F482804

General Info

Members Datasets Scaffolds Average Seq Length
834 366 679 311

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0246669|Ga0453684_0246669_192_1154
Length 320
Sequence MGSWIARIRASIVAGVVVGCAGLHAPLVLAEKFDYQLAPLKVADDTWVLIGKTEDFTRANGGNIVNTAFVVTEDGVVVIDSGPSRRYAEQMRAAIAKITAKPVVRVFNTHHHPDHFLGNQVFARVPTAALAVTIAGQKQEGVAFTDNVYRLSGDWILGTEPVAASESVAPGVYNIGGHAFELIALAGHTQGDLVILDRSTGVIFTGDLVFHNRAPTTPHASIAQWLAALDGLDAIRYQLMVPGHGNPVPDGRAVDQTRRYLRWLEATLRQAAEHGDEMNEVLALPLPAEFGSIPLMRVEFARSVAHLYRRYEAGTLAHSR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
14 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
23 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
26 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
27 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
28 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
29 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
30 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
31 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
32 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
33 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
34 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
35 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
36 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
37 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
38 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
39 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
40 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
41 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
42 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
43 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
44 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
45 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
46 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
47 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
48 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
49 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
50 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
51 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
52 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
53 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
54 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
55 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
56 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
57 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
58 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
59 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
60 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
61 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
62 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
63 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
64 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
65 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
66 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
67 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
68 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
69 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
70 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
71 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
72 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
73 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
74 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
75 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
76 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
77 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
78 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
79 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
80 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
81 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
82 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
83 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
84 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
85 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
86 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
87 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
88 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
89 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
90 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
91 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
92 2773857670 Pseudomonas sp. 478 Isolate Unclassified
93 2784132072 Pseudomonas sp. 460 Isolate Unclassified
94 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
95 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
96 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
97 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
98 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
99 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
100 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
101 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
102 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
103 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
104 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
105 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
106 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
107 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
108 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
109 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
110 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
111 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
112 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
113 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
114 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
115 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
116 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
117 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
118 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
119 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
120 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
121 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
122 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
123 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
124 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
125 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
126 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
127 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
128 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
129 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
130 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
131 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
132 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
133 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
134 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
135 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
136 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
137 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
138 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
139 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
140 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
141 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
142 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
143 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
144 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
145 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
146 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
147 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
148 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
149 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
150 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
151 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
152 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
153 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
154 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
155 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
158 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
159 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
164 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
165 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
222 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
223 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
226 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
227 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
230 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
231 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
232 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
233 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
234 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
235 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
238 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
243 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
250 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
349 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
350 639633007 Azoarcus olearius BH72 Isolate Unclassified
351 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
352 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
353 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
354 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
355 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
356 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
357 8052494512 Pseudomonas putida LD6 Isolate Unclassified
358 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
359 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
360 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
361 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
362 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
363 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
364 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
365 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
366 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.41
Metatranscriptomes 0
Isolates 18.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 1.92
Rhizoplane 8.15
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 13.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5158 2124908027 Bacteria 19190
2 SwRhRL2b_contig_1319436 2162886007 Bacteria 1940
3 JGI25162J39368_1000050 3300002737 Bacteria 157157
4 JGI25163J39215_1000351 3300002771 Bacteria 15275
5 JGI25164J39214_1000025 3300002772 Bacteria 157157
6 JGI25165J46597_1000114 3300003214 Bacteria 144350
7 JGI25165J46597_1000176 3300003214 Bacteria 99160
8 Ga0055530_10000075 3300003791 Bacteria 84932
9 Ga0055530_10032368 3300003791 Bacteria 1360
10 Ga0055540_1000115 3300003792 Bacteria 84932
11 Ga0065714_10000744 3300005288 Bacteria 2932
12 Ga0065714_10002340 3300005288 Bacteria 25797
13 Ga0065714_10006336 3300005288 Bacteria 5927
14 Ga0065714_10029782 3300005288 Bacteria 1496
15 Ga0065714_10074007 3300005288 Bacteria 3096
16 Ga0065714_10083749 3300005288 Bacteria 2232
17 Ga0065714_10092038 3300005288 Bacteria 1885
18 Ga0065714_10092661 3300005288 Bacteria 1870
19 Ga0065704_10000778 3300005289 Bacteria 18558
20 Ga0065704_10009688 3300005289 Bacteria 3447
21 Ga0065704_10072252 3300005289 Bacteria 8859
22 Ga0065712_10008598 3300005290 Bacteria 6003
23 Ga0065715_10281495 3300005293 Bacteria 1074
24 Ga0070670_100000303 3300005331 Bacteria 42489
25 Ga0070661_100002107 3300005344 Bacteria 13699
26 Ga0070669_100030218 3300005353 Bacteria 3908
27 Ga0070662_100001726 3300005457 Bacteria 13449
28 Ga0070664_100002981 3300005564 Bacteria 13699
29 Ga0068854_100204646 3300005578 Bacteria 1554
30 Ga0068851_10000132 3300005834 Bacteria 40261
31 Ga0075432_10001039 3300006058 Bacteria 8837
32 Ga0075432_10008235 3300006058 Bacteria 3554
33 Ga0075432_10016885 3300006058 Bacteria 2491
34 Ga0075362_10012119 3300006177 Bacteria 3416
35 Ga0099823_1000001 3300006944 Bacteria 216833
36 Ga0079104_1000303 3300006946 Bacteria 62394
37 Ga0079104_1000554 3300006946 Bacteria 38699
38 Ga0105251_10000038 3300009011 Bacteria 116060
39 Ga0105251_10002494 3300009011 Bacteria 14402
40 Ga0105251_10010425 3300009011 Bacteria 5393
41 Ga0105251_10012550 3300009011 Bacteria 4789
42 Ga0105244_10000016 3300009036 Bacteria 255363
43 Ga0105244_10001524 3300009036 Bacteria 18507
44 Ga0105244_10004851 3300009036 Bacteria 9120
45 Ga0105244_10008586 3300009036 Bacteria 6370
46 Ga0105244_10014628 3300009036 Bacteria 4533
47 Ga0105244_10016545 3300009036 Bacteria 4199
48 Ga0105244_10084222 3300009036 Bacteria 1571
49 Ga0105244_10111564 3300009036 Bacteria 1330
50 Ga0105250_10000353 3300009092 Bacteria 35144
51 Ga0105250_10027363 3300009092 Bacteria 2298
52 Ga0105243_10014929 3300009148 Bacteria 5879
53 Ga0105243_10039721 3300009148 Bacteria 3670
54 Ga0105243_10054921 3300009148 Bacteria 3164
55 Ga0105242_10022928 3300009176 Bacteria 4917
56 Ga0105248_10712762 3300009177 Bacteria 1132
57 Ga0105237_10006234 3300009545 Bacteria 13284
58 Ga0105246_10047293 3300011119 Bacteria 2937
59 Ga0157373_10001148 3300013100 Bacteria 20279
60 Ga0157373_10006474 3300013100 Bacteria 8739
61 Ga0157373_10008114 3300013100 Bacteria 7806
62 Ga0157373_10086368 3300013100 Bacteria 2211
63 Ga0157371_10001502 3300013102 Bacteria 24121
64 Ga0157371_10001866 3300013102 Bacteria 21095
65 Ga0157371_10054590 3300013102 Bacteria 2837
66 Ga0157370_10001953 3300013104 Bacteria 25403
67 Ga0157370_10134614 3300013104 Bacteria 2304
68 Ga0157370_10135693 3300013104 Bacteria 2293
69 Ga0157369_10009531 3300013105 Bacteria 11103
70 Ga0157369_10011089 3300013105 Bacteria 10254
71 Ga0157369_10012461 3300013105 Bacteria 9646
72 Ga0163162_10421486 3300013306 Bacteria 1467
73 Ga0157372_10001218 3300013307 Bacteria 27843
74 Ga0157375_10188795 3300013308 Bacteria 2215
75 Ga0182008_10000604 3300014497 Bacteria 26387
76 Ga0182008_10007960 3300014497 Bacteria 5813
77 Ga0182008_10009829 3300014497 Bacteria 5143
78 Ga0182008_10040881 3300014497 Bacteria 2314
79 Ga0182006_1001202 3300015261 Bacteria 16166
80 Ga0182006_1003368 3300015261 Bacteria 8214
81 Ga0182006_1007155 3300015261 Bacteria 5130
82 Ga0182006_1061485 3300015261 Bacteria 1416
83 Ga0182007_10000071 3300015262 Bacteria 81966
84 Ga0182007_10001255 3300015262 Bacteria 13789
85 Ga0182007_10013309 3300015262 Bacteria 3141
86 Ga0182005_1000524 3300015265 Bacteria 19519
87 Ga0182005_1002580 3300015265 Bacteria 6418
88 Ga0182005_1017753 3300015265 Bacteria 1969
89 Ga0163161_10004705 3300017792 Bacteria 9493
90 Ga0163161_10006045 3300017792 Bacteria 8391
91 Ga0163161_10013164 3300017792 Bacteria 5751
92 Ga0163161_10040096 3300017792 Bacteria 3363
93 Ga0163161_10044526 3300017792 Bacteria 3197
94 Ga0163161_10075880 3300017792 Bacteria 2467
95 Ga0163161_10119533 3300017792 Bacteria 1979
96 Ga0209760_100033 3300025207 Bacteria 136583
97 Ga0207427_100003 3300025231 Bacteria 1035004
98 Ga0209437_100002 3300025233 Bacteria 1574801
99 Ga0209233_1000004 3300025261 Bacteria 1574798
100 Ga0209676_1000617 3300025292 Bacteria 51959
101 Ga0209676_1004064 3300025292 Bacteria 8411
102 Ga0209676_1008768 3300025292 Bacteria 4456
103 Ga0209050_1000013 3300025298 Bacteria 811408
104 Ga0209050_1000914 3300025298 Bacteria 38994
105 Ga0209051_1000007 3300025303 Bacteria 811408
106 Ga0209257_1011899 3300025304 Bacteria 4108
107 Ga0207656_10000287 3300025321 Bacteria 17443
108 Ga0207696_1000016 3300025711 Bacteria 502467
109 Ga0207696_1000108 3300025711 Bacteria 157445
110 Ga0207696_1024126 3300025711 Bacteria 1910
111 Ga0207655_1000027 3300025728 Bacteria 444552
112 Ga0207655_1000114 3300025728 Bacteria 164098
113 Ga0207655_1000384 3300025728 Bacteria 61818
114 Ga0207655_1002020 3300025728 Bacteria 17156
115 Ga0207655_1003059 3300025728 Bacteria 12750
116 Ga0207655_1022254 3300025728 Bacteria 3186
117 Ga0207713_1000185 3300025735 Bacteria 88697
118 Ga0207713_1001969 3300025735 Bacteria 15463
119 Ga0207713_1002029 3300025735 Bacteria 15167
120 Ga0207713_1006075 3300025735 Bacteria 7441
121 Ga0207713_1015292 3300025735 Bacteria 3946
122 Ga0207713_1032451 3300025735 Bacteria 2293
123 Ga0207671_10001354 3300025914 Bacteria 28611
124 Ga0207649_10000577 3300025920 Bacteria 25047
125 Ga0207681_10006717 3300025923 Bacteria 7059
126 Ga0207650_10000068 3300025925 Bacteria 139947
127 Ga0207706_10004228 3300025933 Bacteria 13524
128 Ga0207686_10046243 3300025934 Bacteria 2683
129 Ga0207709_10003872 3300025935 Bacteria 8757
130 Ga0207709_10013552 3300025935 Bacteria 4497
131 Ga0207709_10430934 3300025935 Bacteria 1015
132 Ga0207679_10001702 3300025945 Bacteria 13713
133 Ga0207640_10133741 3300025981 Bacteria 1797
134 Ga0209281_1000009 3300027111 Bacteria 771717
135 Ga0209281_1000063 3300027111 Bacteria 288465
136 Ga0209389_1000007 3300027296 Bacteria 227459
137 Ga0207428_10009356 3300027907 Bacteria 8791
138 Ga0207428_10052476 3300027907 Bacteria 3256
139 Ga0207428_10064906 3300027907 Bacteria 2882
140 Ga0207428_10142031 3300027907 Bacteria 1832
141 Ga0207428_10155921 3300027907 Bacteria 1737
142 Ga0207428_10256962 3300027907 Bacteria 1302
143 Ga0307408_100000018 3300031548 Bacteria 346872
144 Ga0307408_100014570 3300031548 Bacteria 5224
145 Ga0307408_100094845 3300031548 Bacteria 2260
146 Ga0307405_10000137 3300031731 Bacteria 28468
147 Ga0307405_10005300 3300031731 Bacteria 6201
148 Ga0307405_10074088 3300031731 Bacteria 2200
149 Ga0307405_10392857 3300031731 Bacteria 1083
150 Ga0307406_10183447 3300031901 Bacteria 1525
151 Ga0307406_10324395 3300031901 Bacteria 1192
152 Ga0307407_10208722 3300031903 Bacteria 1313
153 Ga0307412_10029725 3300031911 Bacteria 3431
154 Ga0307412_10115139 3300031911 Bacteria 1926
155 Ga0307416_100234527 3300032002 Bacteria 1772
156 Ga0307414_10052408 3300032004 Bacteria 2839
157 Ga0307414_10088530 3300032004 Bacteria 2291
158 Ga0307414_10193598 3300032004 Bacteria 1647
159 Ga0307411_10020277 3300032005 Bacteria 3862
160 Ga0307411_10075767 3300032005 Bacteria 2297
161 Ga0439438_003908 3300041405 Bacteria 5866
162 Ga0439438_004339 3300041405 Bacteria 5469
163 Ga0439438_005962 3300041405 Bacteria 4397
164 Ga0439438_013043 3300041405 Bacteria 2521
165 Ga0439438_017339 3300041405 Bacteria 2075
166 Ga0439447_003607 3300041407 Bacteria 5480
167 Ga0439447_004429 3300041407 Bacteria 4831
168 Ga0439447_009200 3300041407 Bacteria 3010
169 Ga0439447_015362 3300041407 Bacteria 2125
170 Ga0439466_0002538 3300041411 Bacteria 7147
171 Ga0439466_0004357 3300041411 Bacteria 5457
172 Ga0439466_0006691 3300041411 Bacteria 4373
173 Ga0439466_0009076 3300041411 Bacteria 3731
174 Ga0439466_0015463 3300041411 Bacteria 2771
175 Ga0439466_0030632 3300041411 Bacteria 1843
176 Ga0439465_0008365 3300041413 Bacteria 3266
177 Ga0439431_0002411 3300041997 Bacteria 4138
178 Ga0439432_000171 3300042006 Bacteria 22714
179 Ga0439432_007279 3300042006 Bacteria 3928
180 Ga0439432_010393 3300042006 Bacteria 3224
181 Ga0439432_013015 3300042006 Bacteria 2833
182 Ga0439451_010572 3300042009 Bacteria 1860
183 Ga0439451_016675 3300042009 Bacteria 1478
184 Ga0439451_036055 3300042009 Bacteria 994
185 Ga0439452_000677 3300042010 Bacteria 16790
186 Ga0439452_003056 3300042010 Bacteria 5950
187 Ga0439452_004545 3300042010 Bacteria 4632
188 Ga0439452_004693 3300042010 Bacteria 4528
189 Ga0439452_007797 3300042010 Bacteria 3251
190 Ga0439452_009314 3300042010 Bacteria 2898
191 Ga0439452_010565 3300042010 Bacteria 2679
192 Ga0439452_018732 3300042010 Bacteria 1840
193 Ga0439456_004218 3300042013 Bacteria 2913
194 Ga0439463_002247 3300042016 Bacteria 4955
195 Ga0439463_004592 3300042016 Bacteria 3458
196 Ga0450911_002259 3300042115 Bacteria 3866
197 Ga0450911_002820 3300042115 Bacteria 3269
198 Ga0450911_003118 3300042115 Bacteria 3013
199 Ga0450911_010864 3300042115 Bacteria 1252
200 Ga0450920_000960 3300042122 Bacteria 4700
201 Ga0450922_000360 3300042124 Bacteria 4853
202 Ga0450890_000606 3300042127 Bacteria 5233
203 Ga0450894_002753 3300042131 Bacteria 2331
204 Ga0450898_000712 3300042134 Bacteria 4031
205 Ga0450899_001487 3300042135 Bacteria 2619
206 Ga0450902_001289 3300042137 Bacteria 3386
207 Ga0450902_003671 3300042137 Bacteria 2254
208 Ga0450902_006821 3300042137 Bacteria 1755
209 Ga0450903_001686 3300042138 Bacteria 4084
210 Ga0450903_001697 3300042138 Bacteria 4061
211 Ga0450905_001436 3300042142 Bacteria 3043
212 Ga0450906_003228 3300042145 Bacteria 3519
213 Ga0450907_000140 3300042146 Bacteria 27596
214 Ga0450907_025237 3300042146 Bacteria 1005
215 Ga0450910_002522 3300042147 Bacteria 2405
216 Ga0450910_009742 3300042147 Bacteria 1361
217 Ga0439446_0028856 3300042156 Bacteria 1599
218 Ga0450908_001543 3300042184 Bacteria 4470
219 Ga0450908_005901 3300042184 Bacteria 2339
220 Ga0450909_002131 3300042185 Bacteria 2793
221 Ga0439434_0002427 3300042435 Bacteria 5421
222 Ga0439434_0004141 3300042435 Bacteria 4233
223 Ga0439464_0000443 3300042439 Bacteria 8221
224 Ga0439464_0016060 3300042439 Bacteria 2023
225 Ga0439460_0002498 3300042461 Bacteria 4439
226 Ga0439460_0005265 3300042461 Bacteria 3169
227 Ga0450901_002227 3300042533 Bacteria 2127
228 Ga0439440_0001299 3300042993 Bacteria 4530
229 Ga0439440_0012945 3300042993 Bacteria 1781
230 Ga0439440_0040919 3300042993 Bacteria 1129
231 Ga0453684_0246669 3300044712 Bacteria 2053
232 Ga0451576_0000591 3300045051 Bacteria 76735
233 Ga0495617_000826 3300046452 Bacteria 14740
234 Ga0495617_005450 3300046452 Bacteria 4507
235 Ga0495617_007936 3300046452 Bacteria 3671
236 Ga0495617_008755 3300046452 Bacteria 3484
237 Ga0495617_009711 3300046452 Bacteria 3301
238 Ga0495617_065742 3300046452 Bacteria 1195
239 Ga0495627_005583 3300046453 Bacteria 5036
240 Ga0495603_0004426 3300046455 Bacteria 8375
241 Ga0495603_0036666 3300046455 Bacteria 2943
242 Ga0495590_0002605 3300046457 Bacteria 7455
243 Ga0495590_0006559 3300046457 Bacteria 4539
244 Ga0495590_0025540 3300046457 Bacteria 2077
245 Ga0495590_0070917 3300046457 Bacteria 1222
246 Ga0495591_000174 3300046458 Bacteria 66422
247 Ga0495591_000697 3300046458 Bacteria 24507
248 Ga0495591_000809 3300046458 Bacteria 22141
249 Ga0495591_001735 3300046458 Bacteria 12988
250 Ga0495591_008718 3300046458 Bacteria 4121
251 Ga0495591_015979 3300046458 Bacteria 2631
252 Ga0495591_031472 3300046458 Bacteria 1591
253 Ga0495629_0093107 3300046459 Bacteria 2103
254 Ga0495638_0003448 3300046460 Bacteria 12455
255 Ga0495638_0011837 3300046460 Bacteria 6001
256 Ga0495638_0021838 3300046460 Bacteria 4207
257 Ga0495638_0036107 3300046460 Bacteria 3149
258 Ga0495638_0058887 3300046460 Bacteria 2379
259 Ga0495638_0123132 3300046460 Bacteria 1530
260 Ga0495638_0223700 3300046460 Bacteria 1050
261 Ga0495653_0049230 3300046463 Bacteria 3247
262 Ga0495653_0288031 3300046463 Bacteria 1075
263 Ga0495650_0001051 3300046471 Bacteria 30683
264 Ga0495650_0002388 3300046471 Bacteria 15361
265 Ga0495650_0006072 3300046471 Bacteria 7624
266 Ga0495650_0008122 3300046471 Bacteria 6177
267 Ga0495650_0011840 3300046471 Bacteria 4735
268 Ga0495650_0031224 3300046471 Bacteria 2400
269 Ga0495580_0326583 3300046472 Bacteria 1042
270 Ga0495582_0015874 3300046473 Bacteria 4129
271 Ga0495605_0000076 3300046474 Bacteria 128699
272 Ga0495605_0001638 3300046474 Bacteria 14431
273 Ga0495605_0002121 3300046474 Bacteria 12413
274 Ga0495605_0002432 3300046474 Bacteria 11513
275 Ga0495605_0011566 3300046474 Bacteria 4915
276 Ga0495605_0017220 3300046474 Bacteria 3894
277 Ga0495605_0023402 3300046474 Bacteria 3249
278 Ga0495605_0036829 3300046474 Bacteria 2464
279 Ga0495639_0000563 3300046475 Bacteria 17303
280 Ga0495639_0007071 3300046475 Bacteria 4820
281 Ga0495639_0041389 3300046475 Bacteria 2075
282 Ga0495584_0001241 3300046491 Bacteria 15569
283 Ga0495584_0001301 3300046491 Bacteria 15186
284 Ga0495584_0002919 3300046491 Bacteria 9540
285 Ga0495584_0003118 3300046491 Bacteria 9206
286 Ga0495584_0004135 3300046491 Bacteria 7832
287 Ga0495584_0004362 3300046491 Bacteria 7619
288 Ga0495584_0007572 3300046491 Bacteria 5660
289 Ga0495584_0014709 3300046491 Bacteria 3987
290 Ga0495584_0151165 3300046491 Bacteria 1179
291 Ga0495585_0000545 3300046492 Bacteria 35585
292 Ga0495585_0024521 3300046492 Bacteria 3458
293 Ga0495585_0029212 3300046492 Bacteria 3139
294 Ga0495585_0042777 3300046492 Bacteria 2535
295 Ga0495585_0153079 3300046492 Bacteria 1201
296 Ga0495594_0089341 3300046499 Bacteria 1725
297 Ga0495607_0000799 3300046501 Bacteria 29847
298 Ga0495607_0002369 3300046501 Bacteria 15384
299 Ga0495607_0011916 3300046501 Bacteria 5760
300 Ga0495607_0021849 3300046501 Bacteria 4023
301 Ga0495607_0034393 3300046501 Bacteria 3074
302 Ga0495607_0039962 3300046501 Bacteria 2796
303 Ga0495607_0043919 3300046501 Bacteria 2639
304 Ga0495607_0063519 3300046501 Bacteria 2088
305 Ga0495607_0148839 3300046501 Bacteria 1200
306 Ga0495607_0176741 3300046501 Bacteria 1073
307 Ga0495583_0000172 3300046506 Bacteria 109791
308 Ga0495583_0000813 3300046506 Bacteria 38429
309 Ga0495583_0005099 3300046506 Bacteria 9057
310 Ga0495583_0008503 3300046506 Bacteria 6263
311 Ga0495583_0014007 3300046506 Bacteria 4442
312 Ga0495583_0044567 3300046506 Bacteria 2056
313 Ga0495606_0000028 3300046507 Bacteria 251032
314 Ga0495606_0000684 3300046507 Bacteria 52863
315 Ga0495606_0002075 3300046507 Bacteria 24486
316 Ga0495606_0003306 3300046507 Bacteria 17217
317 Ga0495606_0012296 3300046507 Bacteria 6884
318 Ga0495606_0065931 3300046507 Bacteria 2298
319 Ga0495610_0001089 3300046512 Bacteria 24852
320 Ga0495610_0004091 3300046512 Bacteria 10927
321 Ga0495610_0012001 3300046512 Bacteria 5249
322 Ga0495610_0012622 3300046512 Bacteria 5071
323 Ga0495610_0017558 3300046512 Bacteria 4076
324 Ga0495610_0020005 3300046512 Bacteria 3729
325 Ga0495610_0020231 3300046512 Bacteria 3700
326 Ga0495610_0054924 3300046512 Bacteria 1922
327 Ga0495610_0056084 3300046512 Bacteria 1896
328 Ga0495616_0017235 3300046513 Bacteria 3984
329 Ga0495616_0021128 3300046513 Bacteria 3529
330 Ga0495616_0025932 3300046513 Bacteria 3125
331 Ga0495616_0052285 3300046513 Bacteria 2034
332 Ga0495620_0000011 3300046515 Bacteria 170987
333 Ga0495620_0000314 3300046515 Bacteria 34524
334 Ga0495620_0004729 3300046515 Bacteria 7653
335 Ga0495620_0006281 3300046515 Bacteria 6539
336 Ga0495620_0015603 3300046515 Bacteria 3831
337 Ga0495620_0015924 3300046515 Bacteria 3785
338 Ga0495630_0026502 3300046517 Bacteria 4292
339 Ga0495630_0050454 3300046517 Bacteria 3114
340 Ga0495631_0000275 3300046518 Bacteria 35971
341 Ga0495631_0008361 3300046518 Bacteria 5215
342 Ga0495631_0015699 3300046518 Bacteria 3622
343 Ga0495631_0031460 3300046518 Bacteria 2400
344 Ga0495631_0072768 3300046518 Bacteria 1484
345 Ga0495632_0001446 3300046519 Bacteria 19737
346 Ga0495632_0001462 3300046519 Bacteria 19633
347 Ga0495632_0002289 3300046519 Bacteria 14750
348 Ga0495632_0017216 3300046519 Bacteria 3996
349 Ga0495632_0030936 3300046519 Bacteria 2773
350 Ga0495632_0031263 3300046519 Bacteria 2754
351 Ga0495632_0034581 3300046519 Bacteria 2585
352 Ga0495632_0159273 3300046519 Bacteria 1040
353 Ga0495637_0000027 3300046520 Bacteria 146241
354 Ga0495637_0001476 3300046520 Bacteria 13811
355 Ga0495637_0009577 3300046520 Bacteria 4722
356 Ga0495637_0014696 3300046520 Bacteria 3688
357 Ga0495637_0021018 3300046520 Bacteria 2994
358 Ga0495637_0046539 3300046520 Bacteria 1834
359 Ga0495637_0047143 3300046520 Bacteria 1820
360 Ga0495637_0058025 3300046520 Bacteria 1596
361 Ga0495643_0005300 3300046522 Bacteria 8753
362 Ga0495643_0005423 3300046522 Bacteria 8632
363 Ga0495643_0009526 3300046522 Bacteria 6032
364 Ga0495643_0011839 3300046522 Bacteria 5289
365 Ga0495643_0013261 3300046522 Bacteria 4939
366 Ga0495643_0051388 3300046522 Bacteria 2216
367 Ga0495643_0073857 3300046522 Bacteria 1786
368 Ga0495644_0007674 3300046523 Bacteria 4160
369 Ga0495644_0007800 3300046523 Bacteria 4125
370 Ga0495644_0008624 3300046523 Bacteria 3925
371 Ga0495644_0026710 3300046523 Bacteria 2189
372 Ga0495644_0061101 3300046523 Bacteria 1416
373 Ga0495648_0008539 3300046524 Bacteria 8045
374 Ga0495648_0012258 3300046524 Bacteria 6405
375 Ga0495648_0012950 3300046524 Bacteria 6194
376 Ga0495648_0014240 3300046524 Bacteria 5833
377 Ga0495648_0017267 3300046524 Bacteria 5167
378 Ga0495648_0026536 3300046524 Bacteria 3896
379 Ga0495648_0027428 3300046524 Bacteria 3812
380 Ga0495648_0027839 3300046524 Bacteria 3776
381 Ga0495648_0053570 3300046524 Bacteria 2443
382 Ga0495648_0062290 3300046524 Bacteria 2209
383 Ga0495648_0066672 3300046524 Bacteria 2109
384 Ga0495648_0089331 3300046524 Bacteria 1729
385 Ga0495648_0116059 3300046524 Bacteria 1447
386 Ga0495648_0134845 3300046524 Bacteria 1307
387 Ga0495666_0001581 3300046526 Bacteria 11205
388 Ga0495666_0013234 3300046526 Bacteria 4114
389 Ga0495666_0027206 3300046526 Bacteria 2816
390 Ga0495666_0040580 3300046526 Bacteria 2256
391 Ga0495666_0097428 3300046526 Bacteria 1386
392 Ga0495642_0000067 3300046528 Bacteria 61823
393 Ga0495642_0000334 3300046528 Bacteria 25618
394 Ga0495642_0017588 3300046528 Bacteria 2794
395 Ga0495654_0000658 3300046530 Bacteria 27234
396 Ga0495654_0001188 3300046530 Bacteria 18540
397 Ga0495654_0005001 3300046530 Bacteria 7787
398 Ga0495654_0015040 3300046530 Bacteria 4111
399 Ga0495654_0023658 3300046530 Bacteria 3180
400 Ga0495654_0029233 3300046530 Bacteria 2811
401 Ga0495654_0030989 3300046530 Bacteria 2716
402 Ga0495654_0032361 3300046530 Bacteria 2651
403 Ga0495654_0034513 3300046530 Bacteria 2551
404 Ga0495654_0046604 3300046530 Bacteria 2134
405 Ga0495654_0055750 3300046530 Bacteria 1912
406 Ga0495654_0074947 3300046530 Bacteria 1597
407 Ga0495586_0014791 3300046535 Bacteria 4148
408 Ga0495587_0030587 3300046536 Bacteria 3264
409 Ga0495609_0000206 3300046538 Bacteria 58720
410 Ga0495609_0006540 3300046538 Bacteria 5937
411 Ga0495609_0034354 3300046538 Bacteria 2299
412 Ga0495597_0007463 3300046542 Bacteria 5549
413 Ga0495597_0011774 3300046542 Bacteria 4236
414 Ga0495597_0055416 3300046542 Bacteria 1738
415 Ga0495597_0080126 3300046542 Bacteria 1397
416 Ga0495597_0090277 3300046542 Bacteria 1301
417 Ga0495645_0033668 3300046543 Bacteria 3738
418 Ga0495622_0000638 3300046557 Bacteria 20320
419 Ga0495622_0004006 3300046557 Bacteria 6876
420 Ga0495622_0005661 3300046557 Bacteria 5793
421 Ga0495622_0008757 3300046557 Bacteria 4688
422 Ga0495622_0015265 3300046557 Bacteria 3570
423 Ga0495622_0033067 3300046557 Bacteria 2414
424 Ga0495633_0023203 3300046558 Bacteria 3074
425 Ga0495633_0036921 3300046558 Bacteria 2339
426 Ga0495633_0038234 3300046558 Bacteria 2293
427 Ga0495656_0015464 3300046615 Bacteria 2880
428 Ga0495668_0003932 3300046616 Bacteria 10849
429 Ga0495668_0020336 3300046616 Bacteria 3819
430 Ga0495634_0004634 3300046642 Bacteria 10725
431 Ga0495634_0089760 3300046642 Bacteria 1997
432 Ga0495611_0004712 3300046648 Bacteria 5858
433 Ga0495611_0039564 3300046648 Bacteria 2099
434 Ga0495611_0201529 3300046648 Bacteria 928
435 Ga0495625_0000296 3300046660 Bacteria 77050
436 Ga0495625_0003091 3300046660 Bacteria 17000
437 Ga0495625_0020945 3300046660 Bacteria 5041
438 Ga0495625_0030847 3300046660 Bacteria 3994
439 Ga0495625_0036429 3300046660 Bacteria 3616
440 Ga0495625_0224082 3300046660 Bacteria 1230
441 Ga0495635_0001148 3300046663 Bacteria 17665
442 Ga0495659_0000598 3300046664 Bacteria 13341
443 Ga0495659_0004432 3300046664 Bacteria 4422
444 Ga0495659_0014043 3300046664 Bacteria 2615
445 Ga0495661_0000119 3300046665 Bacteria 94133
446 Ga0495661_0014902 3300046665 Bacteria 5198
447 Ga0495661_0016659 3300046665 Bacteria 4865
448 Ga0495661_0020600 3300046665 Bacteria 4303
449 Ga0495661_0039361 3300046665 Bacteria 2938
450 Ga0495661_0040715 3300046665 Bacteria 2879
451 Ga0495661_0064652 3300046665 Bacteria 2157
452 Ga0495588_0007905 3300046674 Bacteria 4859
453 Ga0495588_0104023 3300046674 Bacteria 1493
454 Ga0495657_0253755 3300046675 Bacteria 1058
455 Ga0495623_0004954 3300046679 Bacteria 8735
456 Ga0495623_0096825 3300046679 Bacteria 1802
457 Ga0495646_0018087 3300046680 Bacteria 4463
458 Ga0495669_0063712 3300046684 Bacteria 1672
459 Ga0495670_0004075 3300046691 Bacteria 7167
460 Ga0495670_0012001 3300046691 Bacteria 4264
461 Ga0495670_0024729 3300046691 Bacteria 2969
462 Ga0495670_0031010 3300046691 Bacteria 2655
463 Ga0495670_0032593 3300046691 Bacteria 2591
464 Ga0495670_0043503 3300046691 Bacteria 2241
465 Ga0495670_0063342 3300046691 Bacteria 1861
466 Ga0495670_0082414 3300046691 Bacteria 1640
467 Ga0495670_0162304 3300046691 Bacteria 1174
468 Ga0495671_0001916 3300046692 Bacteria 13352
469 Ga0495671_0002561 3300046692 Bacteria 11431
470 Ga0495671_0004284 3300046692 Bacteria 8574
471 Ga0495671_0009697 3300046692 Bacteria 5370
472 Ga0495671_0010657 3300046692 Bacteria 5085
473 Ga0495671_0018723 3300046692 Bacteria 3670
474 Ga0495671_0031902 3300046692 Bacteria 2691
475 Ga0495671_0033160 3300046692 Bacteria 2632
476 Ga0495671_0039221 3300046692 Bacteria 2392
477 Ga0495671_0090269 3300046692 Bacteria 1499
478 Ga0495671_0118828 3300046692 Bacteria 1290
479 Ga0495649_0002307 3300046694 Bacteria 13546
480 Ga0495649_0010671 3300046694 Bacteria 5409
481 Ga0495649_0015118 3300046694 Bacteria 4399
482 Ga0495649_0019652 3300046694 Bacteria 3794
483 Ga0495649_0022717 3300046694 Bacteria 3509
484 Ga0495649_0029786 3300046694 Bacteria 3016
485 Ga0495649_0033607 3300046694 Bacteria 2822
486 Ga0495649_0037245 3300046694 Bacteria 2670
487 Ga0495589_0000220 3300046794 Bacteria 48490
488 Ga0495589_0000931 3300046794 Bacteria 17965
489 Ga0495589_0003983 3300046794 Bacteria 7927
490 Ga0495589_0056847 3300046794 Bacteria 1925
491 Ga0495660_0002659 3300046810 Bacteria 11320
492 Ga0495660_0007182 3300046810 Bacteria 6561
493 Ga0495660_0012139 3300046810 Bacteria 4998
494 Ga0495660_0017838 3300046810 Bacteria 4083
495 Ga0495660_0018431 3300046810 Bacteria 4013
496 Ga0495660_0021115 3300046810 Bacteria 3731
497 Ga0495660_0043482 3300046810 Bacteria 2477
498 Ga0495660_0051552 3300046810 Bacteria 2238
499 Ga0495660_0127604 3300046810 Bacteria 1279
500 Ga0495660_0167537 3300046810 Bacteria 1072
501 Ga0495581_0003194 3300047315 Bacteria 9378
502 Ga0495581_0025995 3300047315 Bacteria 3395
503 Ga0495604_0010786 3300047317 Bacteria 7256
504 Ga0495636_0051151 3300047318 Bacteria 1731
505 Ga0495674_0028321 3300047319 Bacteria 5110
506 Ga0495672_0000553 3300047320 Bacteria 42512
507 Ga0495672_0008074 3300047320 Bacteria 7819
508 Ga0495672_0010919 3300047320 Bacteria 6441
509 Ga0495672_0012559 3300047320 Bacteria 5905
510 Ga0495672_0014257 3300047320 Bacteria 5451
511 Ga0495672_0017997 3300047320 Bacteria 4705
512 Ga0495672_0025140 3300047320 Bacteria 3819
513 Ga0495672_0029851 3300047320 Bacteria 3427
514 Ga0495672_0030038 3300047320 Bacteria 3414
515 Ga0495672_0036031 3300047320 Bacteria 3041
516 Ga0495672_0050232 3300047320 Bacteria 2463
517 Ga0495672_0058772 3300047320 Bacteria 2227
518 Ga0495672_0106168 3300047320 Bacteria 1514
519 Ga0495676_0000003 3300047321 Bacteria 318463
520 Ga0495680_0009996 3300047322 Bacteria 8491
521 Ga0495680_0026818 3300047322 Bacteria 4744
522 Ga0495680_0050829 3300047322 Bacteria 3239
523 Ga0495680_0054160 3300047322 Bacteria 3116
524 Ga0495683_0000382 3300047323 Bacteria 36179
525 Ga0495683_0000852 3300047323 Bacteria 21615
526 Ga0495683_0009550 3300047323 Bacteria 5167
527 Ga0495683_0011676 3300047323 Bacteria 4621
528 Ga0495683_0013000 3300047323 Bacteria 4360
529 Ga0495683_0016722 3300047323 Bacteria 3807
530 Ga0495683_0057577 3300047323 Bacteria 1931
531 Ga0495683_0106566 3300047323 Bacteria 1342
532 Ga0495687_004098 3300047443 Bacteria 10082
533 Ga0495687_004969 3300047443 Bacteria 8694
534 Ga0495687_007403 3300047443 Bacteria 6468
535 Ga0495687_053972 3300047443 Bacteria 1689
536 Ga0495675_0020419 3300047444 Bacteria 4212
537 Ga0495677_0000621 3300047445 Bacteria 14403
538 Ga0495679_001158 3300047446 Bacteria 15748
539 Ga0495679_003272 3300047446 Bacteria 7848
540 Ga0495679_009848 3300047446 Bacteria 3792
541 Ga0495685_012289 3300047447 Bacteria 2899
542 Ga0495673_0000602 3300047469 Bacteria 35831
543 Ga0495673_0000782 3300047469 Bacteria 30047
544 Ga0495673_0002393 3300047469 Bacteria 13258
545 Ga0495673_0003440 3300047469 Bacteria 10422
546 Ga0495673_0010563 3300047469 Bacteria 5011
547 Ga0495673_0016804 3300047469 Bacteria 3730
548 Ga0495673_0029565 3300047469 Bacteria 2584
549 Ga0495673_0035647 3300047469 Bacteria 2289
550 Ga0495673_0038941 3300047469 Bacteria 2159
551 Ga0495673_0052623 3300047469 Bacteria 1778
552 Ga0495681_0005092 3300047470 Bacteria 8861
553 Ga0495681_0007269 3300047470 Bacteria 7114
554 Ga0495681_0009412 3300047470 Bacteria 6022
555 Ga0495681_0010033 3300047470 Bacteria 5766
556 Ga0495681_0011556 3300047470 Bacteria 5249
557 Ga0495681_0012260 3300047470 Bacteria 5049
558 Ga0495681_0014950 3300047470 Bacteria 4421
559 Ga0495681_0017403 3300047470 Bacteria 3990
560 Ga0495681_0023982 3300047470 Bacteria 3225
561 Ga0495681_0027234 3300047470 Bacteria 2960
562 Ga0495681_0033300 3300047470 Bacteria 2583
563 Ga0495684_0035996 3300047471 Bacteria 3796
564 Ga0495686_0010813 3300047472 Bacteria 6469
565 Ga0495686_0047400 3300047472 Bacteria 2713
566 Ga0495593_0008220 3300047673 Bacteria 6070
567 Ga0495593_0023197 3300047673 Bacteria 3451
568 Ga0495614_0036271 3300048089 Bacteria 2117
569 Ga0495626_0000086 3300048091 Bacteria 123059
570 Ga0495626_0001191 3300048091 Bacteria 21581
571 Ga0495626_0001541 3300048091 Bacteria 18097
572 Ga0495626_0002350 3300048091 Bacteria 13316
573 Ga0495626_0005638 3300048091 Bacteria 7252
574 Ga0495626_0005927 3300048091 Bacteria 7037
575 Ga0495626_0099461 3300048091 Bacteria 1269
576 Ga0496102_0000073 3300048905 Bacteria 149887
577 Ga0496102_0055901 3300048905 Bacteria 3599
578 Ga0496103_0051494 3300048906 Bacteria 2549
579 Ga0496104_0409534 3300048907 Bacteria 1268
580 Ga0496110_0150873 3300048913 Bacteria 2105
581 Ga0496110_0215226 3300048913 Bacteria 1747
582 Ga0496111_0159412 3300048914 Bacteria 1675
583 Ga0496111_0334201 3300048914 Bacteria 1122
584 Ga0496114_0102327 3300048917 Bacteria 2447
585 Ga0496115_0021197 3300048918 Bacteria 5018
586 Ga0496116_0000995 3300048919 Bacteria 34718
587 Ga0496116_0015721 3300048919 Bacteria 5965
588 Ga0496117_0013130 3300048920 Bacteria 7250
589 Ga0496117_0014592 3300048920 Bacteria 6759
590 Ga0496117_0022977 3300048920 Bacteria 4987
591 Ga0496117_0024212 3300048920 Bacteria 4809
592 Ga0496117_0024679 3300048920 Bacteria 4745
593 Ga0496117_0025585 3300048920 Bacteria 4637
594 Ga0496117_0044827 3300048920 Bacteria 3200
595 Ga0496117_0103369 3300048920 Bacteria 1795
596 Ga0496117_0200285 3300048920 Bacteria 1129
597 Ga0496118_0020357 3300048921 Bacteria 5884
598 Ga0496118_0022302 3300048921 Bacteria 5542
599 Ga0496118_0023787 3300048921 Bacteria 5308
600 Ga0496118_0025532 3300048921 Bacteria 5061
601 Ga0496118_0031708 3300048921 Bacteria 4374
602 Ga0496118_0044031 3300048921 Bacteria 3499
603 Ga0496118_0052541 3300048921 Bacteria 3106
604 Ga0496118_0054404 3300048921 Bacteria 3032
605 Ga0496118_0083386 3300048921 Bacteria 2235
606 Ga0496118_0112752 3300048921 Bacteria 1799
607 Ga0496118_0117878 3300048921 Bacteria 1740
608 Ga0496119_0002172 3300048922 Bacteria 22016
609 Ga0496119_0007243 3300048922 Bacteria 10040
610 Ga0496120_0002014 3300048923 Bacteria 22111
611 Ga0496120_0005044 3300048923 Bacteria 10703
612 Ga0496120_0146785 3300048923 Bacteria 1190
613 Ga0496121_0001663 3300048924 Bacteria 36677
614 Ga0496121_0005421 3300048924 Bacteria 16376
615 Ga0496121_0026738 3300048924 Bacteria 5422
616 Ga0496121_0028037 3300048924 Bacteria 5252
617 Ga0496121_0030367 3300048924 Bacteria 4964
618 Ga0496121_0094563 3300048924 Bacteria 2324
619 Ga0496121_0175145 3300048924 Bacteria 1554
620 Ga0496121_0191632 3300048924 Bacteria 1465
621 Ga0496121_0358548 3300048924 Bacteria 969
622 Ga0496122_0000244 3300048925 Bacteria 122107
623 Ga0496122_0005970 3300048925 Bacteria 14253
624 Ga0496122_0019091 3300048925 Bacteria 6285
625 Ga0496122_0028352 3300048925 Bacteria 4754
626 Ga0496122_0032031 3300048925 Bacteria 4357
627 Ga0496122_0040945 3300048925 Bacteria 3672
628 Ga0496122_0045809 3300048925 Bacteria 3394
629 Ga0496122_0135941 3300048925 Bacteria 1549
630 Ga0496123_0000201 3300048926 Bacteria 121915
631 Ga0496123_0011426 3300048926 Bacteria 7696
632 Ga0496123_0013135 3300048926 Bacteria 6983
633 Ga0496123_0024807 3300048926 Bacteria 4542
634 Ga0496123_0039495 3300048926 Bacteria 3300
635 Ga0496123_0050969 3300048926 Bacteria 2761
636 Ga0496123_0152347 3300048926 Bacteria 1245
637 Ga0496124_0003104 3300048927 Bacteria 20627
638 Ga0496124_0018543 3300048927 Bacteria 6514
639 Ga0496124_0019143 3300048927 Bacteria 6387
640 Ga0496124_0029065 3300048927 Bacteria 4932
641 Ga0496124_0029690 3300048927 Bacteria 4864
642 Ga0496124_0038621 3300048927 Bacteria 4144
643 Ga0496124_0051265 3300048927 Bacteria 3512
644 Ga0496124_0087049 3300048927 Bacteria 2555
645 Ga0496124_0094458 3300048927 Bacteria 2432
646 Ga0496124_0114604 3300048927 Bacteria 2164
647 Ga0496125_0000862 3300048928 Bacteria 48602
648 Ga0496125_0024867 3300048928 Bacteria 5496
649 Ga0496125_0024937 3300048928 Bacteria 5488
650 Ga0496125_0024954 3300048928 Bacteria 5485
651 Ga0496125_0039292 3300048928 Bacteria 4077
652 Ga0496125_0042139 3300048928 Bacteria 3893
653 Ga0496125_0065178 3300048928 Bacteria 2888
654 Ga0496125_0101603 3300048928 Bacteria 2115
655 Ga0496126_0004738 3300048929 Bacteria 16040
656 Ga0496126_0033523 3300048929 Bacteria 4830
657 Ga0496126_0145215 3300048929 Bacteria 2038
658 Ga0495678_008440 3300049459 Bacteria 5195
659 Ga0495678_008505 3300049459 Bacteria 5169
660 Ga0495678_009902 3300049459 Bacteria 4672
661 Ga0495678_013485 3300049459 Bacteria 3837
662 Ga0495678_021785 3300049459 Bacteria 2815
663 Ga0495678_046866 3300049459 Bacteria 1696
664 Ga0495678_061761 3300049459 Bacteria 1404
665 Ga0495678_064843 3300049459 Bacteria 1358
666 Ga0495682_0000138 3300049460 Bacteria 63246
667 Ga0495682_0004702 3300049460 Bacteria 5780
668 Ga0495682_0018407 3300049460 Bacteria 2630
669 Ga0495682_0023955 3300049460 Bacteria 2278
670 Ga0495682_0035889 3300049460 Bacteria 1825
671 Ga0501032_0010934 3300049569 Bacteria 6526
672 Ga0501034_0000003 3300049571 Bacteria 471748
673 Ga0501034_0235891 3300049571 Bacteria 1777
674 Ga0501034_0428665 3300049571 Bacteria 1243
675 Ga0501037_0234027 3300049573 Bacteria 1289
676 Ga0501226_000017 3300049853 Bacteria 150879
677 nmdc:mga00v17_69450_c1 3300050491 Bacteria 2180
678 nmdc:mga00v17_78588_c1 3300050491 Bacteria 2056
679 Ga0500659_0063600 3300053135 Bacteria 1966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0070917 Ga0495590_0070917_10_849 279
2 3300009036 Ga0105244_10014628 Ga0105244_100146282 293
3 3300025728 Ga0207655_1002020 Ga0207655_10020202 293
4 3300048920 Ga0496117_0200285 Ga0496117_0200285_98_1015 293
5 3300048924 Ga0496121_0005421 Ga0496121_0005421_6173_7090 293
6 3300048925 Ga0496122_0000244 Ga0496122_0000244_77536_78453 293
7 3300048926 Ga0496123_0000201 Ga0496123_0000201_77589_78506 293
8 3300048905 Ga0496102_0055901 Ga0496102_0055901_610_1557 295
9 3300047322 Ga0495680_0050829 Ga0495680_0050829_2139_3113 296
10 3300047673 Ga0495593_0023197 Ga0495593_0023197_329_1303 296
11 3300002737 JGI25162J39368_1000050 JGI25162J39368_100005057 297
12 3300002771 JGI25163J39215_1000351 JGI25163J39215_100035116 297
13 3300002772 JGI25164J39214_1000025 JGI25164J39214_1000025104 297
14 3300003214 JGI25165J46597_1000114 JGI25165J46597_1000114104 297
15 3300003214 JGI25165J46597_1000176 JGI25165J46597_100017645 297
16 3300009011 Ga0105251_10000038 Ga0105251_10000038102 297
17 3300013100 Ga0157373_10001148 Ga0157373_1000114814 297
18 3300013102 Ga0157371_10001502 Ga0157371_1000150218 297
19 3300025207 Ga0209760_100033 Ga0209760_10003333 297
20 3300025231 Ga0207427_100003 Ga0207427_100003896 297
21 3300025233 Ga0209437_100002 Ga0209437_100002118 297
22 3300025261 Ga0209233_1000004 Ga0209233_10000041308 297
23 3300025735 Ga0207713_1000185 Ga0207713_100018570 297
24 3300025935 Ga0207709_10003872 Ga0207709_100038721 297
25 3300046458 Ga0495591_000809 Ga0495591_000809_3754_4695 297
26 3300046471 Ga0495650_0001051 Ga0495650_0001051_10580_11521 297
27 3300046474 Ga0495605_0001638 Ga0495605_0001638_9007_9948 297
28 3300046491 Ga0495584_0007572 Ga0495584_0007572_3741_4682 297
29 3300046501 Ga0495607_0039962 Ga0495607_0039962_525_1466 297
30 3300046506 Ga0495583_0005099 Ga0495583_0005099_2416_3357 297
31 3300046507 Ga0495606_0002075 Ga0495606_0002075_21379_22320 297
32 3300046512 Ga0495610_0004091 Ga0495610_0004091_42_983 297
33 3300046513 Ga0495616_0017235 Ga0495616_0017235_1409_2350 297
34 3300046515 Ga0495620_0015924 Ga0495620_0015924_1717_2658 297
35 3300046518 Ga0495631_0072768 Ga0495631_0072768_463_1404 297
36 3300046519 Ga0495632_0001446 Ga0495632_0001446_5799_6740 297
37 3300046520 Ga0495637_0000027 Ga0495637_0000027_93756_94697 297
38 3300046522 Ga0495643_0073857 Ga0495643_0073857_160_1101 297
39 3300046523 Ga0495644_0007674 Ga0495644_0007674_720_1661 297
40 3300046524 Ga0495648_0062290 Ga0495648_0062290_885_1826 297
41 3300046530 Ga0495654_0005001 Ga0495654_0005001_3718_4659 297
42 3300046538 Ga0495609_0000206 Ga0495609_0000206_31284_32225 297
43 3300046557 Ga0495622_0015265 Ga0495622_0015265_413_1354 297
44 3300046616 Ga0495668_0003932 Ga0495668_0003932_1531_2472 297
45 3300046648 Ga0495611_0004712 Ga0495611_0004712_4457_5398 297
46 3300046648 Ga0495611_0201529 Ga0495611_0201529_16_909 297
47 3300046660 Ga0495625_0000296 Ga0495625_0000296_72565_73506 297
48 3300046665 Ga0495661_0000119 Ga0495661_0000119_33431_34372 297
49 3300046692 Ga0495671_0031902 Ga0495671_0031902_698_1639 297
50 3300046694 Ga0495649_0029786 Ga0495649_0029786_633_1574 297
51 3300046810 Ga0495660_0002659 Ga0495660_0002659_6113_7054 297
52 3300046810 Ga0495660_0051552 Ga0495660_0051552_914_1855 297
53 3300047320 Ga0495672_0029851 Ga0495672_0029851_626_1567 297
54 3300047321 Ga0495676_0000003 Ga0495676_0000003_55602_56543 297
55 3300047446 Ga0495679_001158 Ga0495679_001158_12830_13771 297
56 3300047469 Ga0495673_0035647 Ga0495673_0035647_160_1101 297
57 3300047470 Ga0495681_0010033 Ga0495681_0010033_3051_3992 297
58 3300048091 Ga0495626_0000086 Ga0495626_0000086_26297_27238 297
59 3300048913 Ga0496110_0215226 Ga0496110_0215226_28_939 297
60 3300048919 Ga0496116_0015721 Ga0496116_0015721_1525_2454 297
61 3300048920 Ga0496117_0025585 Ga0496117_0025585_1053_1982 297
62 3300048921 Ga0496118_0054404 Ga0496118_0054404_1116_2063 297
63 3300048921 Ga0496118_0117878 Ga0496118_0117878_167_1096 297
64 3300048924 Ga0496121_0028037 Ga0496121_0028037_1501_2430 297
65 3300048924 Ga0496121_0358548 Ga0496121_0358548_18_911 297
66 3300048925 Ga0496122_0028352 Ga0496122_0028352_2719_3648 297
67 3300048926 Ga0496123_0024807 Ga0496123_0024807_988_1917 297
68 3300003791 Ga0055530_10000075 Ga0055530_1000007538 300
69 3300003792 Ga0055540_1000115 Ga0055540_100011538 300
70 3300015265 Ga0182005_1017753 Ga0182005_10177533 300
71 3300025292 Ga0209676_1008768 Ga0209676_10087685 300
72 3300025298 Ga0209050_1000013 Ga0209050_1000013430 300
73 3300025303 Ga0209051_1000007 Ga0209051_1000007430 300
74 3300025304 Ga0209257_1011899 Ga0209257_10118993 300
75 3300046471 Ga0495650_0006072 Ga0495650_0006072_224_1171 300
76 3300046501 Ga0495607_0000799 Ga0495607_0000799_5484_6431 300
77 3300046507 Ga0495606_0000028 Ga0495606_0000028_11585_12532 300
78 3300046512 Ga0495610_0012622 Ga0495610_0012622_625_1572 300
79 3300046515 Ga0495620_0000314 Ga0495620_0000314_5645_6592 300
80 3300046616 Ga0495668_0020336 Ga0495668_0020336_727_1656 300
81 3300047469 Ga0495673_0003440 Ga0495673_0003440_5847_6776 300
82 3300048914 Ga0496111_0159412 Ga0496111_0159412_577_1506 300
83 3300048924 Ga0496121_0001663 Ga0496121_0001663_29448_30377 300
84 3300048925 Ga0496122_0045809 Ga0496122_0045809_513_1442 300
85 3300048926 Ga0496123_0050969 Ga0496123_0050969_1339_2268 300
86 3300048927 Ga0496124_0003104 Ga0496124_0003104_1378_2307 300
87 3300049460 Ga0495682_0000138 Ga0495682_0000138_38915_39862 300
88 3300046506 Ga0495583_0044567 Ga0495583_0044567_150_1100 301
89 3300046520 Ga0495637_0047143 Ga0495637_0047143_37_987 301
90 3300009177 Ga0105248_10712762 Ga0105248_107127622 302
91 iso_pu_bacteria 2738543020 2739286375 303
92 iso_pu_bacteria 2738543021 2739291688 303
93 iso_pu_bacteria 2808606361 2808856270 303
94 iso_pu_bacteria 2808606376 2808924710 303
95 iso_pu_bacteria 2808606378 2808938991 303
96 iso_pu_bacteria 2808606380 2808946708 303
97 iso_pu_bacteria 2808606383 2808964762 303
98 iso_pu_bacteria 2808606389 2809002100 303
99 iso_pu_bacteria 2844665904 2844669659 303
100 iso_pu_bacteria 8052494512 8052497779 303
101 iso_pu_bacteria 8055878733 8055883312 303
102 iso_pu_bacteria 8057798959 8057799663 303
103 3300042010 Ga0439452_004693 Ga0439452_004693_2528_3442 304
104 3300044712 Ga0453684_0246669 Ga0453684_0246669_192_1154 304
105 3300045051 Ga0451576_0000591 Ga0451576_0000591_63832_64785 304
106 iso_pu_bacteria 2600254954 2600446630 304
107 iso_pu_bacteria 2600255389 2602010829 304
108 iso_pu_bacteria 2823421272 2823423410 304
109 iso_pu_bacteria 2919501602 2919505220 304
110 iso_pu_bacteria 2926063275 2926066897 304
111 iso_pu_bacteria 8011350971 8011354595 304
112 iso_pu_bacteria 8034962539 8034963697 304
113 iso_pu_bacteria 2554235341 2555669224 305
114 iso_pu_bacteria 2599185160 2599357878 305
115 iso_pu_bacteria 2599185161 2599361631 305
116 iso_pu_bacteria 2599185162 2599367953 305
117 iso_pu_bacteria 2599185163 2599374742 305
118 iso_pu_bacteria 2599185164 2599383043 305
119 iso_pu_bacteria 2599185165 2599389574 305
120 iso_pu_bacteria 2599185166 2599393600 305
121 iso_pu_bacteria 2599185168 2599405367 305
122 iso_pu_bacteria 2599185181 2599464694 305
123 iso_pu_bacteria 2599185182 2599468244 305
124 iso_pu_bacteria 2599185186 2599493717 305
125 iso_pu_bacteria 2599185188 2599502315 305
126 iso_pu_bacteria 2599185248 2599769044 305
127 iso_pu_bacteria 2599185289 2599884843 305
128 iso_pu_bacteria 2599185291 2599895979 305
129 iso_pu_bacteria 2599185302 2599943375 305
130 iso_pu_bacteria 2599185304 2599954486 305
131 iso_pu_bacteria 2599185305 2599957864 305
132 iso_pu_bacteria 2599185306 2599966787 305
133 iso_pu_bacteria 2599185308 2599978066 305
134 iso_pu_bacteria 2599185309 2599983799 305
135 iso_pu_bacteria 2599185310 2599988695 305
136 iso_pu_bacteria 2599185312 2600001401 305
137 iso_pu_bacteria 2599185313 2600004039 305
138 iso_pu_bacteria 2599185314 2600012207 305
139 iso_pu_bacteria 2599185315 2600015587 305
140 iso_pu_bacteria 2599185320 2600048604 305
141 iso_pu_bacteria 2599185321 2600050795 305
142 iso_pu_bacteria 2599185324 2600072673 305
143 iso_pu_bacteria 2599185356 2600217416 305
144 iso_pu_bacteria 2600254931 2600365632 305
145 iso_pu_bacteria 2600255313 2601777586 305
146 iso_pu_bacteria 2643221650 2644283938 305
147 iso_pu_bacteria 2651869719 2652544946 305
148 iso_pu_bacteria 2667528170 2671088671 305
149 iso_pu_bacteria 2667528171 2671098273 305
150 iso_pu_bacteria 2728369097 2729145489 305
151 iso_pu_bacteria 2808606379 2808943241 305
152 iso_pu_bacteria 2818991464 2819703344 305
153 iso_pu_bacteria 2913036834 2913039677 305
154 iso_pu_bacteria 2917070673 2917073027 305
155 iso_pu_bacteria 2919155634 2919156765 305
156 iso_pu_bacteria 2923586266 2923588446 305
157 iso_pu_bacteria 2931369376 2931375147 305
158 iso_pu_bacteria 2935353572 2935359443 305
159 iso_pu_bacteria 3007803356 3007808261 305
160 iso_pu_bacteria 637000220 637319559 305
161 iso_pu_bacteria 640427133 640488211 305
162 iso_pu_bacteria 651053060 651176165 305
163 iso_pu_bacteria 8019769354 8019775663 305
164 iso_pu_bacteria 8054503363 8054507050 305
165 3300009036 Ga0105244_10001524 Ga0105244_100015245 306
166 3300009092 Ga0105250_10027363 Ga0105250_100273632 306
167 3300009148 Ga0105243_10039721 Ga0105243_100397213 306
168 3300013307 Ga0157372_10001218 Ga0157372_100012185 306
169 3300017792 Ga0163161_10040096 Ga0163161_100400964 306
170 3300046507 Ga0495606_0000684 Ga0495606_0000684_2064_2987 306
171 3300046522 Ga0495643_0009526 Ga0495643_0009526_3880_4803 306
172 3300046692 Ga0495671_0001916 Ga0495671_0001916_9705_10628 306
173 3300046694 Ga0495649_0010671 Ga0495649_0010671_2012_2935 306
174 3300046694 Ga0495649_0033607 Ga0495649_0033607_171_1094 306
175 3300048917 Ga0496114_0102327 Ga0496114_0102327_580_1503 306
176 3300048920 Ga0496117_0022977 Ga0496117_0022977_2842_3765 306
177 3300048920 Ga0496117_0024212 Ga0496117_0024212_1033_1962 306
178 3300048921 Ga0496118_0025532 Ga0496118_0025532_2774_3703 306
179 3300048921 Ga0496118_0083386 Ga0496118_0083386_398_1321 306
180 3300048922 Ga0496119_0002172 Ga0496119_0002172_17258_18181 306
181 3300048923 Ga0496120_0002014 Ga0496120_0002014_17661_18584 306
182 3300048925 Ga0496122_0005970 Ga0496122_0005970_1628_2551 306
183 3300048926 Ga0496123_0011426 Ga0496123_0011426_1516_2439 306
184 3300048927 Ga0496124_0029065 Ga0496124_0029065_1165_2088 306
185 3300048928 Ga0496125_0065178 Ga0496125_0065178_149_1072 306
186 3300048929 Ga0496126_0145215 Ga0496126_0145215_1022_1951 306
187 iso_pu_bacteria 2511231018 2511336178 306
188 iso_pu_bacteria 2511231156 2511824964 306
189 iso_pu_bacteria 2599185212 2599612842 306
190 iso_pu_bacteria 2599185288 2599877985 306
191 iso_pu_bacteria 2599185300 2599932623 306
192 iso_pu_bacteria 2599185303 2599952207 306
193 iso_pu_bacteria 2599185311 2599993354 306
194 iso_pu_bacteria 2599185316 2600021941 306
195 iso_pu_bacteria 2599185317 2600028546 306
196 iso_pu_bacteria 2599185318 2600037538 306
197 iso_pu_bacteria 2599185319 2600042867 306
198 iso_pu_bacteria 2599185322 2600060077 306
199 iso_pu_bacteria 2599185323 2600063298 306
200 iso_pu_bacteria 2599185325 2600075215 306
201 iso_pu_bacteria 2600254930 2600357713 306
202 iso_pu_bacteria 2619619299 2621298795 306
203 iso_pu_bacteria 2667528176 2671126289 306
204 iso_pu_bacteria 2675903515 2678263601 306
205 iso_pu_bacteria 2738541265 2738672044 306
206 iso_pu_bacteria 2738541282 2738750437 306
207 iso_pu_bacteria 2738541294 2738810032 306
208 iso_pu_bacteria 2738541303 2738859478 306
209 iso_pu_bacteria 2738541309 2738897392 306
210 iso_pu_bacteria 2744054620 2745009932 306
211 iso_pu_bacteria 2791355520 2794594850 306
212 iso_pu_bacteria 2808606382 2808958309 306
213 iso_pu_bacteria 2808606385 2808977000 306
214 iso_pu_bacteria 2808606388 2808992155 306
215 iso_pu_bacteria 2816332298 2817492044 306
216 iso_pu_bacteria 2825651385 2825651975 306
217 iso_pu_bacteria 2834028612 2834032858 306
218 iso_pu_bacteria 2842854478 2842858150 306
219 iso_pu_bacteria 2852612431 2852613666 306
220 iso_pu_bacteria 2852667396 2852668598 306
221 iso_pu_bacteria 2919481497 2919484767 306
222 iso_pu_bacteria 2929144301 2929147582 306
223 iso_pu_bacteria 2988728565 2988728860 306
224 iso_pu_bacteria 3007866637 3007869135 306
225 iso_pu_bacteria 8056131705 8056135481 306
226 iso_pu_bacteria 8056143049 8056146203 306
227 3300006944 Ga0099823_1000001 Ga0099823_1000001147 307
228 3300027296 Ga0209389_1000007 Ga0209389_1000007157 307
229 3300031548 Ga0307408_100000018 Ga0307408_100000018248 307
230 3300042439 Ga0439464_0000443 Ga0439464_0000443_1894_2823 307
231 3300042993 Ga0439440_0040919 Ga0439440_0040919_134_1060 307
232 3300046522 Ga0495643_0005423 Ga0495643_0005423_2766_3692 307
233 3300047469 Ga0495673_0016804 Ga0495673_0016804_753_1694 307
234 3300048924 Ga0496121_0175145 Ga0496121_0175145_507_1439 307
235 3300048927 Ga0496124_0051265 Ga0496124_0051265_2030_2956 307
236 3300048927 Ga0496124_0087049 Ga0496124_0087049_405_1337 307
237 3300049571 Ga0501034_0000003 Ga0501034_0000003_467100_468023 307
238 3300049853 Ga0501226_000017 Ga0501226_000017_13526_14455 307
239 3300053135 Ga0500659_0063600 Ga0500659_0063600_422_1345 307
240 iso_pu_bacteria 2511231004 2511258060 307
241 iso_pu_bacteria 2511231012 2511302942 307
242 iso_pu_bacteria 2511231022 2511362726 307
243 iso_pu_bacteria 2738543004 2739197683 307
244 iso_pu_bacteria 2904550169 2904550568 307
245 iso_pu_bacteria 639633007 639788133 307
246 iso_pu_bacteria 8056155041 8056157623 307
247 3300015265 Ga0182005_1000524 Ga0182005_100052416 308
248 3300042533 Ga0450901_002227 Ga0450901_002227_1085_2053 308
249 3300046506 Ga0495583_0000813 Ga0495583_0000813_23692_24624 308
250 3300046530 Ga0495654_0000658 Ga0495654_0000658_12406_13338 308
251 3300048921 Ga0496118_0112752 Ga0496118_0112752_317_1246 308
252 iso_pu_bacteria 2511231007 2511271543 308
253 iso_pu_bacteria 2511231015 2511322862 308
254 iso_pu_bacteria 2511231016 2511329322 308
255 iso_pu_bacteria 2511231017 2511331381 308
256 iso_pu_bacteria 2511231019 2511342237 308
257 iso_pu_bacteria 2511231021 2511354953 308
258 iso_pu_bacteria 2599185167 2599397862 308
259 iso_pu_bacteria 2599185179 2599452309 308
260 iso_pu_bacteria 2599185190 2599513312 308
261 iso_pu_bacteria 2599185191 2599518188 308
262 iso_pu_bacteria 2599185290 2599891988 308
263 iso_pu_bacteria 2623620446 2624492660 308
264 iso_pu_bacteria 2643221565 2643841653 308
265 iso_pu_bacteria 2643221589 2643956968 308
266 iso_pu_bacteria 2643221602 2644024891 308
267 iso_pu_bacteria 2643221633 2644186760 308
268 iso_pu_bacteria 2675903420 2677900729 308
269 iso_pu_bacteria 2738543015 2739258597 308
270 iso_pu_bacteria 2773857670 2774123241 308
271 iso_pu_bacteria 2784132072 2784315765 308
272 iso_pu_bacteria 2808606377 2808932978 308
273 iso_pu_bacteria 2808606381 2808955123 308
274 iso_pu_bacteria 2860339153 2860342340 308
275 iso_pu_bacteria 2919456309 2919459020 308
276 iso_pu_bacteria 2919697872 2919702646 308
277 iso_pu_bacteria 2931390751 2931394537 308
278 iso_pu_bacteria 2931396565 2931402423 308
279 iso_pu_bacteria 2939636861 2939638499 308
280 iso_pu_bacteria 2945928738 2945934226 308
281 iso_pu_bacteria 3007511990 3007514619 308
282 iso_pu_bacteria 8019775933 8019781052 308
283 iso_pu_bacteria 8055817908 8055820115 308
284 iso_pu_bacteria 8056125926 8056129298 308
285 iso_pu_bacteria 8056161164 8056165253 308
286 3300005289 Ga0065704_10009688 Ga0065704_100096884 309
287 3300006946 Ga0079104_1000554 Ga0079104_10005544 309
288 3300014497 Ga0182008_10040881 Ga0182008_100408812 309
289 3300025292 Ga0209676_1000617 Ga0209676_10006178 309
290 3300025711 Ga0207696_1000016 Ga0207696_1000016147 309
291 3300025711 Ga0207696_1024126 Ga0207696_10241262 309
292 3300025728 Ga0207655_1000384 Ga0207655_100038444 309
293 3300025735 Ga0207713_1001969 Ga0207713_10019693 309
294 3300025935 Ga0207709_10430934 Ga0207709_104309341 309
295 3300027111 Ga0209281_1000009 Ga0209281_1000009448 309
296 3300031731 Ga0307405_10074088 Ga0307405_100740882 309
297 3300041405 Ga0439438_005962 Ga0439438_005962_552_1487 309
298 3300041411 Ga0439466_0006691 Ga0439466_0006691_2840_3769 309
299 3300042010 Ga0439452_018732 Ga0439452_018732_807_1742 309
300 3300042016 Ga0439463_002247 Ga0439463_002247_121_1068 309
301 3300046452 Ga0495617_005450 Ga0495617_005450_2731_3660 309
302 3300046453 Ga0495627_005583 Ga0495627_005583_1569_2498 309
303 3300046458 Ga0495591_000174 Ga0495591_000174_33695_34642 309
304 3300046458 Ga0495591_015979 Ga0495591_015979_1624_2553 309
305 3300046512 Ga0495610_0001089 Ga0495610_0001089_1483_2412 309
306 3300046513 Ga0495616_0021128 Ga0495616_0021128_223_1152 309
307 3300046515 Ga0495620_0015603 Ga0495620_0015603_310_1239 309
308 3300046519 Ga0495632_0017216 Ga0495632_0017216_2891_3820 309
309 3300046523 Ga0495644_0008624 Ga0495644_0008624_98_1027 309
310 3300046524 Ga0495648_0027839 Ga0495648_0027839_90_1019 309
311 3300046530 Ga0495654_0015040 Ga0495654_0015040_271_1200 309
312 3300046542 Ga0495597_0080126 Ga0495597_0080126_54_983 309
313 3300046558 Ga0495633_0038234 Ga0495633_0038234_1324_2253 309
314 3300046660 Ga0495625_0020945 Ga0495625_0020945_1226_2155 309
315 3300046665 Ga0495661_0020600 Ga0495661_0020600_2912_3841 309
316 3300046691 Ga0495670_0004075 Ga0495670_0004075_3820_4749 309
317 3300046692 Ga0495671_0018723 Ga0495671_0018723_2306_3235 309
318 3300047320 Ga0495672_0106168 Ga0495672_0106168_438_1367 309
319 3300047446 Ga0495679_003272 Ga0495679_003272_3840_4769 309
320 3300047469 Ga0495673_0052623 Ga0495673_0052623_78_1007 309
321 3300047470 Ga0495681_0012260 Ga0495681_0012260_2616_3545 309
322 3300048914 Ga0496111_0334201 Ga0496111_0334201_160_1107 309
323 3300048925 Ga0496122_0032031 Ga0496122_0032031_531_1460 309
324 3300048926 Ga0496123_0013135 Ga0496123_0013135_2903_3832 309
325 3300048927 Ga0496124_0018543 Ga0496124_0018543_2644_3591 309
326 3300048928 Ga0496125_0000862 Ga0496125_0000862_23649_24578 309
327 3300048928 Ga0496125_0024954 Ga0496125_0024954_1629_2567 309
328 iso_pu_bacteria 2599185307 2599970390 309
329 iso_pu_bacteria 2811994881 2812368046 309
330 iso_pu_bacteria 2923519811 2923522098 309
331 2162886007 SwRhRL2b_contig_1319436 SwRhRL2b_0346.00006940 310
332 3300005288 Ga0065714_10002340 Ga0065714_100023404 310
333 3300005288 Ga0065714_10074007 Ga0065714_100740071 310
334 3300005289 Ga0065704_10000778 Ga0065704_1000077810 310
335 3300005289 Ga0065704_10072252 Ga0065704_100722527 310
336 3300005331 Ga0070670_100000303 Ga0070670_10000030323 310
337 3300005344 Ga0070661_100002107 Ga0070661_1000021075 310
338 3300005353 Ga0070669_100030218 Ga0070669_1000302182 310
339 3300005457 Ga0070662_100001726 Ga0070662_1000017265 310
340 3300005564 Ga0070664_100002981 Ga0070664_1000029816 310
341 3300005578 Ga0068854_100204646 Ga0068854_1002046461 310
342 3300005834 Ga0068851_10000132 Ga0068851_1000013220 310
343 3300009011 Ga0105251_10002494 Ga0105251_100024949 310
344 3300009011 Ga0105251_10012550 Ga0105251_100125503 310
345 3300009036 Ga0105244_10000016 Ga0105244_1000001620 310
346 3300009036 Ga0105244_10004851 Ga0105244_100048516 310
347 3300009036 Ga0105244_10016545 Ga0105244_100165452 310
348 3300009036 Ga0105244_10084222 Ga0105244_100842222 310
349 3300009092 Ga0105250_10000353 Ga0105250_1000035316 310
350 3300009148 Ga0105243_10014929 Ga0105243_100149295 310
351 3300009176 Ga0105242_10022928 Ga0105242_100229283 310
352 3300009545 Ga0105237_10006234 Ga0105237_100062345 310
353 3300011119 Ga0105246_10047293 Ga0105246_100472932 310
354 3300013100 Ga0157373_10006474 Ga0157373_100064745 310
355 3300013100 Ga0157373_10008114 Ga0157373_100081143 310
356 3300013102 Ga0157371_10054590 Ga0157371_100545901 310
357 3300013104 Ga0157370_10135693 Ga0157370_101356932 310
358 3300013105 Ga0157369_10009531 Ga0157369_100095319 310
359 3300013105 Ga0157369_10011089 Ga0157369_100110899 310
360 3300013105 Ga0157369_10012461 Ga0157369_100124617 310
361 3300013306 Ga0163162_10421486 Ga0163162_104214861 310
362 3300013308 Ga0157375_10188795 Ga0157375_101887953 310
363 3300014497 Ga0182008_10000604 Ga0182008_100006044 310
364 3300014497 Ga0182008_10009829 Ga0182008_100098294 310
365 3300015261 Ga0182006_1001202 Ga0182006_100120212 310
366 3300015261 Ga0182006_1061485 Ga0182006_10614852 310
367 3300015262 Ga0182007_10001255 Ga0182007_100012555 310
368 3300015262 Ga0182007_10013309 Ga0182007_100133091 310
369 3300017792 Ga0163161_10006045 Ga0163161_100060455 310
370 3300017792 Ga0163161_10119533 Ga0163161_101195332 310
371 3300025321 Ga0207656_10000287 Ga0207656_100002874 310
372 3300025711 Ga0207696_1000108 Ga0207696_100010897 310
373 3300025728 Ga0207655_1000027 Ga0207655_1000027248 310
374 3300025728 Ga0207655_1000114 Ga0207655_10001147 310
375 3300025735 Ga0207713_1002029 Ga0207713_10020293 310
376 3300025735 Ga0207713_1006075 Ga0207713_10060759 310
377 3300025914 Ga0207671_10001354 Ga0207671_100013545 310
378 3300025920 Ga0207649_10000577 Ga0207649_100005776 310
379 3300025923 Ga0207681_10006717 Ga0207681_100067175 310
380 3300025925 Ga0207650_10000068 Ga0207650_10000068112 310
381 3300025933 Ga0207706_10004228 Ga0207706_100042286 310
382 3300025934 Ga0207686_10046243 Ga0207686_100462432 310
383 3300025935 Ga0207709_10013552 Ga0207709_100135524 310
384 3300025945 Ga0207679_10001702 Ga0207679_100017027 310
385 3300025981 Ga0207640_10133741 Ga0207640_101337411 310
386 3300031548 Ga0307408_100014570 Ga0307408_1000145705 310
387 3300031548 Ga0307408_100094845 Ga0307408_1000948453 310
388 3300031731 Ga0307405_10000137 Ga0307405_1000013714 310
389 3300031731 Ga0307405_10005300 Ga0307405_100053005 310
390 3300031731 Ga0307405_10392857 Ga0307405_103928571 310
391 3300031901 Ga0307406_10183447 Ga0307406_101834472 310
392 3300031901 Ga0307406_10324395 Ga0307406_103243951 310
393 3300031903 Ga0307407_10208722 Ga0307407_102087221 310
394 3300031911 Ga0307412_10029725 Ga0307412_100297251 310
395 3300031911 Ga0307412_10115139 Ga0307412_101151392 310
396 3300032002 Ga0307416_100234527 Ga0307416_1002345271 310
397 3300032004 Ga0307414_10052408 Ga0307414_100524084 310
398 3300032004 Ga0307414_10088530 Ga0307414_100885302 310
399 3300032004 Ga0307414_10193598 Ga0307414_101935981 310
400 3300032005 Ga0307411_10020277 Ga0307411_100202771 310
401 3300032005 Ga0307411_10075767 Ga0307411_100757672 310
402 3300041405 Ga0439438_004339 Ga0439438_004339_1469_2404 310
403 3300041407 Ga0439447_004429 Ga0439447_004429_3827_4759 310
404 3300041997 Ga0439431_0002411 Ga0439431_0002411_1878_2813 310
405 3300042006 Ga0439432_000171 Ga0439432_000171_9364_10338 310
406 3300042006 Ga0439432_007279 Ga0439432_007279_2221_3156 310
407 3300042010 Ga0439452_009314 Ga0439452_009314_110_1045 310
408 3300042115 Ga0450911_010864 Ga0450911_010864_48_1022 310
409 3300042131 Ga0450894_002753 Ga0450894_002753_1117_2091 310
410 3300042134 Ga0450898_000712 Ga0450898_000712_2576_3550 310
411 3300042135 Ga0450899_001487 Ga0450899_001487_334_1308 310
412 3300042147 Ga0450910_002522 Ga0450910_002522_125_1060 310
413 3300042156 Ga0439446_0028856 Ga0439446_0028856_32_967 310
414 3300046459 Ga0495629_0093107 Ga0495629_0093107_993_1931 310
415 3300046460 Ga0495638_0021838 Ga0495638_0021838_2772_3704 310
416 3300046473 Ga0495582_0015874 Ga0495582_0015874_1944_2915 310
417 3300046475 Ga0495639_0041389 Ga0495639_0041389_996_1934 310
418 3300046499 Ga0495594_0089341 Ga0495594_0089341_655_1620 310
419 3300046512 Ga0495610_0020231 Ga0495610_0020231_832_1770 310
420 3300046515 Ga0495620_0000011 Ga0495620_0000011_2641_3582 310
421 3300046530 Ga0495654_0023658 Ga0495654_0023658_650_1582 310
422 3300046530 Ga0495654_0046604 Ga0495654_0046604_1157_2095 310
423 3300046535 Ga0495586_0014791 Ga0495586_0014791_2252_3223 310
424 3300046536 Ga0495587_0030587 Ga0495587_0030587_115_1086 310
425 3300046543 Ga0495645_0033668 Ga0495645_0033668_728_1666 310
426 3300046642 Ga0495634_0089760 Ga0495634_0089760_920_1891 310
427 3300046680 Ga0495646_0018087 Ga0495646_0018087_2304_3275 310
428 3300047315 Ga0495581_0025995 Ga0495581_0025995_2314_3285 310
429 3300047317 Ga0495604_0010786 Ga0495604_0010786_42_1013 310
430 3300047322 Ga0495680_0054160 Ga0495680_0054160_28_999 310
431 3300047470 Ga0495681_0009412 Ga0495681_0009412_3311_4243 310
432 3300047470 Ga0495681_0017403 Ga0495681_0017403_2917_3849 310
433 3300048920 Ga0496117_0013130 Ga0496117_0013130_1859_2800 310
434 3300048920 Ga0496117_0014592 Ga0496117_0014592_1954_2892 310
435 3300048920 Ga0496117_0044827 Ga0496117_0044827_1786_2760 310
436 3300048920 Ga0496117_0103369 Ga0496117_0103369_215_1189 310
437 3300048921 Ga0496118_0022302 Ga0496118_0022302_1700_2674 310
438 3300048921 Ga0496118_0023787 Ga0496118_0023787_1225_2157 310
439 3300048921 Ga0496118_0052541 Ga0496118_0052541_355_1329 310
440 3300048922 Ga0496119_0007243 Ga0496119_0007243_2539_3477 310
441 3300048923 Ga0496120_0005044 Ga0496120_0005044_6931_7869 310
442 3300048923 Ga0496120_0146785 Ga0496120_0146785_35_967 310
443 3300048924 Ga0496121_0026738 Ga0496121_0026738_2611_3549 310
444 3300048924 Ga0496121_0094563 Ga0496121_0094563_1152_2084 310
445 3300048925 Ga0496122_0040945 Ga0496122_0040945_2272_3210 310
446 3300048925 Ga0496122_0135941 Ga0496122_0135941_306_1247 310
447 3300048926 Ga0496123_0039495 Ga0496123_0039495_1769_2707 310
448 3300048927 Ga0496124_0029690 Ga0496124_0029690_1882_2820 310
449 3300048927 Ga0496124_0038621 Ga0496124_0038621_454_1386 310
450 3300048928 Ga0496125_0039292 Ga0496125_0039292_2866_3840 310
451 3300048928 Ga0496125_0042139 Ga0496125_0042139_2879_3817 310
452 3300048928 Ga0496125_0101603 Ga0496125_0101603_37_975 310
453 3300048929 Ga0496126_0004738 Ga0496126_0004738_3730_4704 310
454 3300048929 Ga0496126_0033523 Ga0496126_0033523_2625_3599 310
455 3300003791 Ga0055530_10032368 Ga0055530_100323682 311
456 3300009148 Ga0105243_10054921 Ga0105243_100549212 311
457 3300013100 Ga0157373_10086368 Ga0157373_100863682 311
458 3300017792 Ga0163161_10075880 Ga0163161_100758803 311
459 3300025292 Ga0209676_1004064 Ga0209676_10040643 311
460 3300025298 Ga0209050_1000914 Ga0209050_100091421 311
461 3300025735 Ga0207713_1015292 Ga0207713_10152922 311
462 3300027907 Ga0207428_10064906 Ga0207428_100649062 311
463 3300027907 Ga0207428_10155921 Ga0207428_101559211 311
464 3300041411 Ga0439466_0030632 Ga0439466_0030632_376_1311 311
465 3300042009 Ga0439451_010572 Ga0439451_010572_393_1328 311
466 3300042010 Ga0439452_000677 Ga0439452_000677_15499_16434 311
467 3300042010 Ga0439452_007797 Ga0439452_007797_871_1806 311
468 3300042127 Ga0450890_000606 Ga0450890_000606_4069_5004 311
469 3300042138 Ga0450903_001686 Ga0450903_001686_1206_2141 311
470 3300042461 Ga0439460_0002498 Ga0439460_0002498_1418_2353 311
471 3300046452 Ga0495617_007936 Ga0495617_007936_1200_2135 311
472 3300046457 Ga0495590_0002605 Ga0495590_0002605_3119_4054 311
473 3300046474 Ga0495605_0002121 Ga0495605_0002121_2857_3792 311
474 3300046491 Ga0495584_0002919 Ga0495584_0002919_2870_3805 311
475 3300046491 Ga0495584_0004362 Ga0495584_0004362_5433_6368 311
476 3300046512 Ga0495610_0054924 Ga0495610_0054924_839_1831 311
477 3300046518 Ga0495631_0031460 Ga0495631_0031460_1203_2138 311
478 3300046519 Ga0495632_0034581 Ga0495632_0034581_1109_2101 311
479 3300046523 Ga0495644_0061101 Ga0495644_0061101_60_995 311
480 3300046524 Ga0495648_0017267 Ga0495648_0017267_243_1178 311
481 3300046528 Ga0495642_0000067 Ga0495642_0000067_36673_37608 311
482 3300046530 Ga0495654_0055750 Ga0495654_0055750_38_1030 311
483 3300046538 Ga0495609_0034354 Ga0495609_0034354_147_1082 311
484 3300046665 Ga0495661_0064652 Ga0495661_0064652_1058_2008 311
485 3300046674 Ga0495588_0104023 Ga0495588_0104023_305_1240 311
486 3300046684 Ga0495669_0063712 Ga0495669_0063712_54_989 311
487 3300046692 Ga0495671_0004284 Ga0495671_0004284_3419_4354 311
488 3300046692 Ga0495671_0039221 Ga0495671_0039221_1352_2287 311
489 3300046694 Ga0495649_0037245 Ga0495649_0037245_1391_2383 311
490 3300046810 Ga0495660_0167537 Ga0495660_0167537_29_1021 311
491 3300047320 Ga0495672_0014257 Ga0495672_0014257_3703_4695 311
492 3300047323 Ga0495683_0106566 Ga0495683_0106566_261_1196 311
493 3300047443 Ga0495687_007403 Ga0495687_007403_3987_4922 311
494 3300047470 Ga0495681_0007269 Ga0495681_0007269_3101_4036 311
495 3300048091 Ga0495626_0001191 Ga0495626_0001191_17516_18451 311
496 3300048091 Ga0495626_0005927 Ga0495626_0005927_3275_4210 311
497 3300048091 Ga0495626_0099461 Ga0495626_0099461_84_1019 311
498 3300049569 Ga0501032_0010934 Ga0501032_0010934_2066_3001 311
499 3300049571 Ga0501034_0235891 Ga0501034_0235891_672_1607 311
500 3300049571 Ga0501034_0428665 Ga0501034_0428665_233_1168 311
501 3300049573 Ga0501037_0234027 Ga0501037_0234027_67_1002 311
502 2124908027 MRS2a_Contig_5158 MRS2a_00057610 312
503 3300005288 Ga0065714_10000744 Ga0065714_100007442 312
504 3300005288 Ga0065714_10006336 Ga0065714_100063361 312
505 3300005288 Ga0065714_10029782 Ga0065714_100297822 312
506 3300005288 Ga0065714_10083749 Ga0065714_100837492 312
507 3300005288 Ga0065714_10092038 Ga0065714_100920381 312
508 3300005288 Ga0065714_10092661 Ga0065714_100926612 312
509 3300005290 Ga0065712_10008598 Ga0065712_100085981 312
510 3300005293 Ga0065715_10281495 Ga0065715_102814951 312
511 3300006058 Ga0075432_10001039 Ga0075432_100010393 312
512 3300006058 Ga0075432_10008235 Ga0075432_100082353 312
513 3300006058 Ga0075432_10016885 Ga0075432_100168852 312
514 3300006177 Ga0075362_10012119 Ga0075362_100121191 312
515 3300006946 Ga0079104_1000303 Ga0079104_100030349 312
516 3300009011 Ga0105251_10010425 Ga0105251_100104252 312
517 3300009036 Ga0105244_10008586 Ga0105244_100085864 312
518 3300009036 Ga0105244_10111564 Ga0105244_101115642 312
519 3300013102 Ga0157371_10001866 Ga0157371_100018663 312
520 3300013104 Ga0157370_10001953 Ga0157370_100019537 312
521 3300013104 Ga0157370_10134614 Ga0157370_101346143 312
522 3300014497 Ga0182008_10007960 Ga0182008_100079603 312
523 3300015261 Ga0182006_1003368 Ga0182006_10033681 312
524 3300015261 Ga0182006_1007155 Ga0182006_10071551 312
525 3300015262 Ga0182007_10000071 Ga0182007_1000007117 312
526 3300015265 Ga0182005_1002580 Ga0182005_10025806 312
527 3300017792 Ga0163161_10004705 Ga0163161_100047055 312
528 3300017792 Ga0163161_10013164 Ga0163161_100131645 312
529 3300017792 Ga0163161_10044526 Ga0163161_100445262 312
530 3300025728 Ga0207655_1003059 Ga0207655_10030597 312
531 3300025728 Ga0207655_1022254 Ga0207655_10222542 312
532 3300025735 Ga0207713_1032451 Ga0207713_10324513 312
533 3300027111 Ga0209281_1000063 Ga0209281_100006346 312
534 3300027907 Ga0207428_10009356 Ga0207428_100093562 312
535 3300027907 Ga0207428_10052476 Ga0207428_100524763 312
536 3300027907 Ga0207428_10142031 Ga0207428_101420312 312
537 3300027907 Ga0207428_10256962 Ga0207428_102569621 312
538 3300041405 Ga0439438_003908 Ga0439438_003908_3973_4911 312
539 3300041405 Ga0439438_013043 Ga0439438_013043_265_1203 312
540 3300041405 Ga0439438_017339 Ga0439438_017339_1044_1982 312
541 3300041407 Ga0439447_003607 Ga0439447_003607_2864_3805 312
542 3300041407 Ga0439447_009200 Ga0439447_009200_88_1026 312
543 3300041407 Ga0439447_015362 Ga0439447_015362_190_1161 312
544 3300041411 Ga0439466_0002538 Ga0439466_0002538_2672_3643 312
545 3300041411 Ga0439466_0004357 Ga0439466_0004357_3832_4773 312
546 3300041411 Ga0439466_0009076 Ga0439466_0009076_2467_3405 312
547 3300041411 Ga0439466_0015463 Ga0439466_0015463_1309_2247 312
548 3300041413 Ga0439465_0008365 Ga0439465_0008365_1727_2665 312
549 3300042006 Ga0439432_010393 Ga0439432_010393_201_1139 312
550 3300042006 Ga0439432_013015 Ga0439432_013015_1682_2620 312
551 3300042009 Ga0439451_016675 Ga0439451_016675_327_1265 312
552 3300042009 Ga0439451_036055 Ga0439451_036055_10_948 312
553 3300042010 Ga0439452_003056 Ga0439452_003056_3230_4168 312
554 3300042010 Ga0439452_004545 Ga0439452_004545_637_1578 312
555 3300042010 Ga0439452_010565 Ga0439452_010565_1648_2586 312
556 3300042013 Ga0439456_004218 Ga0439456_004218_105_1043 312
557 3300042016 Ga0439463_004592 Ga0439463_004592_277_1215 312
558 3300042115 Ga0450911_002259 Ga0450911_002259_2067_3005 312
559 3300042115 Ga0450911_002820 Ga0450911_002820_835_1779 312
560 3300042115 Ga0450911_003118 Ga0450911_003118_1938_2876 312
561 3300042122 Ga0450920_000960 Ga0450920_000960_1786_2724 312
562 3300042124 Ga0450922_000360 Ga0450922_000360_602_1540 312
563 3300042137 Ga0450902_001289 Ga0450902_001289_510_1481 312
564 3300042137 Ga0450902_003671 Ga0450902_003671_1253_2191 312
565 3300042137 Ga0450902_006821 Ga0450902_006821_754_1692 312
566 3300042138 Ga0450903_001697 Ga0450903_001697_1496_2434 312
567 3300042142 Ga0450905_001436 Ga0450905_001436_1424_2395 312
568 3300042145 Ga0450906_003228 Ga0450906_003228_802_1740 312
569 3300042146 Ga0450907_000140 Ga0450907_000140_8955_9896 312
570 3300042146 Ga0450907_025237 Ga0450907_025237_43_981 312
571 3300042147 Ga0450910_009742 Ga0450910_009742_173_1111 312
572 3300042184 Ga0450908_001543 Ga0450908_001543_599_1537 312
573 3300042184 Ga0450908_005901 Ga0450908_005901_1134_2072 312
574 3300042185 Ga0450909_002131 Ga0450909_002131_1321_2259 312
575 3300042435 Ga0439434_0002427 Ga0439434_0002427_3441_4382 312
576 3300042435 Ga0439434_0004141 Ga0439434_0004141_1868_2806 312
577 3300042439 Ga0439464_0016060 Ga0439464_0016060_104_1042 312
578 3300042461 Ga0439460_0005265 Ga0439460_0005265_982_1923 312
579 3300042993 Ga0439440_0001299 Ga0439440_0001299_1165_2106 312
580 3300042993 Ga0439440_0012945 Ga0439440_0012945_214_1152 312
581 3300046452 Ga0495617_000826 Ga0495617_000826_12235_13173 312
582 3300046452 Ga0495617_008755 Ga0495617_008755_30_1001 312
583 3300046452 Ga0495617_009711 Ga0495617_009711_2117_3055 312
584 3300046452 Ga0495617_065742 Ga0495617_065742_205_1143 312
585 3300046455 Ga0495603_0004426 Ga0495603_0004426_522_1460 312
586 3300046455 Ga0495603_0036666 Ga0495603_0036666_1525_2463 312
587 3300046457 Ga0495590_0006559 Ga0495590_0006559_3093_4031 312
588 3300046457 Ga0495590_0025540 Ga0495590_0025540_19_957 312
589 3300046458 Ga0495591_000697 Ga0495591_000697_12200_13171 312
590 3300046458 Ga0495591_001735 Ga0495591_001735_93_1031 312
591 3300046458 Ga0495591_008718 Ga0495591_008718_2797_3768 312
592 3300046458 Ga0495591_031472 Ga0495591_031472_396_1334 312
593 3300046460 Ga0495638_0003448 Ga0495638_0003448_7368_8306 312
594 3300046460 Ga0495638_0011837 Ga0495638_0011837_2907_3878 312
595 3300046460 Ga0495638_0036107 Ga0495638_0036107_1138_2076 312
596 3300046460 Ga0495638_0058887 Ga0495638_0058887_1016_1996 312
597 3300046460 Ga0495638_0123132 Ga0495638_0123132_230_1168 312
598 3300046460 Ga0495638_0223700 Ga0495638_0223700_71_1009 312
599 3300046463 Ga0495653_0049230 Ga0495653_0049230_616_1554 312
600 3300046463 Ga0495653_0288031 Ga0495653_0288031_105_1043 312
601 3300046471 Ga0495650_0002388 Ga0495650_0002388_14035_15051 312
602 3300046471 Ga0495650_0008122 Ga0495650_0008122_783_1721 312
603 3300046471 Ga0495650_0011840 Ga0495650_0011840_2677_3648 312
604 3300046471 Ga0495650_0031224 Ga0495650_0031224_1299_2237 312
605 3300046472 Ga0495580_0326583 Ga0495580_0326583_56_994 312
606 3300046474 Ga0495605_0000076 Ga0495605_0000076_95347_96309 312
607 3300046474 Ga0495605_0002432 Ga0495605_0002432_618_1556 312
608 3300046474 Ga0495605_0011566 Ga0495605_0011566_1071_2042 312
609 3300046474 Ga0495605_0017220 Ga0495605_0017220_85_1023 312
610 3300046474 Ga0495605_0023402 Ga0495605_0023402_307_1245 312
611 3300046474 Ga0495605_0036829 Ga0495605_0036829_821_1759 312
612 3300046475 Ga0495639_0000563 Ga0495639_0000563_15562_16500 312
613 3300046475 Ga0495639_0007071 Ga0495639_0007071_1511_2449 312
614 3300046491 Ga0495584_0001241 Ga0495584_0001241_196_1134 312
615 3300046491 Ga0495584_0001301 Ga0495584_0001301_1549_2520 312
616 3300046491 Ga0495584_0003118 Ga0495584_0003118_4280_5218 312
617 3300046491 Ga0495584_0004135 Ga0495584_0004135_5609_6547 312
618 3300046491 Ga0495584_0014709 Ga0495584_0014709_157_1095 312
619 3300046491 Ga0495584_0151165 Ga0495584_0151165_53_991 312
620 3300046492 Ga0495585_0000545 Ga0495585_0000545_31188_32126 312
621 3300046492 Ga0495585_0024521 Ga0495585_0024521_2156_3136 312
622 3300046492 Ga0495585_0029212 Ga0495585_0029212_1548_2486 312
623 3300046492 Ga0495585_0042777 Ga0495585_0042777_50_988 312
624 3300046492 Ga0495585_0153079 Ga0495585_0153079_97_1035 312
625 3300046501 Ga0495607_0002369 Ga0495607_0002369_2967_3905 312
626 3300046501 Ga0495607_0011916 Ga0495607_0011916_843_1781 312
627 3300046501 Ga0495607_0021849 Ga0495607_0021849_2823_3761 312
628 3300046501 Ga0495607_0034393 Ga0495607_0034393_41_979 312
629 3300046501 Ga0495607_0043919 Ga0495607_0043919_110_1048 312
630 3300046501 Ga0495607_0063519 Ga0495607_0063519_1010_1948 312
631 3300046501 Ga0495607_0148839 Ga0495607_0148839_197_1135 312
632 3300046501 Ga0495607_0176741 Ga0495607_0176741_41_979 312
633 3300046506 Ga0495583_0000172 Ga0495583_0000172_102703_103641 312
634 3300046506 Ga0495583_0008503 Ga0495583_0008503_1236_2174 312
635 3300046506 Ga0495583_0014007 Ga0495583_0014007_381_1319 312
636 3300046507 Ga0495606_0003306 Ga0495606_0003306_4311_5249 312
637 3300046507 Ga0495606_0012296 Ga0495606_0012296_2901_3872 312
638 3300046507 Ga0495606_0065931 Ga0495606_0065931_350_1330 312
639 3300046512 Ga0495610_0012001 Ga0495610_0012001_3616_4596 312
640 3300046512 Ga0495610_0017558 Ga0495610_0017558_384_1322 312
641 3300046512 Ga0495610_0020005 Ga0495610_0020005_2126_3106 312
642 3300046512 Ga0495610_0056084 Ga0495610_0056084_507_1487 312
643 3300046513 Ga0495616_0025932 Ga0495616_0025932_1562_2500 312
644 3300046513 Ga0495616_0052285 Ga0495616_0052285_10_948 312
645 3300046515 Ga0495620_0004729 Ga0495620_0004729_4324_5340 312
646 3300046515 Ga0495620_0006281 Ga0495620_0006281_4116_5054 312
647 3300046517 Ga0495630_0026502 Ga0495630_0026502_526_1464 312
648 3300046517 Ga0495630_0050454 Ga0495630_0050454_1415_2353 312
649 3300046518 Ga0495631_0000275 Ga0495631_0000275_17933_18871 312
650 3300046518 Ga0495631_0008361 Ga0495631_0008361_47_985 312
651 3300046518 Ga0495631_0015699 Ga0495631_0015699_1171_2109 312
652 3300046519 Ga0495632_0001462 Ga0495632_0001462_17303_18241 312
653 3300046519 Ga0495632_0002289 Ga0495632_0002289_12133_13071 312
654 3300046519 Ga0495632_0030936 Ga0495632_0030936_1628_2599 312
655 3300046519 Ga0495632_0031263 Ga0495632_0031263_426_1364 312
656 3300046519 Ga0495632_0159273 Ga0495632_0159273_13_951 312
657 3300046520 Ga0495637_0001476 Ga0495637_0001476_3198_4136 312
658 3300046520 Ga0495637_0009577 Ga0495637_0009577_648_1586 312
659 3300046520 Ga0495637_0014696 Ga0495637_0014696_1668_2639 312
660 3300046520 Ga0495637_0021018 Ga0495637_0021018_1020_1958 312
661 3300046520 Ga0495637_0046539 Ga0495637_0046539_11_949 312
662 3300046520 Ga0495637_0058025 Ga0495637_0058025_62_1000 312
663 3300046522 Ga0495643_0005300 Ga0495643_0005300_484_1422 312
664 3300046522 Ga0495643_0011839 Ga0495643_0011839_3574_4512 312
665 3300046522 Ga0495643_0013261 Ga0495643_0013261_2863_3801 312
666 3300046522 Ga0495643_0051388 Ga0495643_0051388_203_1141 312
667 3300046523 Ga0495644_0007800 Ga0495644_0007800_454_1425 312
668 3300046523 Ga0495644_0026710 Ga0495644_0026710_991_1929 312
669 3300046524 Ga0495648_0008539 Ga0495648_0008539_1567_2505 312
670 3300046524 Ga0495648_0012258 Ga0495648_0012258_3899_4870 312
671 3300046524 Ga0495648_0012950 Ga0495648_0012950_1542_2489 312
672 3300046524 Ga0495648_0014240 Ga0495648_0014240_3657_4595 312
673 3300046524 Ga0495648_0026536 Ga0495648_0026536_1217_2155 312
674 3300046524 Ga0495648_0027428 Ga0495648_0027428_1007_1978 312
675 3300046524 Ga0495648_0053570 Ga0495648_0053570_725_1663 312
676 3300046524 Ga0495648_0066672 Ga0495648_0066672_26_964 312
677 3300046524 Ga0495648_0089331 Ga0495648_0089331_688_1626 312
678 3300046524 Ga0495648_0116059 Ga0495648_0116059_439_1377 312
679 3300046524 Ga0495648_0134845 Ga0495648_0134845_104_1042 312
680 3300046526 Ga0495666_0001581 Ga0495666_0001581_427_1365 312
681 3300046526 Ga0495666_0013234 Ga0495666_0013234_747_1685 312
682 3300046526 Ga0495666_0027206 Ga0495666_0027206_255_1193 312
683 3300046526 Ga0495666_0040580 Ga0495666_0040580_847_1827 312
684 3300046526 Ga0495666_0097428 Ga0495666_0097428_66_1010 312
685 3300046528 Ga0495642_0000334 Ga0495642_0000334_17968_18906 312
686 3300046528 Ga0495642_0017588 Ga0495642_0017588_1352_2290 312
687 3300046530 Ga0495654_0001188 Ga0495654_0001188_16044_16982 312
688 3300046530 Ga0495654_0029233 Ga0495654_0029233_1105_2043 312
689 3300046530 Ga0495654_0030989 Ga0495654_0030989_888_1859 312
690 3300046530 Ga0495654_0032361 Ga0495654_0032361_728_1666 312
691 3300046530 Ga0495654_0034513 Ga0495654_0034513_83_1021 312
692 3300046530 Ga0495654_0074947 Ga0495654_0074947_358_1329 312
693 3300046538 Ga0495609_0006540 Ga0495609_0006540_2254_3192 312
694 3300046542 Ga0495597_0007463 Ga0495597_0007463_196_1134 312
695 3300046542 Ga0495597_0011774 Ga0495597_0011774_2716_3657 312
696 3300046542 Ga0495597_0055416 Ga0495597_0055416_283_1221 312
697 3300046542 Ga0495597_0090277 Ga0495597_0090277_89_1027 312
698 3300046557 Ga0495622_0000638 Ga0495622_0000638_18819_19757 312
699 3300046557 Ga0495622_0004006 Ga0495622_0004006_3197_4135 312
700 3300046557 Ga0495622_0005661 Ga0495622_0005661_3255_4193 312
701 3300046557 Ga0495622_0008757 Ga0495622_0008757_2961_3899 312
702 3300046557 Ga0495622_0033067 Ga0495622_0033067_449_1387 312
703 3300046558 Ga0495633_0023203 Ga0495633_0023203_1509_2447 312
704 3300046558 Ga0495633_0036921 Ga0495633_0036921_1329_2267 312
705 3300046615 Ga0495656_0015464 Ga0495656_0015464_1660_2598 312
706 3300046642 Ga0495634_0004634 Ga0495634_0004634_9099_10037 312
707 3300046648 Ga0495611_0039564 Ga0495611_0039564_350_1288 312
708 3300046660 Ga0495625_0003091 Ga0495625_0003091_15310_16326 312
709 3300046660 Ga0495625_0030847 Ga0495625_0030847_1417_2355 312
710 3300046660 Ga0495625_0036429 Ga0495625_0036429_193_1131 312
711 3300046660 Ga0495625_0224082 Ga0495625_0224082_220_1158 312
712 3300046663 Ga0495635_0001148 Ga0495635_0001148_1142_2080 312
713 3300046664 Ga0495659_0000598 Ga0495659_0000598_10843_11781 312
714 3300046664 Ga0495659_0004432 Ga0495659_0004432_287_1225 312
715 3300046664 Ga0495659_0014043 Ga0495659_0014043_720_1658 312
716 3300046665 Ga0495661_0014902 Ga0495661_0014902_763_1734 312
717 3300046665 Ga0495661_0016659 Ga0495661_0016659_3200_4138 312
718 3300046665 Ga0495661_0039361 Ga0495661_0039361_995_1933 312
719 3300046665 Ga0495661_0040715 Ga0495661_0040715_81_1019 312
720 3300046674 Ga0495588_0007905 Ga0495588_0007905_1185_2123 312
721 3300046675 Ga0495657_0253755 Ga0495657_0253755_100_1038 312
722 3300046679 Ga0495623_0004954 Ga0495623_0004954_7221_8159 312
723 3300046679 Ga0495623_0096825 Ga0495623_0096825_177_1115 312
724 3300046691 Ga0495670_0012001 Ga0495670_0012001_1579_2517 312
725 3300046691 Ga0495670_0024729 Ga0495670_0024729_1579_2517 312
726 3300046691 Ga0495670_0031010 Ga0495670_0031010_585_1523 312
727 3300046691 Ga0495670_0032593 Ga0495670_0032593_1580_2518 312
728 3300046691 Ga0495670_0043503 Ga0495670_0043503_1208_2146 312
729 3300046691 Ga0495670_0063342 Ga0495670_0063342_847_1785 312
730 3300046691 Ga0495670_0082414 Ga0495670_0082414_234_1172 312
731 3300046691 Ga0495670_0162304 Ga0495670_0162304_148_1086 312
732 3300046692 Ga0495671_0002561 Ga0495671_0002561_10010_10948 312
733 3300046692 Ga0495671_0009697 Ga0495671_0009697_4379_5317 312
734 3300046692 Ga0495671_0010657 Ga0495671_0010657_582_1520 312
735 3300046692 Ga0495671_0033160 Ga0495671_0033160_662_1600 312
736 3300046692 Ga0495671_0090269 Ga0495671_0090269_430_1368 312
737 3300046692 Ga0495671_0118828 Ga0495671_0118828_15_953 312
738 3300046694 Ga0495649_0002307 Ga0495649_0002307_12197_13135 312
739 3300046694 Ga0495649_0015118 Ga0495649_0015118_2792_3763 312
740 3300046694 Ga0495649_0019652 Ga0495649_0019652_78_1016 312
741 3300046694 Ga0495649_0022717 Ga0495649_0022717_1016_1954 312
742 3300046794 Ga0495589_0000220 Ga0495589_0000220_41616_42554 312
743 3300046794 Ga0495589_0000931 Ga0495589_0000931_15500_16438 312
744 3300046794 Ga0495589_0003983 Ga0495589_0003983_1439_2377 312
745 3300046794 Ga0495589_0056847 Ga0495589_0056847_826_1764 312
746 3300046810 Ga0495660_0007182 Ga0495660_0007182_1512_2483 312
747 3300046810 Ga0495660_0012139 Ga0495660_0012139_70_1008 312
748 3300046810 Ga0495660_0017838 Ga0495660_0017838_597_1559 312
749 3300046810 Ga0495660_0018431 Ga0495660_0018431_1394_2332 312
750 3300046810 Ga0495660_0021115 Ga0495660_0021115_70_1008 312
751 3300046810 Ga0495660_0043482 Ga0495660_0043482_98_1036 312
752 3300046810 Ga0495660_0127604 Ga0495660_0127604_175_1113 312
753 3300047315 Ga0495581_0003194 Ga0495581_0003194_1110_2048 312
754 3300047318 Ga0495636_0051151 Ga0495636_0051151_598_1536 312
755 3300047319 Ga0495674_0028321 Ga0495674_0028321_4142_5080 312
756 3300047320 Ga0495672_0000553 Ga0495672_0000553_21625_22563 312
757 3300047320 Ga0495672_0008074 Ga0495672_0008074_3928_4866 312
758 3300047320 Ga0495672_0010919 Ga0495672_0010919_3601_4572 312
759 3300047320 Ga0495672_0012559 Ga0495672_0012559_3282_4226 312
760 3300047320 Ga0495672_0017997 Ga0495672_0017997_774_1712 312
761 3300047320 Ga0495672_0025140 Ga0495672_0025140_2624_3562 312
762 3300047320 Ga0495672_0030038 Ga0495672_0030038_2383_3321 312
763 3300047320 Ga0495672_0036031 Ga0495672_0036031_1443_2381 312
764 3300047320 Ga0495672_0050232 Ga0495672_0050232_68_1006 312
765 3300047320 Ga0495672_0058772 Ga0495672_0058772_248_1228 312
766 3300047322 Ga0495680_0009996 Ga0495680_0009996_1163_2101 312
767 3300047322 Ga0495680_0026818 Ga0495680_0026818_2547_3527 312
768 3300047323 Ga0495683_0000382 Ga0495683_0000382_17056_18072 312
769 3300047323 Ga0495683_0000852 Ga0495683_0000852_17731_18669 312
770 3300047323 Ga0495683_0009550 Ga0495683_0009550_3809_4747 312
771 3300047323 Ga0495683_0011676 Ga0495683_0011676_974_1945 312
772 3300047323 Ga0495683_0013000 Ga0495683_0013000_284_1222 312
773 3300047323 Ga0495683_0016722 Ga0495683_0016722_526_1464 312
774 3300047323 Ga0495683_0057577 Ga0495683_0057577_466_1404 312
775 3300047443 Ga0495687_004098 Ga0495687_004098_1634_2572 312
776 3300047443 Ga0495687_004969 Ga0495687_004969_326_1264 312
777 3300047443 Ga0495687_053972 Ga0495687_053972_528_1466 312
778 3300047444 Ga0495675_0020419 Ga0495675_0020419_363_1301 312
779 3300047445 Ga0495677_0000621 Ga0495677_0000621_12840_13778 312
780 3300047446 Ga0495679_009848 Ga0495679_009848_1691_2629 312
781 3300047447 Ga0495685_012289 Ga0495685_012289_1078_2016 312
782 3300047469 Ga0495673_0000602 Ga0495673_0000602_17943_18881 312
783 3300047469 Ga0495673_0000782 Ga0495673_0000782_10535_11506 312
784 3300047469 Ga0495673_0002393 Ga0495673_0002393_4175_5113 312
785 3300047469 Ga0495673_0010563 Ga0495673_0010563_391_1362 312
786 3300047469 Ga0495673_0029565 Ga0495673_0029565_1477_2415 312
787 3300047469 Ga0495673_0038941 Ga0495673_0038941_76_1014 312
788 3300047470 Ga0495681_0005092 Ga0495681_0005092_7416_8387 312
789 3300047470 Ga0495681_0011556 Ga0495681_0011556_3843_4823 312
790 3300047470 Ga0495681_0014950 Ga0495681_0014950_502_1440 312
791 3300047470 Ga0495681_0023982 Ga0495681_0023982_409_1347 312
792 3300047470 Ga0495681_0027234 Ga0495681_0027234_1149_2087 312
793 3300047470 Ga0495681_0033300 Ga0495681_0033300_776_1756 312
794 3300047471 Ga0495684_0035996 Ga0495684_0035996_1946_2884 312
795 3300047472 Ga0495686_0010813 Ga0495686_0010813_1377_2315 312
796 3300047472 Ga0495686_0047400 Ga0495686_0047400_102_1040 312
797 3300047673 Ga0495593_0008220 Ga0495593_0008220_898_1836 312
798 3300048089 Ga0495614_0036271 Ga0495614_0036271_1136_2074 312
799 3300048091 Ga0495626_0001541 Ga0495626_0001541_15571_16509 312
800 3300048091 Ga0495626_0002350 Ga0495626_0002350_8141_9079 312
801 3300048091 Ga0495626_0005638 Ga0495626_0005638_5609_6547 312
802 3300048905 Ga0496102_0000073 Ga0496102_0000073_128227_129165 312
803 3300048906 Ga0496103_0051494 Ga0496103_0051494_475_1413 312
804 3300048907 Ga0496104_0409534 Ga0496104_0409534_173_1111 312
805 3300048913 Ga0496110_0150873 Ga0496110_0150873_154_1092 312
806 3300048918 Ga0496115_0021197 Ga0496115_0021197_140_1078 312
807 3300048919 Ga0496116_0000995 Ga0496116_0000995_16471_17409 312
808 3300048920 Ga0496117_0024679 Ga0496117_0024679_3230_4168 312
809 3300048921 Ga0496118_0020357 Ga0496118_0020357_4262_5200 312
810 3300048921 Ga0496118_0031708 Ga0496118_0031708_2902_3840 312
811 3300048921 Ga0496118_0044031 Ga0496118_0044031_2472_3410 312
812 3300048924 Ga0496121_0030367 Ga0496121_0030367_131_1069 312
813 3300048924 Ga0496121_0191632 Ga0496121_0191632_83_1021 312
814 3300048925 Ga0496122_0019091 Ga0496122_0019091_1256_2194 312
815 3300048926 Ga0496123_0152347 Ga0496123_0152347_285_1223 312
816 3300048927 Ga0496124_0019143 Ga0496124_0019143_2618_3589 312
817 3300048927 Ga0496124_0094458 Ga0496124_0094458_397_1335 312
818 3300048927 Ga0496124_0114604 Ga0496124_0114604_289_1227 312
819 3300048928 Ga0496125_0024867 Ga0496125_0024867_4502_5440 312
820 3300048928 Ga0496125_0024937 Ga0496125_0024937_4041_5021 312
821 3300049459 Ga0495678_008440 Ga0495678_008440_4185_5123 312
822 3300049459 Ga0495678_008505 Ga0495678_008505_931_1869 312
823 3300049459 Ga0495678_009902 Ga0495678_009902_2779_3717 312
824 3300049459 Ga0495678_013485 Ga0495678_013485_1193_2131 312
825 3300049459 Ga0495678_021785 Ga0495678_021785_1074_2012 312
826 3300049459 Ga0495678_046866 Ga0495678_046866_86_1027 312
827 3300049459 Ga0495678_061761 Ga0495678_061761_104_1042 312
828 3300049459 Ga0495678_064843 Ga0495678_064843_298_1269 312
829 3300049460 Ga0495682_0004702 Ga0495682_0004702_4017_4955 312
830 3300049460 Ga0495682_0018407 Ga0495682_0018407_1419_2357 312
831 3300049460 Ga0495682_0023955 Ga0495682_0023955_737_1675 312
832 3300049460 Ga0495682_0035889 Ga0495682_0035889_699_1637 312
833 3300050491 nmdc:mga00v17_69450_c1 nmdc:mga00v17_69450_c1_711_1649 312
834 3300050491 nmdc:mga00v17_78588_c1 nmdc:mga00v17_78588_c1_681_1619 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

60

244

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xfr-assembly1.cif.gz_A metallo-beta-lactamase from pontibacter korlensis 0.8631 22 246
4nq5-assembly1.cif.gz_A bacillus cereus zn-dependent metallo-beta-lactamase at ph 7 complexed with compound cs319 0.8568 26 245
1bmc-assembly1.cif.gz_A structure of a zinc metallo-beta-lactamase from bacillus cereus 0.8555 26 245
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8543 22 245
3fai-assembly1.cif.gz_A the di zinc carbapenemase cpha n220g mutant 0.8528 21 245
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8574 152 234 3.60.15.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8535 21 245 3.60.15.10
1x8gA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8359 21 245 3.60.15.10
3l6nA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8253 19 245 3.60.15.10
4nq7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8241 26 245 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3D0K7C7-F1-model_v4 deleted 0.9808 11 152
AF-A0A431KTK1-F1-model_v4 Quinoprotein relay system zinc metallohydrolase 1 0.9789 12 268 GO:0016787
AF-A0A1X1QQ21-F1-model_v4 MBL fold metallo-hydrolase 0.9755 18 298 GO:0016787
AF-A0A661F283-F1-model_v4 MBL fold metallo-hydrolase 0.973 12 191 GO:0016787
AF-A0A2P8EN68-F1-model_v4 Quinoprotein relay system zinc metallohydrolase 1 0.9726 12 297 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.04 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map