1432 | Ga0495599_0000040 | |||
| 1433 | Ga0495599_0028865 | |||
| 1434 | Ga0495599_0139720 | |||
| 1435 | Ga0495599_0243266 | |||
| 1436 | Ga0495599_0305225 | |||
| 1437 | Ga0495599_0603583 | |||
| 1438 | Ga0495623_0000284 | |||
| 1439 | Ga0495623_0017741 | |||
| 1440 | Ga0495623_0091013 | |||
| 1441 | Ga0495623_0220134 | |||
| 1442 | Ga0495646_0006814 | |||
| 1443 | Ga0495646_0016988 | |||
| 1444 | Ga0495646_0141043 | |||
| 1445 | Ga0495646_0228716 | |||
| 1446 | Ga0495647_0003459 | |||
| 1447 | Ga0495647_0038703 | |||
| 1448 | Ga0495658_0004141 | |||
| 1449 | Ga0495658_0047633 | |||
| 1450 | Ga0495658_0079721 | |||
| 1451 | Ga0495658_0260449 | |||
| 1452 | Ga0495658_0375546 | |||
| 1453 | Ga0495613_0003464 | |||
| 1454 | Ga0495613_0016362 | |||
| 1455 | Ga0495613_0048337 | |||
| 1456 | Ga0495613_0131034 | |||
| 1457 | Ga0495624_0007166 | |||
| 1458 | Ga0495624_0009694 | |||
| 1459 | Ga0495624_0022917 | |||
| 1460 | Ga0495624_0200386 | |||
| 1461 | Ga0495600_0002749 | |||
| 1462 | Ga0495600_0003484 | |||
| 1463 | Ga0495600_0012423 | |||
| 1464 | Ga0495600_0074799 | |||
| 1465 | Ga0495600_0108435 | |||
| 1466 | Ga0495600_0246810 | |||
| 1467 | Ga0495600_0369644 | |||
| 1468 | Ga0495600_0467442 | |||
| 1469 | Ga0495600_0888438 | |||
| 1470 | Ga0495581_0001463 | |||
| 1471 | Ga0495581_0014631 | |||
| 1472 | Ga0495604_0000040 | |||
| 1473 | Ga0495604_0011031 | |||
| 1474 | Ga0495604_0136708 | |||
| 1475 | Ga0495604_0456142 | |||
| 1476 | Ga0495604_0645470 | |||
| 1477 | Ga0495674_0013104 | |||
| 1478 | Ga0495674_0021106 | |||
| 1479 | Ga0495674_0030767 | |||
| 1480 | Ga0495674_0293455 | |||
| 1481 | Ga0495674_0399258 | |||
| 1482 | Ga0495674_0799749 | |||
| 1483 | Ga0495676_0002726 | |||
| 1484 | Ga0495676_0021095 | |||
| 1485 | Ga0495676_0135210 | |||
| 1486 | Ga0495676_0582863 | |||
| 1487 | Ga0495676_0908765 | |||
| 1488 | Ga0495680_0000010 | |||
| 1489 | Ga0495680_0018534 | |||
| 1490 | Ga0495680_0022123 | |||
| 1491 | Ga0495680_0044621 | |||
| 1492 | Ga0495680_0068326 | |||
| 1493 | Ga0495675_0000111 | |||
| 1494 | Ga0495675_0002537 | |||
| 1495 | Ga0495675_0051392 | |||
| 1496 | Ga0495675_0113964 | |||
| 1497 | Ga0495675_0438768 | |||
| 1498 | Ga0495684_0004232 | |||
| 1499 | Ga0495684_0015780 | |||
| 1500 | Ga0495684_0016426 | |||
| 1501 | Ga0495684_0556643 | |||
| 1502 | Ga0495684_0564922 | |||
| 1503 | Ga0495684_0970435 | |||
| 1504 | Ga0495593_0000748 | |||
| 1505 | Ga0495593_0003299 | |||
| 1506 | Ga0495593_0004950 | |||
| 1507 | Ga0495593_0122801 | |||
| 1508 | Ga0495593_0164877 | |||
| 1509 | Ga0495602_0000130 | |||
| 1510 | Ga0495602_0025325 | |||
| 1511 | Ga0495602_0034481 | |||
| 1512 | Ga0495602_0034592 | |||
| 1513 | Ga0495602_0141296 | |||
| 1514 | Ga0495602_0219624 | |||
| 1515 | Ga0495614_0003721 | |||
| 1516 | Ga0495614_0040358 | |||
| 1517 | Ga0495614_0060127 | |||
| 1518 | Ga0495614_0210571 | |||
| 1519 | Ga0496100_0086796 | |||
| 1520 | Ga0496100_0223727 | |||
| 1521 | Ga0496100_0249072 | |||
| 1522 | Ga0496100_0321410 | |||
| 1523 | Ga0496100_0785305 | |||
| 1524 | Ga0496101_0020018 | |||
| 1525 | Ga0496101_0029417 | |||
| 1526 | Ga0496101_0057538 | |||
| 1527 | Ga0496101_0098092 | |||
| 1528 | Ga0496101_0262629 | |||
| 1529 | Ga0496101_0287842 | |||
| 1530 | Ga0496101_0295243 | |||
| 1531 | Ga0496101_0300065 | |||
| 1532 | Ga0496101_0526594 | |||
| 1533 | Ga0496101_0706886 | |||
| 1534 | Ga0496102_0009708 | |||
| 1535 | Ga0496102_0059975 | |||
| 1536 | Ga0496102_0091475 | |||
| 1537 | Ga0496102_0250319 | |||
| 1538 | Ga0496102_0344125 | |||
| 1539 | Ga0496102_0580986 | |||
| 1540 | Ga0496102_1036932 | |||
| 1541 | Ga0496102_1307321 | |||
| 1542 | Ga0496103_0018216 | |||
| 1543 | Ga0496103_0025374 | |||
| 1544 | Ga0496103_0062758 | |||
| 1545 | Ga0496103_0170749 | |||
| 1546 | Ga0496103_0612477 | |||
| 1547 | Ga0496104_0002197 | |||
| 1548 | Ga0496104_0015592 | |||
| 1549 | Ga0496104_0134688 | |||
| 1550 | Ga0496104_0154922 | |||
| 1551 | Ga0496104_0174713 | |||
| 1552 | Ga0496104_0200979 | |||
| 1553 | Ga0496104_0254828 | |||
| 1554 | Ga0496104_0522908 | |||
| 1555 | Ga0496104_1192540 | |||
| 1556 | Ga0496104_1642480 | |||
| 1557 | Ga0496104_1779265 | |||
| 1558 | Ga0496105_0010699 | |||
| 1559 | Ga0496105_0014649 | |||
| 1560 | Ga0496105_0055896 | |||
| 1561 | Ga0496105_0062139 | |||
| 1562 | Ga0496105_0111417 | |||
| 1563 | Ga0496105_0118027 | |||
| 1564 | Ga0496105_0269572 | |||
| 1565 | Ga0496105_0730977 | |||
| 1566 | Ga0496105_1304391 | |||
| 1567 | Ga0496106_0042703 | |||
| 1568 | Ga0496106_0067644 | |||
| 1569 | Ga0496106_0301784 | |||
| 1570 | Ga0496106_0344588 | |||
| 1571 | Ga0496106_0703858 | |||
| 1572 | Ga0496106_1465020 | |||
| 1573 | Ga0496107_0018491 | |||
| 1574 | Ga0496107_0081962 | |||
| 1575 | Ga0496107_0260863 | |||
| 1576 | Ga0496107_0368553 | |||
| 1577 | Ga0496107_0477028 | |||
| 1578 | Ga0496107_0591793 | |||
| 1579 | Ga0496108_0031548 | |||
| 1580 | Ga0496108_0093760 | |||
| 1581 | Ga0496108_0280808 | |||
| 1582 | Ga0496108_0329399 | |||
| 1583 | Ga0496108_0503250 | |||
| 1584 | Ga0496108_1241057 | |||
| 1585 | Ga0496108_1502620 | |||
| 1586 | Ga0496109_0038823 | |||
| 1587 | Ga0496109_0063231 | |||
| 1588 | Ga0496109_0113931 | |||
| 1589 | Ga0496109_0117794 | |||
| 1590 | Ga0496109_0233942 | |||
| 1591 | Ga0496109_0258192 | |||
| 1592 | Ga0496109_0520549 | |||
| 1593 | Ga0496109_0988618 | |||
| 1594 | Ga0496110_0034862 | |||
| 1595 | Ga0496110_0132252 | |||
| 1596 | Ga0496110_0271824 | |||
| 1597 | Ga0496110_0331843 | |||
| 1598 | Ga0496110_0375496 | |||
| 1599 | Ga0496110_0733714 | |||
| 1600 | Ga0496110_1619813 | |||
| 1601 | Ga0496111_0006666 | |||
| 1602 | Ga0496111_0007652 | |||
| 1603 | Ga0496111_0073398 | |||
| 1604 | Ga0496111_0088925 | |||
| 1605 | Ga0496111_0632182 | |||
| 1606 | Ga0496112_0263149 | |||
| 1607 | Ga0496112_0937989 | |||
| 1608 | Ga0496112_1476332 | |||
| 1609 | Ga0496113_0142671 | |||
| 1610 | Ga0496113_0371904 | |||
| 1611 | Ga0496113_0515793 | |||
| 1612 | Ga0496113_0569793 | |||
| 1613 | Ga0496113_0790045 | |||
| 1614 | Ga0496113_0809524 | |||
| 1615 | Ga0496113_0999174 | |||
| 1616 | Ga0496114_0002893 | |||
| 1617 | Ga0496114_0011607 | |||
| 1618 | Ga0496114_0011773 | |||
| 1619 | Ga0496114_0018715 | |||
| 1620 | Ga0496114_0023056 | |||
| 1621 | Ga0496114_0078641 | |||
| 1622 | Ga0496114_0085181 | |||
| 1623 | Ga0496114_0126510 | |||
| 1624 | Ga0496114_0128959 | |||
| 1625 | Ga0496114_0138221 | |||
| 1626 | Ga0496114_0150024 | |||
| 1627 | Ga0496114_0946779 | |||
| 1628 | Ga0496114_1095147 | |||
| 1629 | Ga0496115_0008844 | |||
| 1630 | Ga0496115_0029783 | |||
| 1631 | Ga0496115_0043772 | |||
| 1632 | Ga0496115_0060803 | |||
| 1633 | Ga0496115_0413364 | |||
| 1634 | Ga0496126_0136749 | |||
| 1635 | Ga0501069_0173729 | |||
| 1636 | nmdc:mga00v17_129809_c1 | |||
| 1637 | nmdc:mga0yw44_14258_c2 | |||
| 1638 | nmdc:mga0yw44_197472_c1 | |||
| 1639 | nmdc:mga0yw44_74778_c1 | |||
| 1640 | nmdc:mga0yw44_81377_c1 | |||
| 1641 | nmdc:mga0yw44_8868_c1 | |||
| 1642 | nmdc:mga0yw44_890176_c1 | |||
| 1643 | nmdc:mga06z11_756092_c1 | |||
| 1644 | nmdc:mga08y16_1013887_c1 | |||
| 1645 | nmdc:mga08y16_96490_c1 | |||
| 1646 | nmdc:mga0n895_353574_c1 | |||
| 1647 | nmdc:mga08x19_315563_c1 | |||
| 1648 | nmdc:mga08x19_59232_c1 | |||
| 1649 | Ga0495601_0038506 | |||
| 1650 | Ga0495601_0050898 | |||
| 1651 | Ga0495601_0207982 | |||
| 1652 | Ga0495601_0222607 | |||
| 1653 | Ga0495601_0268240 | |||
| 1654 | Ga0495612_0029167 | |||
| 1655 | Ga0495612_0099332 | |||
| 1656 | Ga0495612_0114955 | |||
| 1657 | Ga0495595_0003683 | |||
| 1658 | Ga0495595_0037451 | |||
| 1659 | Ga0495595_0099765 | |||
| 1660 | Ga0495595_0162465 | |||
| 1661 | Ga0495619_0023709 | |||
| 1662 | Ga0495619_0065986 | |||
| 1663 | Ga0495619_0132948 | |||
| 1664 | Ga0495619_0203513 | |||
| 1665 | Ga0495619_0334187 | |||
| 1666 | Ga0495619_0346137 | |||
| 1667 | Ga0495619_0604716 | |||
| 1668 | Ga0495619_0690966 | |||
| 1669 | Ga0495619_1025858 | |||
| 1670 | Ga0495619_1072403 | |||
| 1671 | Ga0500641_0019102 | |||
| 1672 | Ga0500554_033823 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r6a-assembly1.cif.gz_B | crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. | 0.9244 | 67 | 117 |
| 8aid-assembly2.cif.gz_D | crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 | 0.872 | 66 | 118 |
| 6isd-assembly1.cif.gz_B | crystal structure of arabidopsis thaliana hppd complexed with sulcotrione | 0.8354 | 66 | 116 |
| 7yvv-assembly1.cif.gz_A | acmp1, r-4-hydroxymandelate synthase | 0.8313 | 66 | 117 |
| 6bu2-assembly1.cif.gz_A | crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis | 0.8209 | 66 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r6aA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9157 | 67 | 118 | 3.10.180.10 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9049 | 68 | 118 | 3.30.720.110 |
| 2rk0B01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8494 | 68 | 118 | 3.10.180.10 |
| 2qh0A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.827 | 66 | 116 | 3.10.180.10 |
| af_L7N6B1_8_152_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8168 | 66 | 118 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838KVQ7-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9824 | 66 | 118 |
|
| AF-A0A2V7YWX1-F1-model_v4 | VOC family protein | 0.982 | 68 | 118 |
|
| AF-A0A087NA56-F1-model_v4 | VOC domain-containing protein | 0.9808 | 66 | 117 |
|
| AF-A0A4S8QHV1-F1-model_v4 | VOC family protein | 0.9753 | 66 | 118 |
|
| AF-A0A1G9JNR8-F1-model_v4 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein | 0.9748 | 68 | 117 |
GO:0051213
|