F482867

General Info

Members Datasets Scaffolds Average Seq Length
836 313 1672 117

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101973227|Ga0070682_1019732271
Length 125
Sequence MGRPVRKGRINMASPVVHFEIRSEDPDATRAFFGDLFGWTYPEGAFPGYSYVETGAQTIPGGIGPLQGGNEMVTFFVGVEDMDASLAAAKKLGGRVVQEPVGVPGVTFALIADPQGHVVGLAQQG

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
101 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
102 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
103 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
104 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
105 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
106 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
197 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
231 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 14
Rhizosphere 83.01
Stem 0
Stem Tuber 0
Unclassified 13.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101973227 3300005337 Unclassified 513
2 rootH1_10158853 3300003316 Bacteria 1283
3 JGI25404J52841_10020890 3300003659 Bacteria 1417
4 Ga0065707_10657283 3300005295 Bacteria 660
5 Ga0070658_10017013 3300005327 Bacteria 5819
6 Ga0070658_10106611 3300005327 Bacteria 2318
7 Ga0070683_100002777 3300005329 Bacteria 14001
8 Ga0070683_100193780 3300005329 Bacteria 1930
9 Ga0070683_100760310 3300005329 Bacteria 928
10 Ga0070690_100051285 3300005330 Bacteria 2633
11 Ga0070670_100555957 3300005331 Bacteria 1024
12 Ga0068869_100499772 3300005334 Bacteria 1015
13 Ga0068869_101643608 3300005334 Unclassified 572
14 Ga0070666_10999097 3300005335 Unclassified 620
15 Ga0070682_100034351 3300005337 Bacteria 3088
16 Ga0070682_100209735 3300005337 Bacteria 1380
17 Ga0070682_100735952 3300005337 Unclassified 794
18 Ga0068868_100175630 3300005338 Bacteria 1775
19 Ga0068868_100368288 3300005338 Bacteria 1234
20 Ga0068868_100637676 3300005338 Bacteria 947
21 Ga0068868_100705503 3300005338 Bacteria 903
22 Ga0068868_100961134 3300005338 Bacteria 779
23 Ga0068868_100966464 3300005338 Bacteria 777
24 Ga0070660_100160486 3300005339 Bacteria 1811
25 Ga0070660_101511170 3300005339 Bacteria 571
26 Ga0070689_100161259 3300005340 Bacteria 1813
27 Ga0070689_100661449 3300005340 Bacteria 909
28 Ga0070691_10333176 3300005341 Bacteria 838
29 Ga0070687_100039240 3300005343 Bacteria 2378
30 Ga0070687_101137085 3300005343 Bacteria 573
31 Ga0070661_100024614 3300005344 Bacteria 4319
32 Ga0070661_100042198 3300005344 Bacteria 3329
33 Ga0070692_10234971 3300005345 Bacteria 1090
34 Ga0070692_10302861 3300005345 Bacteria 976
35 Ga0070668_100183215 3300005347 Bacteria 1712
36 Ga0070671_100097364 3300005355 Bacteria 2467
37 Ga0070671_100804176 3300005355 Unclassified 819
38 Ga0070671_101840212 3300005355 Bacteria 538
39 Ga0070674_101273229 3300005356 Unclassified 655
40 Ga0070673_100090049 3300005364 Bacteria 2506
41 Ga0070688_100876388 3300005365 Bacteria 707
42 Ga0070659_100128946 3300005366 Bacteria 2053
43 Ga0070659_100132079 3300005366 Bacteria 2028
44 Ga0070667_100319123 3300005367 Bacteria 1402
45 Ga0070667_100989544 3300005367 Unclassified 784
46 Ga0070667_101320605 3300005367 Bacteria 676
47 Ga0070667_101568585 3300005367 Bacteria 619
48 Ga0070667_101909367 3300005367 Bacteria 559
49 Ga0070703_10019810 3300005406 Bacteria 1953
50 Ga0070709_10283712 3300005434 Bacteria 1204
51 Ga0070709_10378020 3300005434 Unclassified 1052
52 Ga0070714_100235461 3300005435 Bacteria 1688
53 Ga0070713_102395072 3300005436 Unclassified 510
54 Ga0070710_10335661 3300005437 Bacteria 996
55 Ga0070710_10694668 3300005437 Bacteria 717
56 Ga0070710_10769581 3300005437 Bacteria 685
57 Ga0070701_10125107 3300005438 Bacteria 1454
58 Ga0070711_100538183 3300005439 Unclassified 967
59 Ga0070711_100668055 3300005439 Bacteria 872
60 Ga0070711_100689172 3300005439 Unclassified 859
61 Ga0070705_100028447 3300005440 Unclassified 3061
62 Ga0070705_100423069 3300005440 Bacteria 992
63 Ga0070700_100169265 3300005441 Bacteria 1512
64 Ga0070694_100054366 3300005444 Bacteria 2712
65 Ga0070708_100560614 3300005445 Unclassified 1077
66 Ga0070708_101135067 3300005445 Unclassified 732
67 Ga0070663_100473643 3300005455 Bacteria 1036
68 Ga0070678_100204928 3300005456 Bacteria 1630
69 Ga0070678_102407749 3300005456 Bacteria 500
70 Ga0070662_100405564 3300005457 Bacteria 1126
71 Ga0070681_10198546 3300005458 Bacteria 1924
72 Ga0070681_10457842 3300005458 Bacteria 1188
73 Ga0070681_10655181 3300005458 Unclassified 965
74 Ga0068867_100559395 3300005459 Bacteria 992
75 Ga0070685_10143721 3300005466 Bacteria 1505
76 Ga0070685_11371272 3300005466 Unclassified 542
77 Ga0070706_100411672 3300005467 Bacteria 1259
78 Ga0070706_100959045 3300005467 Unclassified 789
79 Ga0070707_100199949 3300005468 Bacteria 1948
80 Ga0070698_100212619 3300005471 Bacteria 1868
81 Ga0070698_100604634 3300005471 Bacteria 1037
82 Ga0070679_100077935 3300005530 Bacteria 3303
83 Ga0070679_100698957 3300005530 Unclassified 957
84 Ga0070684_100004109 3300005535 Bacteria 11007
85 Ga0070684_100070363 3300005535 Bacteria 3079
86 Ga0068853_100400470 3300005539 Bacteria 1284
87 Ga0068853_100514534 3300005539 Bacteria 1131
88 Ga0070672_101057179 3300005543 Unclassified 721
89 Ga0070686_100117007 3300005544 Bacteria 1825
90 Ga0070695_101154019 3300005545 Bacteria 636
91 Ga0070696_100026859 3300005546 Bacteria 3918
92 Ga0070696_100790664 3300005546 Unclassified 780
93 Ga0070696_101328225 3300005546 Bacteria 611
94 Ga0070693_100049318 3300005547 Bacteria 2401
95 Ga0070665_100000454 3300005548 Bacteria 59667
96 Ga0070665_100352612 3300005548 Bacteria 1477
97 Ga0070704_100465046 3300005549 Bacteria 1092
98 Ga0068855_100048549 3300005563 Bacteria 5009
99 Ga0070664_100008592 3300005564 Bacteria 8263
100 Ga0070664_100076583 3300005564 Bacteria 2875
101 Ga0070664_102266846 3300005564 Unclassified 515
102 Ga0068857_100050320 3300005577 Bacteria 3697
103 Ga0068857_100087245 3300005577 Bacteria 2791
104 Ga0068857_101988364 3300005577 Bacteria 570
105 Ga0068854_100044673 3300005578 Bacteria 3146
106 Ga0068856_100026056 3300005614 Bacteria 5702
107 Ga0068856_100761888 3300005614 Bacteria 988
108 Ga0070702_100021100 3300005615 Bacteria 3422
109 Ga0070702_100044869 3300005615 Bacteria 2498
110 Ga0070702_100605588 3300005615 Bacteria 822
111 Ga0070702_100764115 3300005615 Bacteria 743
112 Ga0070702_101397767 3300005615 Bacteria 572
113 Ga0068852_100300499 3300005616 Bacteria 1553
114 Ga0068852_100673686 3300005616 Bacteria 1043
115 Ga0068859_100379305 3300005617 Bacteria 1509
116 Ga0068859_102872236 3300005617 Unclassified 528
117 Ga0068864_100008792 3300005618 Bacteria 8327
118 Ga0068864_100034777 3300005618 Bacteria 4287
119 Ga0068864_100368308 3300005618 Bacteria 1359
120 Ga0068864_100483642 3300005618 Bacteria 1189
121 Ga0068866_10044525 3300005718 Bacteria 2221
122 Ga0068866_11429310 3300005718 Unclassified 506
123 Ga0068861_100252382 3300005719 Unclassified 1506
124 Ga0068861_100316319 3300005719 Bacteria 1358
125 Ga0068861_100921594 3300005719 Bacteria 829
126 Ga0068861_101894599 3300005719 Bacteria 593
127 Ga0068851_10066951 3300005834 Bacteria 1851
128 Ga0068870_10080129 3300005840 Bacteria 1803
129 Ga0068863_100041626 3300005841 Bacteria 4369
130 Ga0068858_100197110 3300005842 Bacteria 1903
131 Ga0068858_100307555 3300005842 Bacteria 1513
132 Ga0068860_100042001 3300005843 Bacteria 4369
133 Ga0068860_100312123 3300005843 Bacteria 1542
134 Ga0068860_100336634 3300005843 Bacteria 1483
135 Ga0068862_100736240 3300005844 Bacteria 958
136 Ga0081540_1000511 3300005983 Bacteria 38044
137 Ga0081540_1295139 3300005983 Bacteria 558
138 Ga0070717_10871629 3300006028 Bacteria 819
139 Ga0075365_10011417 3300006038 Bacteria 5222
140 Ga0075365_10025856 3300006038 Bacteria 3720
141 Ga0075365_10031223 3300006038 Bacteria 3417
142 Ga0075365_10087628 3300006038 Bacteria 2117
143 Ga0075365_10147243 3300006038 Bacteria 1637
144 Ga0075365_11169898 3300006038 Bacteria 541
145 Ga0075363_100471937 3300006048 Bacteria 743
146 Ga0075364_10064194 3300006051 Bacteria 2410
147 Ga0075364_10510047 3300006051 Bacteria 822
148 Ga0075432_10052081 3300006058 Bacteria 1446
149 Ga0070715_10013333 3300006163 Bacteria 3016
150 Ga0070715_10271235 3300006163 Unclassified 895
151 Ga0070716_100134774 3300006173 Bacteria 1566
152 Ga0070716_100314008 3300006173 Unclassified 1095
153 Ga0070712_100395861 3300006175 Unclassified 1140
154 Ga0070712_100690509 3300006175 Unclassified 869
155 Ga0070712_100912665 3300006175 Bacteria 758
156 Ga0097621_100156961 3300006237 Bacteria 1953
157 Ga0068871_100257938 3300006358 Bacteria 1520
158 Ga0068871_101856580 3300006358 Unclassified 572
159 Ga0068871_102157574 3300006358 Bacteria 531
160 Ga0075428_101124778 3300006844 Unclassified 829
161 Ga0075434_100711685 3300006871 Bacteria 1021
162 Ga0075434_101494250 3300006871 Bacteria 685
163 Ga0068865_100309903 3300006881 Bacteria 1266
164 Ga0068865_100375236 3300006881 Bacteria 1158
165 Ga0075436_100265941 3300006914 Unclassified 1224
166 Ga0075436_100836534 3300006914 Bacteria 687
167 Ga0097620_100379294 3300006931 Bacteria 1509
168 Ga0097620_102872544 3300006931 Unclassified 528
169 Ga0105244_10215167 3300009036 Bacteria 903
170 Ga0105245_10000507 3300009098 Bacteria 35762
171 Ga0105245_10003390 3300009098 Bacteria 14272
172 Ga0105245_10180198 3300009098 Bacteria 2018
173 Ga0105245_10458120 3300009098 Unclassified 1285
174 Ga0105245_10628436 3300009098 Bacteria 1102
175 Ga0105245_11549452 3300009098 Bacteria 714
176 Ga0105245_12709298 3300009098 Bacteria 549
177 Ga0105247_10092010 3300009101 Bacteria 1927
178 Ga0105247_10388421 3300009101 Bacteria 991
179 Ga0105247_10461591 3300009101 Bacteria 918
180 Ga0105247_11154540 3300009101 Unclassified 614
181 Ga0105243_10066434 3300009148 Bacteria 2900
182 Ga0105243_10113757 3300009148 Bacteria 2270
183 Ga0105241_10409039 3300009174 Bacteria 1192
184 Ga0105241_11500802 3300009174 Bacteria 649
185 Ga0105242_10035942 3300009176 Bacteria 3972
186 Ga0105242_10452914 3300009176 Bacteria 1210
187 Ga0105242_10528375 3300009176 Bacteria 1127
188 Ga0105242_10541896 3300009176 Bacteria 1114
189 Ga0105242_10715277 3300009176 Bacteria 982
190 Ga0105242_13269090 3300009176 Unclassified 504
191 Ga0105248_10068019 3300009177 Bacteria 3999
192 Ga0105248_10101079 3300009177 Bacteria 3250
193 Ga0105248_10326803 3300009177 Bacteria 1727
194 Ga0105237_10658689 3300009545 Bacteria 1054
195 Ga0105237_11522722 3300009545 Bacteria 676
196 Ga0105238_10125857 3300009551 Bacteria 2541
197 Ga0105238_10269752 3300009551 Bacteria 1682
198 Ga0105238_10742587 3300009551 Unclassified 995
199 Ga0105238_10915319 3300009551 Unclassified 896
200 Ga0105238_11364068 3300009551 Bacteria 736
201 Ga0105249_10083011 3300009553 Bacteria 2982
202 Ga0105249_10634891 3300009553 Bacteria 1125
203 Ga0105249_11631544 3300009553 Bacteria 717
204 Ga0105249_11897479 3300009553 Bacteria 668
205 Ga0105239_10003323 3300010375 Bacteria 19789
206 Ga0105239_11331788 3300010375 Bacteria 828
207 Ga0105239_11356405 3300010375 Bacteria 821
208 Ga0105239_11793038 3300010375 Unclassified 711
209 Ga0105246_10002642 3300011119 Bacteria 10859
210 Ga0105246_10248110 3300011119 Bacteria 1411
211 Ga0157321_1007050 3300012487 Bacteria 782
212 Ga0157329_1030771 3300012491 Bacteria 557
213 Ga0157341_1034637 3300012494 Unclassified 561
214 Ga0157319_1004395 3300012497 Bacteria 925
215 Ga0157347_1024527 3300012502 Bacteria 725
216 Ga0157342_1008070 3300012507 Bacteria 1035
217 Ga0157315_1040902 3300012508 Unclassified 587
218 Ga0157326_1031470 3300012513 Unclassified 705
219 Ga0157338_1008470 3300012515 Bacteria 997
220 Ga0157373_10811167 3300013100 Unclassified 690
221 Ga0157371_10050824 3300013102 Bacteria 2946
222 Ga0157370_10871986 3300013104 Bacteria 817
223 Ga0157370_11830590 3300013104 Unclassified 545
224 Ga0157369_10105011 3300013105 Bacteria 3007
225 Ga0157369_10410743 3300013105 Bacteria 1404
226 Ga0157369_10528344 3300013105 Bacteria 1220
227 Ga0157369_10867312 3300013105 Bacteria 926
228 Ga0157369_11878462 3300013105 Bacteria 608
229 Ga0157369_11913527 3300013105 Bacteria 602
230 Ga0157374_10840809 3300013296 Bacteria 934
231 Ga0157374_11450350 3300013296 Bacteria 709
232 Ga0163162_10052280 3300013306 Bacteria 4103
233 Ga0163162_10167959 3300013306 Bacteria 2318
234 Ga0163162_10767235 3300013306 Bacteria 1083
235 Ga0163162_10832251 3300013306 Bacteria 1039
236 Ga0163162_11627860 3300013306 Unclassified 737
237 Ga0157372_10001454 3300013307 Bacteria 25656
238 Ga0157372_10518031 3300013307 Bacteria 1390
239 Ga0157372_11659274 3300013307 Bacteria 736
240 Ga0157372_12297833 3300013307 Unclassified 619
241 Ga0157372_13433854 3300013307 Bacteria 504
242 Ga0157375_10023644 3300013308 Bacteria 5673
243 Ga0157375_10050509 3300013308 Bacteria 4079
244 Ga0157375_10763685 3300013308 Bacteria 1117
245 Ga0157375_10923426 3300013308 Unclassified 1016
246 Ga0157375_11034154 3300013308 Unclassified 960
247 Ga0163163_10026127 3300014325 Bacteria 5576
248 Ga0163163_10038578 3300014325 Unclassified 4657
249 Ga0163163_10045078 3300014325 Bacteria 4328
250 Ga0163163_10122930 3300014325 Unclassified 2630
251 Ga0163163_10817832 3300014325 Bacteria 995
252 Ga0163163_11145524 3300014325 Bacteria 840
253 Ga0157377_10155318 3300014745 Bacteria 1418
254 Ga0157377_10177223 3300014745 Bacteria 1338
255 Ga0157379_10022699 3300014968 Bacteria 5561
256 Ga0157376_10238908 3300014969 Bacteria 1692
257 Ga0157376_10432794 3300014969 Unclassified 1279
258 Ga0157376_10654969 3300014969 Bacteria 1051
259 Ga0157376_11523544 3300014969 Bacteria 702
260 Ga0163161_10129903 3300017792 Bacteria 1899
261 Ga0163161_10445235 3300017792 Bacteria 1046
262 Ga0206356_11334568 3300020070 Bacteria 1078
263 Ga0206353_10987813 3300020082 Bacteria 1398
264 Ga0206353_11910781 3300020082 Bacteria 1232
265 Ga0207697_10449167 3300025315 Unclassified 571
266 Ga0207656_10096879 3300025321 Bacteria 1347
267 Ga0207713_1133944 3300025735 Bacteria 816
268 Ga0207653_10004486 3300025885 Bacteria 4378
269 Ga0207692_10479506 3300025898 Bacteria 787
270 Ga0207642_10346712 3300025899 Bacteria 875
271 Ga0207710_10222177 3300025900 Bacteria 938
272 Ga0207688_10008202 3300025901 Bacteria 5676
273 Ga0207688_10066926 3300025901 Bacteria 2033
274 Ga0207688_10482074 3300025901 Bacteria 775
275 Ga0207688_10672897 3300025901 Bacteria 654
276 Ga0207680_10326895 3300025903 Bacteria 1073
277 Ga0207647_10064422 3300025904 Unclassified 2227
278 Ga0207685_10012045 3300025905 Bacteria 2626
279 Ga0207699_10134705 3300025906 Bacteria 1616
280 Ga0207699_10429996 3300025906 Unclassified 944
281 Ga0207699_10864917 3300025906 Unclassified 666
282 Ga0207645_10506588 3300025907 Bacteria 818
283 Ga0207643_10010619 3300025908 Bacteria 4962
284 Ga0207705_10756903 3300025909 Bacteria 755
285 Ga0207705_10870355 3300025909 Unclassified 698
286 Ga0207684_10499489 3300025910 Unclassified 1043
287 Ga0207684_10501376 3300025910 Unclassified 1040
288 Ga0207707_10259122 3300025912 Bacteria 1509
289 Ga0207707_10384219 3300025912 Bacteria 1207
290 Ga0207707_10683852 3300025912 Bacteria 863
291 Ga0207695_10180348 3300025913 Bacteria 2033
292 Ga0207693_10075020 3300025915 Bacteria 2648
293 Ga0207693_10401995 3300025915 Unclassified 1071
294 Ga0207663_10304935 3300025916 Unclassified 1191
295 Ga0207663_10359577 3300025916 Bacteria 1104
296 Ga0207663_10627798 3300025916 Bacteria 846
297 Ga0207662_10017649 3300025918 Bacteria 4039
298 Ga0207662_10109933 3300025918 Bacteria 1717
299 Ga0207662_11282698 3300025918 Bacteria 520
300 Ga0207657_10041435 3300025919 Bacteria 4072
301 Ga0207649_10248589 3300025920 Bacteria 1280
302 Ga0207652_10244952 3300025921 Bacteria 1616
303 Ga0207646_11119264 3300025922 Bacteria 692
304 Ga0207694_10316871 3300025924 Bacteria 1286
305 Ga0207694_10930675 3300025924 Unclassified 735
306 Ga0207687_10023515 3300025927 Bacteria 4109
307 Ga0207687_10111018 3300025927 Bacteria 2035
308 Ga0207687_10971060 3300025927 Bacteria 728
309 Ga0207700_10019697 3300025928 Bacteria 4562
310 Ga0207700_10136131 3300025928 Bacteria 2012
311 Ga0207700_11533811 3300025928 Unclassified 591
312 Ga0207664_10006036 3300025929 Bacteria 8295
313 Ga0207664_10298236 3300025929 Bacteria 1417
314 Ga0207664_10584366 3300025929 Bacteria 1003
315 Ga0207644_10513359 3300025931 Bacteria 989
316 Ga0207644_10757572 3300025931 Bacteria 811
317 Ga0207690_10115881 3300025932 Bacteria 1937
318 Ga0207690_10120595 3300025932 Bacteria 1904
319 Ga0207706_10044432 3300025933 Bacteria 3937
320 Ga0207706_10193729 3300025933 Bacteria 1783
321 Ga0207686_10490592 3300025934 Bacteria 951
322 Ga0207686_10787646 3300025934 Bacteria 761
323 Ga0207709_10081727 3300025935 Bacteria 2084
324 Ga0207709_10270770 3300025935 Bacteria 1250
325 Ga0207709_10929046 3300025935 Unclassified 708
326 Ga0207669_10401747 3300025937 Unclassified 1074
327 Ga0207669_10740505 3300025937 Bacteria 811
328 Ga0207669_11229800 3300025937 Unclassified 635
329 Ga0207704_10036924 3300025938 Bacteria 2816
330 Ga0207704_11430150 3300025938 Bacteria 593
331 Ga0207665_10011778 3300025939 Bacteria 5748
332 Ga0207711_10372316 3300025941 Unclassified 1325
333 Ga0207711_10901137 3300025941 Bacteria 822
334 Ga0207689_10479299 3300025942 Bacteria 1041
335 Ga0207689_11121737 3300025942 Unclassified 663
336 Ga0207661_10030249 3300025944 Bacteria 4169
337 Ga0207661_10035726 3300025944 Bacteria 3875
338 Ga0207661_10102164 3300025944 Bacteria 2410
339 Ga0207661_10730888 3300025944 Bacteria 911
340 Ga0207667_10650611 3300025949 Bacteria 1059
341 Ga0207667_11469205 3300025949 Bacteria 653
342 Ga0207651_10099613 3300025960 Bacteria 2153
343 Ga0207712_10118944 3300025961 Bacteria 1995
344 Ga0207668_10289040 3300025972 Bacteria 1348
345 Ga0207658_10103451 3300025986 Bacteria 2236
346 Ga0207658_10851416 3300025986 Unclassified 829
347 Ga0207677_10138864 3300026023 Bacteria 1857
348 Ga0207677_10552365 3300026023 Bacteria 1004
349 Ga0207677_10718101 3300026023 Bacteria 888
350 Ga0207703_10027357 3300026035 Bacteria 4491
351 Ga0207639_10022237 3300026041 Bacteria 4565
352 Ga0207639_10081429 3300026041 Bacteria 2564
353 Ga0207678_10006761 3300026067 Bacteria 10170
354 Ga0207708_10147472 3300026075 Bacteria 1850
355 Ga0207702_10143150 3300026078 Bacteria 2166
356 Ga0207702_10294748 3300026078 Bacteria 1538
357 Ga0207702_10367667 3300026078 Bacteria 1380
358 Ga0207702_10454039 3300026078 Bacteria 1244
359 Ga0207702_11402060 3300026078 Unclassified 692
360 Ga0207641_10064133 3300026088 Bacteria 3139
361 Ga0207648_12012055 3300026089 Bacteria 539
362 Ga0207676_10725502 3300026095 Bacteria 965
363 Ga0207674_10013926 3300026116 Bacteria 8897
364 Ga0207674_10029558 3300026116 Bacteria 5769
365 Ga0207675_100011145 3300026118 Bacteria 8420
366 Ga0207675_100504087 3300026118 Bacteria 1205
367 Ga0207675_100790741 3300026118 Bacteria 962
368 Ga0207683_10042923 3300026121 Bacteria 3949
369 Ga0207683_11419244 3300026121 Bacteria 642
370 Ga0207683_11794931 3300026121 Unclassified 562
371 Ga0207698_10610869 3300026142 Bacteria 1076
372 Ga0268266_10002426 3300028379 Bacteria 20068
373 Ga0268266_10987103 3300028379 Bacteria 815
374 Ga0268265_10342554 3300028380 Bacteria 1362
375 Ga0268265_10606665 3300028380 Bacteria 1047
376 Ga0268265_11347412 3300028380 Bacteria 715
377 Ga0268264_10046222 3300028381 Bacteria 3615
378 Ga0268264_10305489 3300028381 Bacteria 1499
379 Ga0265336_10003154 3300028666 Bacteria 6560
380 Ga0265338_10013289 3300028800 Bacteria 9309
381 Ga0265328_10169373 3300031239 Bacteria 825
382 Ga0265316_10191250 3300031344 Bacteria 1520
383 Ga0307405_10000521 3300031731 Bacteria 14517
384 Ga0307413_10278852 3300031824 Bacteria 1256
385 Ga0307406_10410633 3300031901 Unclassified 1076
386 Ga0307407_10004634 3300031903 Bacteria 5866
387 Ga0307409_100002261 3300031995 Bacteria 9966
388 Ga0307415_100000320 3300032126 Bacteria 20808
389 Ga0373950_0098097 3300034818 Unclassified 629
390 Ga0373959_0138781 3300034820 Bacteria 607
391 Ga0373938_0208901 3300034957 Unclassified 544
392 Ga0373926_0000166 3300035083 Bacteria 14543
393 Ga0373926_0144176 3300035083 Bacteria 905
394 Ga0373929_0170024 3300035085 Unclassified 595
395 Ga0373934_0019215 3300035086 Bacteria 2621
396 Ga0373934_0026766 3300035086 Bacteria 2237
397 Ga0373934_0043382 3300035086 Bacteria 1777
398 Ga0373934_0090305 3300035086 Bacteria 1234
399 Ga0373940_0140728 3300035088 Bacteria 763
400 Ga0373944_0000832 3300035089 Bacteria 7580
401 Ga0373944_0266316 3300035089 Bacteria 636
402 Ga0373949_0070805 3300035090 Unclassified 913
403 Ga0373951_0013761 3300035091 Bacteria 1818
404 Ga0373952_0030402 3300035092 Bacteria 1196
405 Ga0373923_0015161 3300035111 Bacteria 2906
406 Ga0373923_0065268 3300035111 Bacteria 1553
407 Ga0373932_0018462 3300035112 Bacteria 1804
408 Ga0373932_0308192 3300035112 Unclassified 592
409 Ga0373936_0000370 3300035113 Bacteria 15234
410 Ga0373936_0002034 3300035113 Bacteria 7484
411 Ga0373941_0068059 3300035115 Bacteria 1175
412 Ga0373945_0000457 3300035116 Bacteria 11510
413 Ga0373945_0037511 3300035116 Bacteria 1740
414 Ga0373953_0000247 3300035117 Bacteria 14687
415 Ga0373953_0010251 3300035117 Bacteria 3253
416 Ga0373953_0024201 3300035117 Bacteria 2307
417 Ga0373953_0059604 3300035117 Bacteria 1558
418 Ga0373953_0303088 3300035117 Bacteria 697
419 Ga0373954_0009828 3300035118 Bacteria 4210
420 Ga0373954_0045688 3300035118 Bacteria 2046
421 Ga0373954_0219507 3300035118 Bacteria 935
422 Ga0373954_0352807 3300035118 Bacteria 726
423 Ga0373954_0671405 3300035118 Bacteria 514
424 Ga0373956_0002403 3300035119 Bacteria 7642
425 Ga0373956_0009246 3300035119 Bacteria 4001
426 Ga0373956_0012780 3300035119 Bacteria 3485
427 Ga0373956_0046501 3300035119 Bacteria 1939
428 Ga0373957_0000304 3300035120 Bacteria 12323
429 Ga0373957_0000360 3300035120 Bacteria 11609
430 Ga0373957_0109859 3300035120 Bacteria 1110
431 Ga0373957_0119187 3300035120 Bacteria 1067
432 Ga0373957_0159997 3300035120 Bacteria 927
433 Ga0373957_0334606 3300035120 Bacteria 645
434 Ga0373960_0109282 3300035121 Unclassified 905
435 Ga0373943_0000067 3300035170 Bacteria 36676
436 Ga0373943_0023869 3300035170 Plasmid 2847
437 Ga0373946_0000440 3300035171 Bacteria 13618
438 Ga0373946_0024508 3300035171 Bacteria 2365
439 Ga0373955_0016960 3300035172 Bacteria 3592
440 Ga0373955_0044551 3300035172 Bacteria 2390
441 Ga0373955_0195523 3300035172 Bacteria 1203
442 Ga0373955_0474892 3300035172 Bacteria 763
443 Ga0373942_0105845 3300035207 Unclassified 865
444 Ga0373942_0377515 3300035207 Bacteria 505
445 Ga0373961_0210240 3300035241 Bacteria 690
446 Ga0373961_0400329 3300035241 Unclassified 527
447 Ga0373924_0000135 3300035410 Bacteria 21359
448 Ga0373924_0000415 3300035410 Bacteria 13089
449 Ga0373924_0001322 3300035410 Bacteria 7976
450 Ga0373924_0043596 3300035410 Bacteria 1843
451 Ga0373931_0051796 3300035691 Bacteria 2187
452 Ga0373931_0147990 3300035691 Bacteria 1366
453 Ga0373931_1260198 3300035691 Bacteria 508
454 Ga0373935_0031649 3300035692 Bacteria 3284
455 Ga0373935_0637472 3300035692 Bacteria 781
456 Ga0373927_0001544 3300035695 Bacteria 17283
457 Ga0373927_0173696 3300035695 Bacteria 1413
458 Ga0373927_0904243 3300035695 Bacteria 583
459 Ga0373933_0000003 3300035724 Bacteria 150420
460 Ga0373933_0065897 3300035724 Bacteria 2193
461 Ga0373933_0109663 3300035724 Bacteria 1720
462 Ga0373933_1059056 3300035724 Bacteria 534
463 Ga0373933_1091139 3300035724 Bacteria 526
464 Ga0373947_0007085 3300035725 Bacteria 6498
465 Ga0373947_0079368 3300035725 Bacteria 2028
466 Ga0373947_0321073 3300035725 Bacteria 1035
467 Ga0373947_0383648 3300035725 Bacteria 946
468 Ga0373937_0000016 3300036401 Bacteria 145523
469 Ga0373937_0002125 3300036401 Bacteria 16562
470 Ga0373937_0090703 3300036401 Bacteria 2830
471 Ga0373937_0135144 3300036401 Bacteria 2305
472 Ga0373937_0205630 3300036401 Bacteria 1851
473 Ga0373925_0007534 3300037068 Bacteria 7936
474 Ga0373925_0015037 3300037068 Bacteria 5594
475 Ga0373925_0029048 3300037068 Bacteria 4055
476 Ga0373925_0102584 3300037068 Bacteria 2201
477 Ga0451789_0881630 3300041443 Bacteria 820
478 Ga0451804_0805710 3300041463 Bacteria 569
479 Ga0451849_0698324 3300041505 Bacteria 516
480 Ga0451853_1874758 3300041512 Bacteria 1592
481 Ga0451853_2678561 3300041512 Bacteria 680
482 Ga0451853_2682677 3300041512 Bacteria 1013
483 Ga0451577_0358532 3300042876 Unclassified 1323
484 Ga0466963_0244432 3300044694 Unclassified 1259
485 Ga0451576_0264268 3300045051 Bacteria 1799
486 Ga0495592_0000116 3300046454 Bacteria 70091
487 Ga0495592_0015971 3300046454 Bacteria 5696
488 Ga0495592_0054550 3300046454 Bacteria 2961
489 Ga0495592_0232250 3300046454 Bacteria 1227
490 Ga0495592_0391860 3300046454 Bacteria 882
491 Ga0495592_0529405 3300046454 Bacteria 727
492 Ga0495603_0001523 3300046455 Bacteria 13527
493 Ga0495603_0045820 3300046455 Bacteria 2607
494 Ga0495629_0003493 3300046459 Bacteria 11888
495 Ga0495629_0064070 3300046459 Bacteria 2566
496 Ga0495629_0169881 3300046459 Bacteria 1513
497 Ga0495629_0365901 3300046459 Bacteria 982
498 Ga0495641_0003782 3300046461 Bacteria 11100
499 Ga0495641_0007807 3300046461 Bacteria 6623
500 Ga0495641_0008033 3300046461 Bacteria 6495
501 Ga0495641_0062768 3300046461 Bacteria 1675
502 Ga0495641_0165956 3300046461 Bacteria 988
503 Ga0495641_0184160 3300046461 Bacteria 935
504 Ga0495651_0000009 3300046462 Bacteria 150455
505 Ga0495651_0009543 3300046462 Bacteria 7455
506 Ga0495651_0039359 3300046462 Bacteria 3681
507 Ga0495651_0060369 3300046462 Bacteria 2904
508 Ga0495651_0113575 3300046462 Bacteria 1999
509 Ga0495653_0001057 3300046463 Bacteria 21196
510 Ga0495653_0024626 3300046463 Bacteria 4846
511 Ga0495653_0173953 3300046463 Bacteria 1483
512 Ga0495653_0877904 3300046463 Unclassified 535
513 Ga0495653_0908170 3300046463 Bacteria 524
514 Ga0495580_0035745 3300046472 Bacteria 3571
515 Ga0495580_0089073 3300046472 Bacteria 2148
516 Ga0495582_0000375 3300046473 Bacteria 24407
517 Ga0495582_0002790 3300046473 Bacteria 9756
518 Ga0495582_0142355 3300046473 Bacteria 1359
519 Ga0495582_0316946 3300046473 Bacteria 897
520 Ga0495582_0395227 3300046473 Bacteria 797
521 Ga0495639_0000548 3300046475 Bacteria 17449
522 Ga0495639_0040452 3300046475 Bacteria 2097
523 Ga0495639_0305244 3300046475 Unclassified 794
524 Ga0495639_0342680 3300046475 Bacteria 749
525 Ga0495662_0004647 3300046476 Bacteria 6891
526 Ga0495662_0007763 3300046476 Bacteria 5283
527 Ga0495662_0018685 3300046476 Bacteria 3356
528 Ga0495664_0004540 3300046477 Bacteria 7594
529 Ga0495664_0007915 3300046477 Bacteria 5916
530 Ga0495594_0136825 3300046499 Bacteria 1389
531 Ga0495594_0171907 3300046499 Bacteria 1233
532 Ga0495608_0000019 3300046511 Bacteria 180119
533 Ga0495608_0015096 3300046511 Bacteria 5358
534 Ga0495608_0035914 3300046511 Bacteria 3338
535 Ga0495608_0378966 3300046511 Bacteria 867
536 Ga0495608_0396924 3300046511 Unclassified 844
537 Ga0495608_0897605 3300046511 Bacteria 519
538 Ga0495618_0001073 3300046514 Bacteria 18665
539 Ga0495618_0410798 3300046514 Bacteria 826
540 Ga0495628_0000487 3300046516 Bacteria 36399
541 Ga0495628_0178455 3300046516 Bacteria 1607
542 Ga0495628_0241658 3300046516 Bacteria 1350
543 Ga0495628_0313640 3300046516 Bacteria 1158
544 Ga0495628_0512736 3300046516 Bacteria 865
545 Ga0495630_0004836 3300046517 Bacteria 9447
546 Ga0495630_0044423 3300046517 Bacteria 3320
547 Ga0495630_0049458 3300046517 Bacteria 3146
548 Ga0495666_0025075 3300046526 Bacteria 2946
549 Ga0495666_0141735 3300046526 Bacteria 1120
550 Ga0495652_0000430 3300046529 Bacteria 49080
551 Ga0495652_0035590 3300046529 Bacteria 4333
552 Ga0495652_0037892 3300046529 Bacteria 4180
553 Ga0495652_0306386 3300046529 Bacteria 1152
554 Ga0495652_0373095 3300046529 Bacteria 1016
555 Ga0495652_0713384 3300046529 Bacteria 674
556 Ga0495665_0000236 3300046531 Bacteria 27659
557 Ga0495665_0008820 3300046531 Bacteria 5473
558 Ga0495665_0041157 3300046531 Bacteria 2459
559 Ga0495640_0008891 3300046533 Bacteria 7846
560 Ga0495640_0017655 3300046533 Bacteria 5311
561 Ga0495640_0022194 3300046533 Bacteria 4644
562 Ga0495640_0568740 3300046533 Bacteria 686
563 Ga0495586_0008635 3300046535 Bacteria 5423
564 Ga0495587_0000041 3300046536 Bacteria 110168
565 Ga0495587_0080415 3300046536 Bacteria 1889
566 Ga0495587_0138878 3300046536 Bacteria 1387
567 Ga0495587_0218624 3300046536 Bacteria 1075
568 Ga0495587_0376772 3300046536 Bacteria 789
569 Ga0495645_0029423 3300046543 Bacteria 3994
570 Ga0495645_0110029 3300046543 Bacteria 1950
571 Ga0495645_0176939 3300046543 Bacteria 1465
572 Ga0495645_0471893 3300046543 Bacteria 788
573 Ga0495645_0493386 3300046543 Bacteria 766
574 Ga0495622_0061572 3300046557 Bacteria 1737
575 Ga0495667_0000037 3300046559 Bacteria 133780
576 Ga0495667_0000557 3300046559 Bacteria 23816
577 Ga0495667_0005966 3300046559 Bacteria 8237
578 Ga0495667_0032678 3300046559 Bacteria 3485
579 Ga0495667_0216908 3300046559 Bacteria 1222
580 Ga0495667_0448152 3300046559 Bacteria 811
581 Ga0495656_0448327 3300046615 Bacteria 680
582 Ga0495634_0003394 3300046642 Bacteria 12784
583 Ga0495634_0020321 3300046642 Bacteria 4711
584 Ga0495634_0034577 3300046642 Bacteria 3467
585 Ga0495634_0166102 3300046642 Bacteria 1389
586 Ga0495635_0010520 3300046663 Bacteria 6476
587 Ga0495635_0024939 3300046663 Bacteria 4166
588 Ga0495635_0046089 3300046663 Bacteria 3007
589 Ga0495588_0211382 3300046674 Unclassified 1024
590 Ga0495657_0000094 3300046675 Bacteria 78779
591 Ga0495657_0006691 3300046675 Bacteria 8996
592 Ga0495657_0012007 3300046675 Bacteria 6448
593 Ga0495657_0018831 3300046675 Bacteria 4990
594 Ga0495657_0227015 3300046675 Bacteria 1130
595 Ga0495657_0454480 3300046675 Unclassified 750
596 Ga0495599_0000040 3300046678 Bacteria 97423
597 Ga0495599_0028865 3300046678 Bacteria 3476
598 Ga0495599_0139720 3300046678 Bacteria 1503
599 Ga0495599_0243266 3300046678 Bacteria 1096
600 Ga0495599_0305225 3300046678 Unclassified 960
601 Ga0495599_0603583 3300046678 Unclassified 639
602 Ga0495623_0000284 3300046679 Bacteria 32990
603 Ga0495623_0017741 3300046679 Bacteria 4597
604 Ga0495623_0091013 3300046679 Bacteria 1872
605 Ga0495623_0220134 3300046679 Bacteria 1082
606 Ga0495646_0006814 3300046680 Bacteria 7251
607 Ga0495646_0016988 3300046680 Bacteria 4620
608 Ga0495646_0141043 3300046680 Bacteria 1347
609 Ga0495646_0228716 3300046680 Bacteria 1003
610 Ga0495647_0003459 3300046681 Bacteria 5050
611 Ga0495647_0038703 3300046681 Bacteria 1804
612 Ga0495658_0004141 3300046683 Bacteria 7144
613 Ga0495658_0047633 3300046683 Bacteria 2414
614 Ga0495658_0079721 3300046683 Bacteria 1919
615 Ga0495658_0260449 3300046683 Unclassified 1092
616 Ga0495658_0375546 3300046683 Bacteria 905
617 Ga0495613_0003464 3300046689 Bacteria 11801
618 Ga0495613_0016362 3300046689 Bacteria 5526
619 Ga0495613_0048337 3300046689 Bacteria 3141
620 Ga0495613_0131034 3300046689 Bacteria 1796
621 Ga0495624_0007166 3300046690 Bacteria 7848
622 Ga0495624_0009694 3300046690 Bacteria 6666
623 Ga0495624_0022917 3300046690 Bacteria 4120
624 Ga0495624_0200386 3300046690 Unclassified 1213
625 Ga0495600_0002749 3300046809 Bacteria 10193
626 Ga0495600_0003484 3300046809 Bacteria 9248
627 Ga0495600_0012423 3300046809 Bacteria 5324
628 Ga0495600_0074799 3300046809 Bacteria 2212
629 Ga0495600_0108435 3300046809 Bacteria 1808
630 Ga0495600_0246810 3300046809 Bacteria 1136
631 Ga0495600_0369644 3300046809 Unclassified 896
632 Ga0495600_0467442 3300046809 Unclassified 778
633 Ga0495600_0888438 3300046809 Unclassified 526
634 Ga0495581_0001463 3300047315 Bacteria 13122
635 Ga0495581_0014631 3300047315 Bacteria 4549
636 Ga0495604_0000040 3300047317 Bacteria 120837
637 Ga0495604_0011031 3300047317 Bacteria 7172
638 Ga0495604_0136708 3300047317 Bacteria 1755
639 Ga0495604_0456142 3300047317 Bacteria 834
640 Ga0495604_0645470 3300047317 Bacteria 675
641 Ga0495674_0013104 3300047319 Bacteria 7798
642 Ga0495674_0021106 3300047319 Bacteria 6026
643 Ga0495674_0030767 3300047319 Bacteria 4878
644 Ga0495674_0293455 3300047319 Bacteria 1329
645 Ga0495674_0399258 3300047319 Bacteria 1110
646 Ga0495674_0799749 3300047319 Bacteria 733
647 Ga0495676_0002726 3300047321 Bacteria 15847
648 Ga0495676_0021095 3300047321 Bacteria 5701
649 Ga0495676_0135210 3300047321 Bacteria 1774
650 Ga0495676_0582863 3300047321 Bacteria 729
651 Ga0495676_0908765 3300047321 Unclassified 564
652 Ga0495680_0000010 3300047322 Bacteria 142931
653 Ga0495680_0018534 3300047322 Bacteria 5902
654 Ga0495680_0022123 3300047322 Bacteria 5308
655 Ga0495680_0044621 3300047322 Bacteria 3504
656 Ga0495680_0068326 3300047322 Bacteria 2715
657 Ga0495675_0000111 3300047444 Bacteria 58822
658 Ga0495675_0002537 3300047444 Bacteria 10930
659 Ga0495675_0051392 3300047444 Bacteria 2617
660 Ga0495675_0113964 3300047444 Bacteria 1686
661 Ga0495675_0438768 3300047444 Unclassified 757
662 Ga0495684_0004232 3300047471 Bacteria 11206
663 Ga0495684_0015780 3300047471 Bacteria 5813
664 Ga0495684_0016426 3300047471 Bacteria 5700
665 Ga0495684_0556643 3300047471 Bacteria 780
666 Ga0495684_0564922 3300047471 Bacteria 772
667 Ga0495684_0970435 3300047471 Bacteria 542
668 Ga0495593_0000748 3300047673 Bacteria 18892
669 Ga0495593_0003299 3300047673 Bacteria 9671
670 Ga0495593_0004950 3300047673 Bacteria 7897
671 Ga0495593_0122801 3300047673 Bacteria 1321
672 Ga0495593_0164877 3300047673 Bacteria 1118
673 Ga0495602_0000130 3300048088 Bacteria 71178
674 Ga0495602_0025325 3300048088 Bacteria 5743
675 Ga0495602_0034481 3300048088 Bacteria 4734
676 Ga0495602_0034592 3300048088 Bacteria 4725
677 Ga0495602_0141296 3300048088 Bacteria 1905
678 Ga0495602_0219624 3300048088 Bacteria 1436
679 Ga0495614_0003721 3300048089 Bacteria 6850
680 Ga0495614_0040358 3300048089 Bacteria 2003
681 Ga0495614_0060127 3300048089 Bacteria 1633
682 Ga0495614_0210571 3300048089 Bacteria 881
683 Ga0496100_0086796 3300048903 Bacteria 2126
684 Ga0496100_0223727 3300048903 Bacteria 1382
685 Ga0496100_0249072 3300048903 Bacteria 1313
686 Ga0496100_0321410 3300048903 Bacteria 1163
687 Ga0496100_0785305 3300048903 Unclassified 746
688 Ga0496101_0020018 3300048904 Bacteria 4576
689 Ga0496101_0029417 3300048904 Bacteria 3842
690 Ga0496101_0057538 3300048904 Bacteria 2812
691 Ga0496101_0098092 3300048904 Bacteria 2189
692 Ga0496101_0262629 3300048904 Bacteria 1347
693 Ga0496101_0287842 3300048904 Bacteria 1285
694 Ga0496101_0295243 3300048904 Bacteria 1268
695 Ga0496101_0300065 3300048904 Bacteria 1258
696 Ga0496101_0526594 3300048904 Bacteria 934
697 Ga0496101_0706886 3300048904 Bacteria 796
698 Ga0496102_0009708 3300048905 Bacteria 8274
699 Ga0496102_0059975 3300048905 Bacteria 3481
700 Ga0496102_0091475 3300048905 Bacteria 2816
701 Ga0496102_0250319 3300048905 Bacteria 1670
702 Ga0496102_0344125 3300048905 Bacteria 1404
703 Ga0496102_0580986 3300048905 Unclassified 1043
704 Ga0496102_1036932 3300048905 Bacteria 740
705 Ga0496102_1307321 3300048905 Bacteria 644
706 Ga0496103_0018216 3300048906 Bacteria 4211
707 Ga0496103_0025374 3300048906 Bacteria 3582
708 Ga0496103_0062758 3300048906 Bacteria 2313
709 Ga0496103_0170749 3300048906 Bacteria 1396
710 Ga0496103_0612477 3300048906 Unclassified 693
711 Ga0496104_0002197 3300048907 Bacteria 16889
712 Ga0496104_0015592 3300048907 Bacteria 6888
713 Ga0496104_0134688 3300048907 Bacteria 2373
714 Ga0496104_0154922 3300048907 Bacteria 2199
715 Ga0496104_0174713 3300048907 Bacteria 2059
716 Ga0496104_0200979 3300048907 Bacteria 1905
717 Ga0496104_0254828 3300048907 Bacteria 1667
718 Ga0496104_0522908 3300048907 Bacteria 1098
719 Ga0496104_1192540 3300048907 Unclassified 664
720 Ga0496104_1642480 3300048907 Bacteria 545
721 Ga0496104_1779265 3300048907 Bacteria 518
722 Ga0496105_0010699 3300048908 Bacteria 7220
723 Ga0496105_0014649 3300048908 Bacteria 6245
724 Ga0496105_0055896 3300048908 Bacteria 3258
725 Ga0496105_0062139 3300048908 Bacteria 3082
726 Ga0496105_0111417 3300048908 Bacteria 2258
727 Ga0496105_0118027 3300048908 Bacteria 2188
728 Ga0496105_0269572 3300048908 Bacteria 1375
729 Ga0496105_0730977 3300048908 Bacteria 757
730 Ga0496105_1304391 3300048908 Bacteria 530
731 Ga0496106_0042703 3300048909 Bacteria 3400
732 Ga0496106_0067644 3300048909 Bacteria 2724
733 Ga0496106_0301784 3300048909 Bacteria 1284
734 Ga0496106_0344588 3300048909 Bacteria 1197
735 Ga0496106_0703858 3300048909 Bacteria 805
736 Ga0496106_1465020 3300048909 Bacteria 526
737 Ga0496107_0018491 3300048910 Bacteria 4906
738 Ga0496107_0081962 3300048910 Bacteria 2353
739 Ga0496107_0260863 3300048910 Bacteria 1289
740 Ga0496107_0368553 3300048910 Bacteria 1068
741 Ga0496107_0477028 3300048910 Bacteria 926
742 Ga0496107_0591793 3300048910 Bacteria 820
743 Ga0496108_0031548 3300048911 Bacteria 4397
744 Ga0496108_0093760 3300048911 Bacteria 2554
745 Ga0496108_0280808 3300048911 Bacteria 1450
746 Ga0496108_0329399 3300048911 Bacteria 1331
747 Ga0496108_0503250 3300048911 Bacteria 1058
748 Ga0496108_1241057 3300048911 Unclassified 629
749 Ga0496108_1502620 3300048911 Unclassified 560
750 Ga0496109_0038823 3300048912 Bacteria 4306
751 Ga0496109_0063231 3300048912 Bacteria 3385
752 Ga0496109_0113931 3300048912 Bacteria 2515
753 Ga0496109_0117794 3300048912 Bacteria 2472
754 Ga0496109_0233942 3300048912 Bacteria 1729
755 Ga0496109_0258192 3300048912 Bacteria 1641
756 Ga0496109_0520549 3300048912 Bacteria 1122
757 Ga0496109_0988618 3300048912 Unclassified 779
758 Ga0496110_0034862 3300048913 Bacteria 4362
759 Ga0496110_0132252 3300048913 Bacteria 2253
760 Ga0496110_0271824 3300048913 Bacteria 1543
761 Ga0496110_0331843 3300048913 Bacteria 1385
762 Ga0496110_0375496 3300048913 Bacteria 1296
763 Ga0496110_0733714 3300048913 Bacteria 890
764 Ga0496110_1619813 3300048913 Bacteria 557
765 Ga0496111_0006666 3300048914 Bacteria 7511
766 Ga0496111_0007652 3300048914 Bacteria 7102
767 Ga0496111_0073398 3300048914 Bacteria 2492
768 Ga0496111_0088925 3300048914 Bacteria 2262
769 Ga0496111_0632182 3300048914 Bacteria 782
770 Ga0496112_0263149 3300048915 Bacteria 1674
771 Ga0496112_0937989 3300048915 Unclassified 787
772 Ga0496112_1476332 3300048915 Unclassified 594
773 Ga0496113_0142671 3300048916 Bacteria 1885
774 Ga0496113_0371904 3300048916 Bacteria 1147
775 Ga0496113_0515793 3300048916 Unclassified 959
776 Ga0496113_0569793 3300048916 Bacteria 908
777 Ga0496113_0790045 3300048916 Unclassified 754
778 Ga0496113_0809524 3300048916 Bacteria 744
779 Ga0496113_0999174 3300048916 Unclassified 659
780 Ga0496114_0002893 3300048917 Bacteria 13150
781 Ga0496114_0011607 3300048917 Bacteria 7043
782 Ga0496114_0011773 3300048917 Bacteria 6999
783 Ga0496114_0018715 3300048917 Bacteria 5604
784 Ga0496114_0023056 3300048917 Bacteria 5074
785 Ga0496114_0078641 3300048917 Bacteria 2783
786 Ga0496114_0085181 3300048917 Bacteria 2677
787 Ga0496114_0126510 3300048917 Bacteria 2203
788 Ga0496114_0128959 3300048917 Bacteria 2182
789 Ga0496114_0138221 3300048917 Bacteria 2107
790 Ga0496114_0150024 3300048917 Bacteria 2022
791 Ga0496114_0946779 3300048917 Bacteria 743
792 Ga0496114_1095147 3300048917 Bacteria 681
793 Ga0496115_0008844 3300048918 Bacteria 7464
794 Ga0496115_0029783 3300048918 Bacteria 4290
795 Ga0496115_0043772 3300048918 Bacteria 3570
796 Ga0496115_0060803 3300048918 Bacteria 3044
797 Ga0496115_0413364 3300048918 Bacteria 1093
798 Ga0496126_0136749 3300048929 Bacteria 2113
799 Ga0501069_0173729 3300049585 Bacteria 1244
800 nmdc:mga00v17_129809_c1 3300050491 Bacteria 1610
801 nmdc:mga0yw44_14258_c2 3300050492 Bacteria 2600
802 nmdc:mga0yw44_197472_c1 3300050492 Unclassified 1328
803 nmdc:mga0yw44_74778_c1 3300050492 Bacteria 2111
804 nmdc:mga0yw44_81377_c1 3300050492 Bacteria 2030
805 nmdc:mga0yw44_8868_c1 3300050492 Bacteria 5040
806 nmdc:mga0yw44_890176_c1 3300050492 Bacteria 604
807 nmdc:mga06z11_756092_c1 3300050494 Bacteria 592
808 nmdc:mga08y16_1013887_c1 3300050511 Bacteria 809
809 nmdc:mga08y16_96490_c1 3300050511 Bacteria 3079
810 nmdc:mga0n895_353574_c1 3300050512 Unclassified 1488
811 nmdc:mga08x19_315563_c1 3300050514 Unclassified 1087
812 nmdc:mga08x19_59232_c1 3300050514 Bacteria 2478
813 Ga0495601_0038506 3300053077 Bacteria 2991
814 Ga0495601_0050898 3300053077 Bacteria 2614
815 Ga0495601_0207982 3300053077 Bacteria 1278
816 Ga0495601_0222607 3300053077 Bacteria 1233
817 Ga0495601_0268240 3300053077 Bacteria 1114
818 Ga0495612_0029167 3300053078 Bacteria 2221
819 Ga0495612_0099332 3300053078 Bacteria 1238
820 Ga0495612_0114955 3300053078 Bacteria 1154
821 Ga0495595_0003683 3300053084 Bacteria 6095
822 Ga0495595_0037451 3300053084 Bacteria 2205
823 Ga0495595_0099765 3300053084 Bacteria 1400
824 Ga0495595_0162465 3300053084 Bacteria 1103
825 Ga0495619_0023709 3300053085 Bacteria 3934
826 Ga0495619_0065986 3300053085 Bacteria 2415
827 Ga0495619_0132948 3300053085 Bacteria 1710
828 Ga0495619_0203513 3300053085 Bacteria 1371
829 Ga0495619_0334187 3300053085 Bacteria 1049
830 Ga0495619_0346137 3300053085 Bacteria 1028
831 Ga0495619_0604716 3300053085 Unclassified 750
832 Ga0495619_0690966 3300053085 Unclassified 694
833 Ga0495619_1025858 3300053085 Unclassified 551
834 Ga0495619_1072403 3300053085 Bacteria 537
835 Ga0500641_0019102 3300053096 Bacteria 2587
836 Ga0500554_033823 3300053102 Bacteria 1527
837 Ga0070682_101973227
838 rootH1_10158853
839 JGI25404J52841_10020890
840 Ga0065707_10657283
841 Ga0070658_10017013
842 Ga0070658_10106611
843 Ga0070683_100002777
844 Ga0070683_100193780
845 Ga0070683_100760310
846 Ga0070690_100051285
847 Ga0070670_100555957
848 Ga0068869_100499772
849 Ga0068869_101643608
850 Ga0070666_10999097
851 Ga0070682_100034351
852 Ga0070682_100209735
853 Ga0070682_100735952
854 Ga0068868_100175630
855 Ga0068868_100368288
856 Ga0068868_100637676
857 Ga0068868_100705503
858 Ga0068868_100961134
859 Ga0068868_100966464
860 Ga0070660_100160486
861 Ga0070660_101511170
862 Ga0070689_100161259
863 Ga0070689_100661449
864 Ga0070691_10333176
865 Ga0070687_100039240
866 Ga0070687_101137085
867 Ga0070661_100024614
868 Ga0070661_100042198
869 Ga0070692_10234971
870 Ga0070692_10302861
871 Ga0070668_100183215
872 Ga0070671_100097364
873 Ga0070671_100804176
874 Ga0070671_101840212
875 Ga0070674_101273229
876 Ga0070673_100090049
877 Ga0070688_100876388
878 Ga0070659_100128946
879 Ga0070659_100132079
880 Ga0070667_100319123
881 Ga0070667_100989544
882 Ga0070667_101320605
883 Ga0070667_101568585
884 Ga0070667_101909367
885 Ga0070703_10019810
886 Ga0070709_10283712
887 Ga0070709_10378020
888 Ga0070714_100235461
889 Ga0070713_102395072
890 Ga0070710_10335661
891 Ga0070710_10694668
892 Ga0070710_10769581
893 Ga0070701_10125107
894 Ga0070711_100538183
895 Ga0070711_100668055
896 Ga0070711_100689172
897 Ga0070705_100028447
898 Ga0070705_100423069
899 Ga0070700_100169265
900 Ga0070694_100054366
901 Ga0070708_100560614
902 Ga0070708_101135067
903 Ga0070663_100473643
904 Ga0070678_100204928
905 Ga0070678_102407749
906 Ga0070662_100405564
907 Ga0070681_10198546
908 Ga0070681_10457842
909 Ga0070681_10655181
910 Ga0068867_100559395
911 Ga0070685_10143721
912 Ga0070685_11371272
913 Ga0070706_100411672
914 Ga0070706_100959045
915 Ga0070707_100199949
916 Ga0070698_100212619
917 Ga0070698_100604634
918 Ga0070679_100077935
919 Ga0070679_100698957
920 Ga0070684_100004109
921 Ga0070684_100070363
922 Ga0068853_100400470
923 Ga0068853_100514534
924 Ga0070672_101057179
925 Ga0070686_100117007
926 Ga0070695_101154019
927 Ga0070696_100026859
928 Ga0070696_100790664
929 Ga0070696_101328225
930 Ga0070693_100049318
931 Ga0070665_100000454
932 Ga0070665_100352612
933 Ga0070704_100465046
934 Ga0068855_100048549
935 Ga0070664_100008592
936 Ga0070664_100076583
937 Ga0070664_102266846
938 Ga0068857_100050320
939 Ga0068857_100087245
940 Ga0068857_101988364
941 Ga0068854_100044673
942 Ga0068856_100026056
943 Ga0068856_100761888
944 Ga0070702_100021100
945 Ga0070702_100044869
946 Ga0070702_100605588
947 Ga0070702_100764115
948 Ga0070702_101397767
949 Ga0068852_100300499
950 Ga0068852_100673686
951 Ga0068859_100379305
952 Ga0068859_102872236
953 Ga0068864_100008792
954 Ga0068864_100034777
955 Ga0068864_100368308
956 Ga0068864_100483642
957 Ga0068866_10044525
958 Ga0068866_11429310
959 Ga0068861_100252382
960 Ga0068861_100316319
961 Ga0068861_100921594
962 Ga0068861_101894599
963 Ga0068851_10066951
964 Ga0068870_10080129
965 Ga0068863_100041626
966 Ga0068858_100197110
967 Ga0068858_100307555
968 Ga0068860_100042001
969 Ga0068860_100312123
970 Ga0068860_100336634
971 Ga0068862_100736240
972 Ga0081540_1000511
973 Ga0081540_1295139
974 Ga0070717_10871629
975 Ga0075365_10011417
976 Ga0075365_10025856
977 Ga0075365_10031223
978 Ga0075365_10087628
979 Ga0075365_10147243
980 Ga0075365_11169898
981 Ga0075363_100471937
982 Ga0075364_10064194
983 Ga0075364_10510047
984 Ga0075432_10052081
985 Ga0070715_10013333
986 Ga0070715_10271235
987 Ga0070716_100134774
988 Ga0070716_100314008
989 Ga0070712_100395861
990 Ga0070712_100690509
991 Ga0070712_100912665
992 Ga0097621_100156961
993 Ga0068871_100257938
994 Ga0068871_101856580
995 Ga0068871_102157574
996 Ga0075428_101124778
997 Ga0075434_100711685
998 Ga0075434_101494250
999 Ga0068865_100309903
1000 Ga0068865_100375236
1001 Ga0075436_100265941
1002 Ga0075436_100836534
1003 Ga0097620_100379294
1004 Ga0097620_102872544
1005 Ga0105244_10215167
1006 Ga0105245_10000507
1007 Ga0105245_10003390
1008 Ga0105245_10180198
1009 Ga0105245_10458120
1010 Ga0105245_10628436
1011 Ga0105245_11549452
1012 Ga0105245_12709298
1013 Ga0105247_10092010
1014 Ga0105247_10388421
1015 Ga0105247_10461591
1016 Ga0105247_11154540
1017 Ga0105243_10066434
1018 Ga0105243_10113757
1019 Ga0105241_10409039
1020 Ga0105241_11500802
1021 Ga0105242_10035942
1022 Ga0105242_10452914
1023 Ga0105242_10528375
1024 Ga0105242_10541896
1025 Ga0105242_10715277
1026 Ga0105242_13269090
1027 Ga0105248_10068019
1028 Ga0105248_10101079
1029 Ga0105248_10326803
1030 Ga0105237_10658689
1031 Ga0105237_11522722
1032 Ga0105238_10125857
1033 Ga0105238_10269752
1034 Ga0105238_10742587
1035 Ga0105238_10915319
1036 Ga0105238_11364068
1037 Ga0105249_10083011
1038 Ga0105249_10634891
1039 Ga0105249_11631544
1040 Ga0105249_11897479
1041 Ga0105239_10003323
1042 Ga0105239_11331788
1043 Ga0105239_11356405
1044 Ga0105239_11793038
1045 Ga0105246_10002642
1046 Ga0105246_10248110
1047 Ga0157321_1007050
1048 Ga0157329_1030771
1049 Ga0157341_1034637
1050 Ga0157319_1004395
1051 Ga0157347_1024527
1052 Ga0157342_1008070
1053 Ga0157315_1040902
1054 Ga0157326_1031470
1055 Ga0157338_1008470
1056 Ga0157373_10811167
1057 Ga0157371_10050824
1058 Ga0157370_10871986
1059 Ga0157370_11830590
1060 Ga0157369_10105011
1061 Ga0157369_10410743
1062 Ga0157369_10528344
1063 Ga0157369_10867312
1064 Ga0157369_11878462
1065 Ga0157369_11913527
1066 Ga0157374_10840809
1067 Ga0157374_11450350
1068 Ga0163162_10052280
1069 Ga0163162_10167959
1070 Ga0163162_10767235
1071 Ga0163162_10832251
1072 Ga0163162_11627860
1073 Ga0157372_10001454
1074 Ga0157372_10518031
1075 Ga0157372_11659274
1076 Ga0157372_12297833
1077 Ga0157372_13433854
1078 Ga0157375_10023644
1079 Ga0157375_10050509
1080 Ga0157375_10763685
1081 Ga0157375_10923426
1082 Ga0157375_11034154
1083 Ga0163163_10026127
1084 Ga0163163_10038578
1085 Ga0163163_10045078
1086 Ga0163163_10122930
1087 Ga0163163_10817832
1088 Ga0163163_11145524
1089 Ga0157377_10155318
1090 Ga0157377_10177223
1091 Ga0157379_10022699
1092 Ga0157376_10238908
1093 Ga0157376_10432794
1094 Ga0157376_10654969
1095 Ga0157376_11523544
1096 Ga0163161_10129903
1097 Ga0163161_10445235
1098 Ga0206356_11334568
1099 Ga0206353_10987813
1100 Ga0206353_11910781
1101 Ga0207697_10449167
1102 Ga0207656_10096879
1103 Ga0207713_1133944
1104 Ga0207653_10004486
1105 Ga0207692_10479506
1106 Ga0207642_10346712
1107 Ga0207710_10222177
1108 Ga0207688_10008202
1109 Ga0207688_10066926
1110 Ga0207688_10482074
1111 Ga0207688_10672897
1112 Ga0207680_10326895
1113 Ga0207647_10064422
1114 Ga0207685_10012045
1115 Ga0207699_10134705
1116 Ga0207699_10429996
1117 Ga0207699_10864917
1118 Ga0207645_10506588
1119 Ga0207643_10010619
1120 Ga0207705_10756903
1121 Ga0207705_10870355
1122 Ga0207684_10499489
1123 Ga0207684_10501376
1124 Ga0207707_10259122
1125 Ga0207707_10384219
1126 Ga0207707_10683852
1127 Ga0207695_10180348
1128 Ga0207693_10075020
1129 Ga0207693_10401995
1130 Ga0207663_10304935
1131 Ga0207663_10359577
1132 Ga0207663_10627798
1133 Ga0207662_10017649
1134 Ga0207662_10109933
1135 Ga0207662_11282698
1136 Ga0207657_10041435
1137 Ga0207649_10248589
1138 Ga0207652_10244952
1139 Ga0207646_11119264
1140 Ga0207694_10316871
1141 Ga0207694_10930675
1142 Ga0207687_10023515
1143 Ga0207687_10111018
1144 Ga0207687_10971060
1145 Ga0207700_10019697
1146 Ga0207700_10136131
1147 Ga0207700_11533811
1148 Ga0207664_10006036
1149 Ga0207664_10298236
1150 Ga0207664_10584366
1151 Ga0207644_10513359
1152 Ga0207644_10757572
1153 Ga0207690_10115881
1154 Ga0207690_10120595
1155 Ga0207706_10044432
1156 Ga0207706_10193729
1157 Ga0207686_10490592
1158 Ga0207686_10787646
1159 Ga0207709_10081727
1160 Ga0207709_10270770
1161 Ga0207709_10929046
1162 Ga0207669_10401747
1163 Ga0207669_10740505
1164 Ga0207669_11229800
1165 Ga0207704_10036924
1166 Ga0207704_11430150
1167 Ga0207665_10011778
1168 Ga0207711_10372316
1169 Ga0207711_10901137
1170 Ga0207689_10479299
1171 Ga0207689_11121737
1172 Ga0207661_10030249
1173 Ga0207661_10035726
1174 Ga0207661_10102164
1175 Ga0207661_10730888
1176 Ga0207667_10650611
1177 Ga0207667_11469205
1178 Ga0207651_10099613
1179 Ga0207712_10118944
1180 Ga0207668_10289040
1181 Ga0207658_10103451
1182 Ga0207658_10851416
1183 Ga0207677_10138864
1184 Ga0207677_10552365
1185 Ga0207677_10718101
1186 Ga0207703_10027357
1187 Ga0207639_10022237
1188 Ga0207639_10081429
1189 Ga0207678_10006761
1190 Ga0207708_10147472
1191 Ga0207702_10143150
1192 Ga0207702_10294748
1193 Ga0207702_10367667
1194 Ga0207702_10454039
1195 Ga0207702_11402060
1196 Ga0207641_10064133
1197 Ga0207648_12012055
1198 Ga0207676_10725502
1199 Ga0207674_10013926
1200 Ga0207674_10029558
1201 Ga0207675_100011145
1202 Ga0207675_100504087
1203 Ga0207675_100790741
1204 Ga0207683_10042923
1205 Ga0207683_11419244
1206 Ga0207683_11794931
1207 Ga0207698_10610869
1208 Ga0268266_10002426
1209 Ga0268266_10987103
1210 Ga0268265_10342554
1211 Ga0268265_10606665
1212 Ga0268265_11347412
1213 Ga0268264_10046222
1214 Ga0268264_10305489
1215 Ga0265336_10003154
1216 Ga0265338_10013289
1217 Ga0265328_10169373
1218 Ga0265316_10191250
1219 Ga0307405_10000521
1220 Ga0307413_10278852
1221 Ga0307406_10410633
1222 Ga0307407_10004634
1223 Ga0307409_100002261
1224 Ga0307415_100000320
1225 Ga0373950_0098097
1226 Ga0373959_0138781
1227 Ga0373938_0208901
1228 Ga0373926_0000166
1229 Ga0373926_0144176
1230 Ga0373929_0170024
1231 Ga0373934_0019215
1232 Ga0373934_0026766
1233 Ga0373934_0043382
1234 Ga0373934_0090305
1235 Ga0373940_0140728
1236 Ga0373944_0000832
1237 Ga0373944_0266316
1238 Ga0373949_0070805
1239 Ga0373951_0013761
1240 Ga0373952_0030402
1241 Ga0373923_0015161
1242 Ga0373923_0065268
1243 Ga0373932_0018462
1244 Ga0373932_0308192
1245 Ga0373936_0000370
1246 Ga0373936_0002034
1247 Ga0373941_0068059
1248 Ga0373945_0000457
1249 Ga0373945_0037511
1250 Ga0373953_0000247
1251 Ga0373953_0010251
1252 Ga0373953_0024201
1253 Ga0373953_0059604
1254 Ga0373953_0303088
1255 Ga0373954_0009828
1256 Ga0373954_0045688
1257 Ga0373954_0219507
1258 Ga0373954_0352807
1259 Ga0373954_0671405
1260 Ga0373956_0002403
1261 Ga0373956_0009246
1262 Ga0373956_0012780
1263 Ga0373956_0046501
1264 Ga0373957_0000304
1265 Ga0373957_0000360
1266 Ga0373957_0109859
1267 Ga0373957_0119187
1268 Ga0373957_0159997
1269 Ga0373957_0334606
1270 Ga0373960_0109282
1271 Ga0373943_0000067
1272 Ga0373943_0023869
1273 Ga0373946_0000440
1274 Ga0373946_0024508
1275 Ga0373955_0016960
1276 Ga0373955_0044551
1277 Ga0373955_0195523
1278 Ga0373955_0474892
1279 Ga0373942_0105845
1280 Ga0373942_0377515
1281 Ga0373961_0210240
1282 Ga0373961_0400329
1283 Ga0373924_0000135
1284 Ga0373924_0000415
1285 Ga0373924_0001322
1286 Ga0373924_0043596
1287 Ga0373931_0051796
1288 Ga0373931_0147990
1289 Ga0373931_1260198
1290 Ga0373935_0031649
1291 Ga0373935_0637472
1292 Ga0373927_0001544
1293 Ga0373927_0173696
1294 Ga0373927_0904243
1295 Ga0373933_0000003
1296 Ga0373933_0065897
1297 Ga0373933_0109663
1298 Ga0373933_1059056
1299 Ga0373933_1091139
1300 Ga0373947_0007085
1301 Ga0373947_0079368
1302 Ga0373947_0321073
1303 Ga0373947_0383648
1304 Ga0373937_0000016
1305 Ga0373937_0002125
1306 Ga0373937_0090703
1307 Ga0373937_0135144
1308 Ga0373937_0205630
1309 Ga0373925_0007534
1310 Ga0373925_0015037
1311 Ga0373925_0029048
1312 Ga0373925_0102584
1313 Ga0451789_0881630
1314 Ga0451804_0805710
1315 Ga0451849_0698324
1316 Ga0451853_1874758
1317 Ga0451853_2678561
1318 Ga0451853_2682677
1319 Ga0451577_0358532
1320 Ga0466963_0244432
1321 Ga0451576_0264268
1322 Ga0495592_0000116
1323 Ga0495592_0015971
1324 Ga0495592_0054550
1325 Ga0495592_0232250
1326 Ga0495592_0391860
1327 Ga0495592_0529405
1328 Ga0495603_0001523
1329 Ga0495603_0045820
1330 Ga0495629_0003493
1331 Ga0495629_0064070
1332 Ga0495629_0169881
1333 Ga0495629_0365901
1334 Ga0495641_0003782
1335 Ga0495641_0007807
1336 Ga0495641_0008033
1337 Ga0495641_0062768
1338 Ga0495641_0165956
1339 Ga0495641_0184160
1340 Ga0495651_0000009
1341 Ga0495651_0009543
1342 Ga0495651_0039359
1343 Ga0495651_0060369
1344 Ga0495651_0113575
1345 Ga0495653_0001057
1346 Ga0495653_0024626
1347 Ga0495653_0173953
1348 Ga0495653_0877904
1349 Ga0495653_0908170
1350 Ga0495580_0035745
1351 Ga0495580_0089073
1352 Ga0495582_0000375
1353 Ga0495582_0002790
1354 Ga0495582_0142355
1355 Ga0495582_0316946
1356 Ga0495582_0395227
1357 Ga0495639_0000548
1358 Ga0495639_0040452
1359 Ga0495639_0305244
1360 Ga0495639_0342680
1361 Ga0495662_0004647
1362 Ga0495662_0007763
1363 Ga0495662_0018685
1364 Ga0495664_0004540
1365 Ga0495664_0007915
1366 Ga0495594_0136825
1367 Ga0495594_0171907
1368 Ga0495608_0000019
1369 Ga0495608_0015096
1370 Ga0495608_0035914
1371 Ga0495608_0378966
1372 Ga0495608_0396924
1373 Ga0495608_0897605
1374 Ga0495618_0001073
1375 Ga0495618_0410798
1376 Ga0495628_0000487
1377 Ga0495628_0178455
1378 Ga0495628_0241658
1379 Ga0495628_0313640
1380 Ga0495628_0512736
1381 Ga0495630_0004836
1382 Ga0495630_0044423
1383 Ga0495630_0049458
1384 Ga0495666_0025075
1385 Ga0495666_0141735
1386 Ga0495652_0000430
1387 Ga0495652_0035590
1388 Ga0495652_0037892
1389 Ga0495652_0306386
1390 Ga0495652_0373095
1391 Ga0495652_0713384
1392 Ga0495665_0000236
1393 Ga0495665_0008820
1394 Ga0495665_0041157
1395 Ga0495640_0008891
1396 Ga0495640_0017655
1397 Ga0495640_0022194
1398 Ga0495640_0568740
1399 Ga0495586_0008635
1400 Ga0495587_0000041
1401 Ga0495587_0080415
1402 Ga0495587_0138878
1403 Ga0495587_0218624
1404 Ga0495587_0376772
1405 Ga0495645_0029423
1406 Ga0495645_0110029
1407 Ga0495645_0176939
1408 Ga0495645_0471893
1409 Ga0495645_0493386
1410 Ga0495622_0061572
1411 Ga0495667_0000037
1412 Ga0495667_0000557
1413 Ga0495667_0005966
1414 Ga0495667_0032678
1415 Ga0495667_0216908
1416 Ga0495667_0448152
1417 Ga0495656_0448327
1418 Ga0495634_0003394
1419 Ga0495634_0020321
1420 Ga0495634_0034577
1421 Ga0495634_0166102
1422 Ga0495635_0010520
1423 Ga0495635_0024939
1424 Ga0495635_0046089
1425 Ga0495588_0211382
1426 Ga0495657_0000094
1427 Ga0495657_0006691
1428 Ga0495657_0012007
1429 Ga0495657_0018831
1430 Ga0495657_0227015
1431 Ga0495657_0454480
1432 Ga0495599_0000040
1433 Ga0495599_0028865
1434 Ga0495599_0139720
1435 Ga0495599_0243266
1436 Ga0495599_0305225
1437 Ga0495599_0603583
1438 Ga0495623_0000284
1439 Ga0495623_0017741
1440 Ga0495623_0091013
1441 Ga0495623_0220134
1442 Ga0495646_0006814
1443 Ga0495646_0016988
1444 Ga0495646_0141043
1445 Ga0495646_0228716
1446 Ga0495647_0003459
1447 Ga0495647_0038703
1448 Ga0495658_0004141
1449 Ga0495658_0047633
1450 Ga0495658_0079721
1451 Ga0495658_0260449
1452 Ga0495658_0375546
1453 Ga0495613_0003464
1454 Ga0495613_0016362
1455 Ga0495613_0048337
1456 Ga0495613_0131034
1457 Ga0495624_0007166
1458 Ga0495624_0009694
1459 Ga0495624_0022917
1460 Ga0495624_0200386
1461 Ga0495600_0002749
1462 Ga0495600_0003484
1463 Ga0495600_0012423
1464 Ga0495600_0074799
1465 Ga0495600_0108435
1466 Ga0495600_0246810
1467 Ga0495600_0369644
1468 Ga0495600_0467442
1469 Ga0495600_0888438
1470 Ga0495581_0001463
1471 Ga0495581_0014631
1472 Ga0495604_0000040
1473 Ga0495604_0011031
1474 Ga0495604_0136708
1475 Ga0495604_0456142
1476 Ga0495604_0645470
1477 Ga0495674_0013104
1478 Ga0495674_0021106
1479 Ga0495674_0030767
1480 Ga0495674_0293455
1481 Ga0495674_0399258
1482 Ga0495674_0799749
1483 Ga0495676_0002726
1484 Ga0495676_0021095
1485 Ga0495676_0135210
1486 Ga0495676_0582863
1487 Ga0495676_0908765
1488 Ga0495680_0000010
1489 Ga0495680_0018534
1490 Ga0495680_0022123
1491 Ga0495680_0044621
1492 Ga0495680_0068326
1493 Ga0495675_0000111
1494 Ga0495675_0002537
1495 Ga0495675_0051392
1496 Ga0495675_0113964
1497 Ga0495675_0438768
1498 Ga0495684_0004232
1499 Ga0495684_0015780
1500 Ga0495684_0016426
1501 Ga0495684_0556643
1502 Ga0495684_0564922
1503 Ga0495684_0970435
1504 Ga0495593_0000748
1505 Ga0495593_0003299
1506 Ga0495593_0004950
1507 Ga0495593_0122801
1508 Ga0495593_0164877
1509 Ga0495602_0000130
1510 Ga0495602_0025325
1511 Ga0495602_0034481
1512 Ga0495602_0034592
1513 Ga0495602_0141296
1514 Ga0495602_0219624
1515 Ga0495614_0003721
1516 Ga0495614_0040358
1517 Ga0495614_0060127
1518 Ga0495614_0210571
1519 Ga0496100_0086796
1520 Ga0496100_0223727
1521 Ga0496100_0249072
1522 Ga0496100_0321410
1523 Ga0496100_0785305
1524 Ga0496101_0020018
1525 Ga0496101_0029417
1526 Ga0496101_0057538
1527 Ga0496101_0098092
1528 Ga0496101_0262629
1529 Ga0496101_0287842
1530 Ga0496101_0295243
1531 Ga0496101_0300065
1532 Ga0496101_0526594
1533 Ga0496101_0706886
1534 Ga0496102_0009708
1535 Ga0496102_0059975
1536 Ga0496102_0091475
1537 Ga0496102_0250319
1538 Ga0496102_0344125
1539 Ga0496102_0580986
1540 Ga0496102_1036932
1541 Ga0496102_1307321
1542 Ga0496103_0018216
1543 Ga0496103_0025374
1544 Ga0496103_0062758
1545 Ga0496103_0170749
1546 Ga0496103_0612477
1547 Ga0496104_0002197
1548 Ga0496104_0015592
1549 Ga0496104_0134688
1550 Ga0496104_0154922
1551 Ga0496104_0174713
1552 Ga0496104_0200979
1553 Ga0496104_0254828
1554 Ga0496104_0522908
1555 Ga0496104_1192540
1556 Ga0496104_1642480
1557 Ga0496104_1779265
1558 Ga0496105_0010699
1559 Ga0496105_0014649
1560 Ga0496105_0055896
1561 Ga0496105_0062139
1562 Ga0496105_0111417
1563 Ga0496105_0118027
1564 Ga0496105_0269572
1565 Ga0496105_0730977
1566 Ga0496105_1304391
1567 Ga0496106_0042703
1568 Ga0496106_0067644
1569 Ga0496106_0301784
1570 Ga0496106_0344588
1571 Ga0496106_0703858
1572 Ga0496106_1465020
1573 Ga0496107_0018491
1574 Ga0496107_0081962
1575 Ga0496107_0260863
1576 Ga0496107_0368553
1577 Ga0496107_0477028
1578 Ga0496107_0591793
1579 Ga0496108_0031548
1580 Ga0496108_0093760
1581 Ga0496108_0280808
1582 Ga0496108_0329399
1583 Ga0496108_0503250
1584 Ga0496108_1241057
1585 Ga0496108_1502620
1586 Ga0496109_0038823
1587 Ga0496109_0063231
1588 Ga0496109_0113931
1589 Ga0496109_0117794
1590 Ga0496109_0233942
1591 Ga0496109_0258192
1592 Ga0496109_0520549
1593 Ga0496109_0988618
1594 Ga0496110_0034862
1595 Ga0496110_0132252
1596 Ga0496110_0271824
1597 Ga0496110_0331843
1598 Ga0496110_0375496
1599 Ga0496110_0733714
1600 Ga0496110_1619813
1601 Ga0496111_0006666
1602 Ga0496111_0007652
1603 Ga0496111_0073398
1604 Ga0496111_0088925
1605 Ga0496111_0632182
1606 Ga0496112_0263149
1607 Ga0496112_0937989
1608 Ga0496112_1476332
1609 Ga0496113_0142671
1610 Ga0496113_0371904
1611 Ga0496113_0515793
1612 Ga0496113_0569793
1613 Ga0496113_0790045
1614 Ga0496113_0809524
1615 Ga0496113_0999174
1616 Ga0496114_0002893
1617 Ga0496114_0011607
1618 Ga0496114_0011773
1619 Ga0496114_0018715
1620 Ga0496114_0023056
1621 Ga0496114_0078641
1622 Ga0496114_0085181
1623 Ga0496114_0126510
1624 Ga0496114_0128959
1625 Ga0496114_0138221
1626 Ga0496114_0150024
1627 Ga0496114_0946779
1628 Ga0496114_1095147
1629 Ga0496115_0008844
1630 Ga0496115_0029783
1631 Ga0496115_0043772
1632 Ga0496115_0060803
1633 Ga0496115_0413364
1634 Ga0496126_0136749
1635 Ga0501069_0173729
1636 nmdc:mga00v17_129809_c1
1637 nmdc:mga0yw44_14258_c2
1638 nmdc:mga0yw44_197472_c1
1639 nmdc:mga0yw44_74778_c1
1640 nmdc:mga0yw44_81377_c1
1641 nmdc:mga0yw44_8868_c1
1642 nmdc:mga0yw44_890176_c1
1643 nmdc:mga06z11_756092_c1
1644 nmdc:mga08y16_1013887_c1
1645 nmdc:mga08y16_96490_c1
1646 nmdc:mga0n895_353574_c1
1647 nmdc:mga08x19_315563_c1
1648 nmdc:mga08x19_59232_c1
1649 Ga0495601_0038506
1650 Ga0495601_0050898
1651 Ga0495601_0207982
1652 Ga0495601_0222607
1653 Ga0495601_0268240
1654 Ga0495612_0029167
1655 Ga0495612_0099332
1656 Ga0495612_0114955
1657 Ga0495595_0003683
1658 Ga0495595_0037451
1659 Ga0495595_0099765
1660 Ga0495595_0162465
1661 Ga0495619_0023709
1662 Ga0495619_0065986
1663 Ga0495619_0132948
1664 Ga0495619_0203513
1665 Ga0495619_0334187
1666 Ga0495619_0346137
1667 Ga0495619_0604716
1668 Ga0495619_0690966
1669 Ga0495619_1025858
1670 Ga0495619_1072403
1671 Ga0500641_0019102
1672 Ga0500554_033823

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

16

55

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

121

0.8

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

122

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.9244 67 117
8aid-assembly2.cif.gz_D crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 0.872 66 118
6isd-assembly1.cif.gz_B crystal structure of arabidopsis thaliana hppd complexed with sulcotrione 0.8354 66 116
7yvv-assembly1.cif.gz_A acmp1, r-4-hydroxymandelate synthase 0.8313 66 117
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.8209 66 118
ID Description Score Start End Superfamily
3r6aA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9157 67 118 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9049 68 118 3.30.720.110
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8494 68 118 3.10.180.10
2qh0A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.827 66 116 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8168 66 118 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A838KVQ7-F1-model_v4 Glyoxalase-like domain-containing protein 0.9824 66 118
AF-A0A2V7YWX1-F1-model_v4 VOC family protein 0.982 68 118
AF-A0A087NA56-F1-model_v4 VOC domain-containing protein 0.9808 66 117
AF-A0A4S8QHV1-F1-model_v4 VOC family protein 0.9753 66 118
AF-A0A1G9JNR8-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9748 68 117 GO:0051213

Map