F482798

General Info

Members Datasets Scaffolds Average Seq Length
834 258 1668 239

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0442980|Ga0395900_0442980_482_1240
Length 252
Sequence MSADPLLAGQSMVAAMPIHVRAAPGEYAEAVLLPGDPLRAKYIADTYLDNVQQRNAERGLLGFTGDWEGKPVSVQGTGMGCPGATIVFEELIQLGCKKLMRVGTCGGLQPHHQLGDLIVALSAVPADATAMHLVANEPHCPTASWSLIHGAVHVAKGIGQDMHVGPIVSSDLFYNPDEGQYERWSKRGVLAVEMEAAALFTIGALRGVETGCLLTVSDIVVEGVFTRISDDELRAAVDRMTRVALDTVTAQH

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0442980 3300037418 Bacteria 1256
2 Ga0070658_10007803 3300005327 Bacteria 8622
3 Ga0070658_10015001 3300005327 Bacteria 6203
4 Ga0070658_10017256 3300005327 Bacteria 5777
5 Ga0070658_10142602 3300005327 Bacteria 2002
6 Ga0070658_10201183 3300005327 Bacteria 1681
7 Ga0070658_10247057 3300005327 Bacteria 1513
8 Ga0070683_100029811 3300005329 Bacteria 4944
9 Ga0070683_100097492 3300005329 Bacteria 2766
10 Ga0070683_100181009 3300005329 Unclassified 2001
11 Ga0070683_100298884 3300005329 Unclassified 1531
12 Ga0070680_100012026 3300005336 Bacteria 6714
13 Ga0070680_100024864 3300005336 Bacteria 4787
14 Ga0070680_100048592 3300005336 Bacteria 3458
15 Ga0070680_100516351 3300005336 Unclassified 1023
16 Ga0070682_100100957 3300005337 Bacteria 1904
17 Ga0070682_100231633 3300005337 Unclassified 1321
18 Ga0070660_100033559 3300005339 Bacteria 3869
19 Ga0070660_100045246 3300005339 Bacteria 3368
20 Ga0070660_100071914 3300005339 Bacteria 2701
21 Ga0070660_100097205 3300005339 Unclassified 2329
22 Ga0070660_100206388 3300005339 Bacteria 1594
23 Ga0070660_100495756 3300005339 Bacteria 1016
24 Ga0070691_10056721 3300005341 Bacteria 1878
25 Ga0070661_100006585 3300005344 Bacteria 8009
26 Ga0070661_100041553 3300005344 Bacteria 3356
27 Ga0070661_100097230 3300005344 Unclassified 2186
28 Ga0070661_100108232 3300005344 Bacteria 2074
29 Ga0070661_100116470 3300005344 Unclassified 1999
30 Ga0070661_100405963 3300005344 Unclassified 1078
31 Ga0070692_10100763 3300005345 Bacteria 1583
32 Ga0070659_100079029 3300005366 Bacteria 2625
33 Ga0070659_100090667 3300005366 Unclassified 2450
34 Ga0070714_100025605 3300005435 Bacteria 4870
35 Ga0070714_100032003 3300005435 Bacteria 4391
36 Ga0070714_100048415 3300005435 Bacteria 3615
37 Ga0070714_100360041 3300005435 Bacteria 1368
38 Ga0070714_100423410 3300005435 Bacteria 1262
39 Ga0070713_100024280 3300005436 Bacteria 4720
40 Ga0070713_100042102 3300005436 Bacteria 3725
41 Ga0070713_100511542 3300005436 Bacteria 1134
42 Ga0070710_10005611 3300005437 Bacteria 5977
43 Ga0070711_100013831 3300005439 Bacteria 5075
44 Ga0070711_100019156 3300005439 Bacteria 4386
45 Ga0070711_100076504 3300005439 Bacteria 2373
46 Ga0070708_100014184 3300005445 Bacteria 6548
47 Ga0070663_100094069 3300005455 Bacteria 2225
48 Ga0070663_100541784 3300005455 Bacteria 972
49 Ga0070678_100056276 3300005456 Bacteria 2876
50 Ga0070662_100615762 3300005457 Bacteria 914
51 Ga0070681_10000749 3300005458 Bacteria 26980
52 Ga0070681_10006655 3300005458 Bacteria 11248
53 Ga0070681_10008242 3300005458 Bacteria 10196
54 Ga0070681_10047094 3300005458 Bacteria 4309
55 Ga0070681_10067249 3300005458 Bacteria 3552
56 Ga0070681_10093404 3300005458 Unclassified 2957
57 Ga0070681_10108465 3300005458 Bacteria 2716
58 Ga0070681_10122719 3300005458 Unclassified 2531
59 Ga0070681_10187266 3300005458 Bacteria 1990
60 Ga0070707_100001944 3300005468 Bacteria 19823
61 Ga0070707_100464407 3300005468 Bacteria 1227
62 Ga0070698_100037762 3300005471 Bacteria 4979
63 Ga0070699_100020721 3300005518 Bacteria 5671
64 Ga0070699_100607028 3300005518 Bacteria 998
65 Ga0070679_100015385 3300005530 Bacteria 7351
66 Ga0070679_100049409 3300005530 Bacteria 4189
67 Ga0070679_100053394 3300005530 Bacteria 4023
68 Ga0070679_100067376 3300005530 Bacteria 3570
69 Ga0070679_100075416 3300005530 Bacteria 3362
70 Ga0070679_100089663 3300005530 Bacteria 3062
71 Ga0070679_100102155 3300005530 Bacteria 2853
72 Ga0070679_100186474 3300005530 Bacteria 2045
73 Ga0070679_100780560 3300005530 Unclassified 899
74 Ga0070684_100005027 3300005535 Bacteria 10099
75 Ga0070684_100017563 3300005535 Bacteria 5876
76 Ga0068853_100114568 3300005539 Unclassified 2398
77 Ga0068853_100393157 3300005539 Unclassified 1296
78 Ga0070695_100001116 3300005545 Bacteria 14717
79 Ga0070695_100262849 3300005545 Bacteria 1261
80 Ga0070665_100177084 3300005548 Bacteria 2133
81 Ga0070704_100236813 3300005549 Bacteria 1492
82 Ga0068855_100019092 3300005563 Bacteria 8239
83 Ga0068855_100032562 3300005563 Bacteria 6223
84 Ga0068855_100045854 3300005563 Bacteria 5168
85 Ga0068855_100050832 3300005563 Bacteria 4883
86 Ga0068855_100080104 3300005563 Bacteria 3787
87 Ga0068855_100397134 3300005563 Bacteria 1512
88 Ga0068857_100607164 3300005577 Unclassified 1034
89 Ga0068854_100717078 3300005578 Bacteria 865
90 Ga0068856_100028398 3300005614 Bacteria 5463
91 Ga0068856_100048093 3300005614 Bacteria 4202
92 Ga0068856_100154480 3300005614 Bacteria 2305
93 Ga0068852_100075877 3300005616 Bacteria 2967
94 Ga0068864_100336506 3300005618 Bacteria 1421
95 Ga0070717_10002024 3300006028 Bacteria 14193
96 Ga0070717_10025828 3300006028 Bacteria 4678
97 Ga0070717_10048900 3300006028 Bacteria 3470
98 Ga0070715_10000285 3300006163 Bacteria 12378
99 Ga0070715_10062010 3300006163 Bacteria 1644
100 Ga0070716_100011760 3300006173 Bacteria 4414
101 Ga0070712_100018785 3300006175 Bacteria 4496
102 Ga0070712_100726324 3300006175 Bacteria 848
103 Ga0097621_100681889 3300006237 Bacteria 945
104 Ga0075433_10131136 3300006852 Bacteria 2227
105 Ga0075434_100006735 3300006871 Bacteria 10557
106 Ga0075434_100052890 3300006871 Bacteria 4036
107 Ga0068865_100257097 3300006881 Bacteria 1381
108 Ga0075436_100352922 3300006914 Unclassified 1060
109 Ga0105240_10004372 3300009093 Bacteria 21577
110 Ga0105240_10026508 3300009093 Bacteria 7605
111 Ga0105240_10151987 3300009093 Bacteria 2756
112 Ga0105240_10189040 3300009093 Bacteria 2423
113 Ga0105240_10357338 3300009093 Bacteria 1656
114 Ga0105240_10950146 3300009093 Unclassified 922
115 Ga0105245_10210947 3300009098 Bacteria 1869
116 Ga0114129_10033307 3300009147 Bacteria 7281
117 Ga0105241_10874689 3300009174 Bacteria 833
118 Ga0105242_10036689 3300009176 Bacteria 3934
119 Ga0105248_10680605 3300009177 Bacteria 1160
120 Ga0105237_10026492 3300009545 Bacteria 5926
121 Ga0105237_10032639 3300009545 Bacteria 5271
122 Ga0105238_10010250 3300009551 Bacteria 9401
123 Ga0105238_10150583 3300009551 Bacteria 2302
124 Ga0105239_10934705 3300010375 Bacteria 996
125 Ga0105239_10936412 3300010375 Bacteria 995
126 Ga0157373_10138625 3300013100 Bacteria 1710
127 Ga0157370_10015065 3300013104 Bacteria 7878
128 Ga0157370_10050383 3300013104 Bacteria 3980
129 Ga0157370_10057103 3300013104 Bacteria 3713
130 Ga0157370_10066410 3300013104 Bacteria 3412
131 Ga0157370_10120191 3300013104 Bacteria 2453
132 Ga0157369_10003856 3300013105 Bacteria 17824
133 Ga0157369_10040278 3300013105 Bacteria 5101
134 Ga0157369_10045651 3300013105 Bacteria 4763
135 Ga0157369_10078926 3300013105 Bacteria 3526
136 Ga0157369_10106748 3300013105 Bacteria 2980
137 Ga0157369_10176982 3300013105 Bacteria 2246
138 Ga0157369_10195652 3300013105 Unclassified 2123
139 Ga0157369_10320206 3300013105 Bacteria 1612
140 Ga0157374_10630269 3300013296 Bacteria 1083
141 Ga0157372_10059594 3300013307 Bacteria 4270
142 Ga0157372_10085387 3300013307 Bacteria 3579
143 Ga0157372_10378585 3300013307 Unclassified 1649
144 Ga0157372_10670807 3300013307 Bacteria 1207
145 Ga0182008_10027288 3300014497 Bacteria 2894
146 Ga0157377_10395737 3300014745 Bacteria 939
147 Ga0157376_10028299 3300014969 Bacteria 4454
148 Ga0197907_11375264 3300020069 Bacteria 939
149 Ga0206354_10233267 3300020081 Bacteria 2808
150 Ga0206354_10383196 3300020081 Bacteria 2439
151 Ga0206354_11613024 3300020081 Bacteria 2564
152 Ga0206353_10115099 3300020082 Bacteria 5737
153 Ga0206353_11084915 3300020082 Bacteria 1579
154 Ga0206353_11117654 3300020082 Bacteria 5681
155 Ga0213871_10049500 3300021441 Bacteria 1148
156 Ga0207692_10078368 3300025898 Bacteria 1760
157 Ga0207685_10059620 3300025905 Bacteria 1506
158 Ga0207699_10041401 3300025906 Bacteria 2660
159 Ga0207699_10280642 3300025906 Bacteria 1157
160 Ga0207705_10017363 3300025909 Bacteria 5154
161 Ga0207705_10021630 3300025909 Bacteria 4590
162 Ga0207705_10140330 3300025909 Unclassified 1804
163 Ga0207654_10042579 3300025911 Unclassified 2571
164 Ga0207707_10023124 3300025912 Bacteria 5439
165 Ga0207707_10044759 3300025912 Bacteria 3857
166 Ga0207707_10048038 3300025912 Bacteria 3718
167 Ga0207707_10086901 3300025912 Bacteria 2732
168 Ga0207707_10122857 3300025912 Bacteria 2270
169 Ga0207707_10148217 3300025912 Unclassified 2051
170 Ga0207707_10693801 3300025912 Unclassified 855
171 Ga0207695_10039360 3300025913 Bacteria 5082
172 Ga0207695_10057395 3300025913 Bacteria 4044
173 Ga0207695_10073223 3300025913 Bacteria 3492
174 Ga0207695_10134669 3300025913 Unclassified 2425
175 Ga0207671_10146825 3300025914 Unclassified 1820
176 Ga0207671_10213610 3300025914 Bacteria 1510
177 Ga0207693_10001514 3300025915 Bacteria 20507
178 Ga0207693_10005278 3300025915 Bacteria 10802
179 Ga0207693_10084722 3300025915 Bacteria 2483
180 Ga0207693_10166901 3300025915 Bacteria 1733
181 Ga0207663_10006744 3300025916 Bacteria 5904
182 Ga0207663_10014649 3300025916 Bacteria 4301
183 Ga0207663_10050193 3300025916 Bacteria 2592
184 Ga0207660_10008175 3300025917 Bacteria 6769
185 Ga0207660_10079599 3300025917 Bacteria 2404
186 Ga0207660_10229556 3300025917 Bacteria 1459
187 Ga0207657_10000486 3300025919 Bacteria 41915
188 Ga0207657_10004929 3300025919 Bacteria 14033
189 Ga0207657_10006205 3300025919 Bacteria 12426
190 Ga0207657_10008281 3300025919 Bacteria 10581
191 Ga0207657_10012639 3300025919 Bacteria 8322
192 Ga0207657_10015181 3300025919 Bacteria 7474
193 Ga0207657_10033940 3300025919 Bacteria 4595
194 Ga0207657_10055140 3300025919 Bacteria 3435
195 Ga0207657_10287636 3300025919 Unclassified 1304
196 Ga0207649_10042731 3300025920 Bacteria 2766
197 Ga0207649_10053430 3300025920 Bacteria 2510
198 Ga0207649_10089346 3300025920 Bacteria 2014
199 Ga0207649_10158878 3300025920 Bacteria 1564
200 Ga0207649_10194620 3300025920 Unclassified 1428
201 Ga0207649_10253619 3300025920 Unclassified 1268
202 Ga0207649_10342637 3300025920 Bacteria 1104
203 Ga0207652_10006427 3300025921 Bacteria 9475
204 Ga0207652_10021225 3300025921 Bacteria 5359
205 Ga0207652_10069815 3300025921 Bacteria 3050
206 Ga0207652_10080801 3300025921 Unclassified 2843
207 Ga0207652_10188799 3300025921 Bacteria 1853
208 Ga0207652_10739555 3300025921 Unclassified 876
209 Ga0207646_10006959 3300025922 Bacteria 11595
210 Ga0207694_10061636 3300025924 Bacteria 2919
211 Ga0207694_10136324 3300025924 Unclassified 1971
212 Ga0207687_10371965 3300025927 Bacteria 1169
213 Ga0207700_10050604 3300025928 Bacteria 3096
214 Ga0207700_10773398 3300025928 Bacteria 858
215 Ga0207664_10024679 3300025929 Bacteria 4520
216 Ga0207664_10032537 3300025929 Bacteria 3998
217 Ga0207664_10059949 3300025929 Bacteria 3033
218 Ga0207664_10127389 3300025929 Unclassified 2139
219 Ga0207664_10292601 3300025929 Bacteria 1431
220 Ga0207664_10306677 3300025929 Bacteria 1398
221 Ga0207664_10414274 3300025929 Bacteria 1200
222 Ga0207664_10522743 3300025929 Bacteria 1063
223 Ga0207644_10195967 3300025931 Bacteria 1591
224 Ga0207690_10099925 3300025932 Unclassified 2069
225 Ga0207690_10166319 3300025932 Unclassified 1648
226 Ga0207690_10314237 3300025932 Bacteria 1230
227 Ga0207690_10451338 3300025932 Bacteria 1033
228 Ga0207690_10504610 3300025932 Unclassified 979
229 Ga0207686_10056395 3300025934 Bacteria 2469
230 Ga0207665_10013702 3300025939 Bacteria 5332
231 Ga0207661_10005380 3300025944 Bacteria 9019
232 Ga0207661_10062334 3300025944 Bacteria 3016
233 Ga0207661_10182567 3300025944 Bacteria 1834
234 Ga0207661_10198935 3300025944 Bacteria 1761
235 Ga0207661_10255796 3300025944 Unclassified 1558
236 Ga0207679_10305790 3300025945 Bacteria 1372
237 Ga0207667_10046352 3300025949 Bacteria 4602
238 Ga0207667_10074638 3300025949 Bacteria 3522
239 Ga0207667_10100363 3300025949 Bacteria 2985
240 Ga0207667_10103375 3300025949 Bacteria 2938
241 Ga0207667_10106933 3300025949 Bacteria 2886
242 Ga0207667_10200091 3300025949 Unclassified 2049
243 Ga0207667_10335588 3300025949 Bacteria 1543
244 Ga0207667_10379866 3300025949 Bacteria 1439
245 Ga0207667_10404819 3300025949 Bacteria 1389
246 Ga0207640_10199928 3300025981 Bacteria 1514
247 Ga0207677_10158125 3300026023 Bacteria 1757
248 Ga0207677_10278865 3300026023 Bacteria 1371
249 Ga0207639_10490479 3300026041 Bacteria 1121
250 Ga0207678_10086611 3300026067 Bacteria 2677
251 Ga0207678_10160144 3300026067 Unclassified 1922
252 Ga0207702_10102866 3300026078 Bacteria 2525
253 Ga0207702_10174412 3300026078 Unclassified 1974
254 Ga0207702_10298824 3300026078 Bacteria 1527
255 Ga0207702_10307111 3300026078 Bacteria 1507
256 Ga0207676_10336484 3300026095 Bacteria 1391
257 Ga0207674_10030732 3300026116 Bacteria 5645
258 Ga0207674_10078247 3300026116 Bacteria 3312
259 Ga0207683_10297683 3300026121 Bacteria 1476
260 Ga0207698_10008070 3300026142 Bacteria 6639
261 Ga0207698_10060354 3300026142 Bacteria 2949
262 Ga0207698_10198309 3300026142 Bacteria 1795
263 Ga0265319_1007255 3300028563 Bacteria 5012
264 Ga0265319_1032102 3300028563 Bacteria 1824
265 Ga0265318_10022142 3300028577 Bacteria 2544
266 Ga0265338_10003469 3300028800 Bacteria 22183
267 Ga0265338_10006363 3300028800 Bacteria 15074
268 Ga0265338_10011492 3300028800 Bacteria 10221
269 Ga0265338_10016336 3300028800 Bacteria 8084
270 Ga0265338_10028196 3300028800 Bacteria 5606
271 Ga0265338_10125062 3300028800 Bacteria 2042
272 Ga0265338_10169009 3300028800 Bacteria 1679
273 Ga0265324_10034777 3300029957 Bacteria 1754
274 Ga0265330_10092095 3300031235 Unclassified 1301
275 Ga0265320_10012728 3300031240 Bacteria 4879
276 Ga0265340_10092764 3300031247 Bacteria 1410
277 Ga0265339_10037237 3300031249 Bacteria 2719
278 Ga0265327_10087079 3300031251 Bacteria 1530
279 Ga0265313_10004167 3300031595 Bacteria 11226
280 Ga0307409_100171156 3300031995 Bacteria 1912
281 Ga0307416_100012377 3300032002 Bacteria 5746
282 Ga0307416_100329940 3300032002 Bacteria 1533
283 Ga0307415_100504330 3300032126 Bacteria 1059
284 Ga0373934_0071044 3300035086 Bacteria 1392
285 Ga0373944_0003460 3300035089 Bacteria 4078
286 Ga0373932_0060733 3300035112 Bacteria 1148
287 Ga0373945_0017396 3300035116 Bacteria 2434
288 Ga0373945_0094327 3300035116 Unclassified 1163
289 Ga0373953_0026174 3300035117 Bacteria 2234
290 Ga0373956_0100892 3300035119 Bacteria 1339
291 Ga0373957_0059544 3300035120 Bacteria 1477
292 Ga0373943_0001557 3300035170 Bacteria 10374
293 Ga0373943_0004770 3300035170 Bacteria 6128
294 Ga0373943_0029675 3300035170 Bacteria 2584
295 Ga0373946_0029927 3300035171 Bacteria 2171
296 Ga0373955_0108397 3300035172 Bacteria 1603
297 Ga0373924_0024003 3300035410 Bacteria 2399
298 Ga0373924_0213580 3300035410 Bacteria 852
299 Ga0373931_0025549 3300035691 Bacteria 3000
300 Ga0373935_0018087 3300035692 Bacteria 4284
301 Ga0373927_0028847 3300035695 Bacteria 3619
302 Ga0373927_0076703 3300035695 Bacteria 2164
303 Ga0373933_0074530 3300035724 Bacteria 2070
304 Ga0373947_0000833 3300035725 Bacteria 18617
305 Ga0373947_0001304 3300035725 Bacteria 15351
306 Ga0373947_0004241 3300035725 Bacteria 8409
307 Ga0373937_0001461 3300036401 Bacteria 19779
308 Ga0373937_0016157 3300036401 Bacteria 6622
309 Ga0373937_0751835 3300036401 Bacteria 922
310 Ga0373925_0003428 3300037068 Bacteria 12278
311 Ga0373925_0015724 3300037068 Bacteria 5477
312 Ga0395899_0024329 3300037312 Bacteria 4579
313 Ga0395900_0017016 3300037418 Bacteria 7421
314 Ga0395900_0017733 3300037418 Bacteria 7265
315 Ga0395900_0077576 3300037418 Bacteria 3413
316 Ga0395900_0579189 3300037418 Bacteria 1064
317 Ga0395900_0585131 3300037418 Bacteria 1058
318 Ga0395898_0027463 3300037466 Bacteria 5712
319 Ga0395898_0034193 3300037466 Bacteria 5068
320 Ga0395898_0066172 3300037466 Bacteria 3502
321 Ga0395898_0073578 3300037466 Bacteria 3301
322 Ga0395898_0086574 3300037466 Bacteria 3019
323 Ga0395898_0225352 3300037466 Unclassified 1788
324 Ga0395898_0474683 3300037466 Bacteria 1190
325 Ga0395905_0050603 3300037471 Unclassified 3892
326 Ga0436364_1212053 3300037853 Bacteria 2039
327 Ga0395901_0042245 3300038443 Bacteria 4726
328 Ga0395901_0055019 3300038443 Unclassified 4137
329 Ga0395901_0078826 3300038443 Bacteria 3440
330 Ga0395901_0104986 3300038443 Bacteria 2965
331 Ga0436365_1019739 3300039437 Bacteria 1923
332 Ga0436360_0815520 3300039438 Bacteria 2284
333 Ga0436363_0106831 3300039450 Bacteria 1104
334 Ga0439436_0012362 3300041404 Bacteria 2592
335 Ga0439439_0016008 3300041406 Bacteria 1834
336 Ga0439431_0002269 3300041997 Bacteria 4241
337 Ga0439448_0134255 3300042005 Bacteria 854
338 Ga0439457_042944 3300042014 Bacteria 1008
339 Ga0439446_0002256 3300042156 Bacteria 4602
340 Ga0439434_0007674 3300042435 Bacteria 3160
341 Ga0466969_0000408 3300044656 Bacteria 23689
342 Ga0466969_0070411 3300044656 Bacteria 1682
343 Ga0466972_0013763 3300044658 Bacteria 4061
344 Ga0466965_0004049 3300044683 Bacteria 6503
345 Ga0466966_0004115 3300044684 Bacteria 9606
346 Ga0466966_0056747 3300044684 Bacteria 2477
347 Ga0466966_0107675 3300044684 Bacteria 1719
348 Ga0466966_0260045 3300044684 Bacteria 1045
349 Ga0466966_0292199 3300044684 Bacteria 980
350 Ga0466961_0003343 3300044693 Bacteria 10009
351 Ga0466961_0018160 3300044693 Bacteria 4523
352 Ga0466961_0024084 3300044693 Bacteria 3917
353 Ga0466961_0040880 3300044693 Bacteria 2972
354 Ga0466961_0065232 3300044693 Bacteria 2313
355 Ga0466961_0144466 3300044693 Unclassified 1488
356 Ga0466963_0000752 3300044694 Bacteria 16002
357 Ga0466963_0000760 3300044694 Bacteria 15952
358 Ga0466963_0001436 3300044694 Bacteria 12827
359 Ga0466963_0003818 3300044694 Bacteria 8685
360 Ga0466963_0011658 3300044694 Bacteria 5355
361 Ga0466963_0024964 3300044694 Bacteria 3807
362 Ga0466963_0026442 3300044694 Bacteria 3711
363 Ga0466963_0026995 3300044694 Bacteria 3673
364 Ga0466963_0028399 3300044694 Bacteria 3591
365 Ga0466963_0029963 3300044694 Bacteria 3507
366 Ga0466963_0045069 3300044694 Bacteria 2904
367 Ga0466963_0069877 3300044694 Bacteria 2361
368 Ga0466963_0070413 3300044694 Bacteria 2352
369 Ga0466963_0089111 3300044694 Bacteria 2098
370 Ga0466963_0091966 3300044694 Bacteria 2067
371 Ga0466963_0102932 3300044694 Bacteria 1956
372 Ga0466963_0171660 3300044694 Bacteria 1512
373 Ga0466963_0231732 3300044694 Bacteria 1294
374 Ga0466963_0260560 3300044694 Bacteria 1217
375 Ga0466963_0290401 3300044694 Bacteria 1149
376 Ga0466963_0300212 3300044694 Bacteria 1129
377 Ga0466963_0395449 3300044694 Bacteria 974
378 Ga0466963_0518671 3300044694 Bacteria 841
379 Ga0466964_0000980 3300044706 Bacteria 9461
380 Ga0466964_0001835 3300044706 Bacteria 7397
381 Ga0466964_0004614 3300044706 Bacteria 5094
382 Ga0466964_0019307 3300044706 Bacteria 2619
383 Ga0466964_0021445 3300044706 Bacteria 2499
384 Ga0466964_0055934 3300044706 Bacteria 1630
385 Ga0466964_0068277 3300044706 Bacteria 1496
386 Ga0466964_0144131 3300044706 Bacteria 1098
387 Ga0466971_0000854 3300044719 Bacteria 12413
388 Ga0466971_0006026 3300044719 Bacteria 5276
389 Ga0466971_0010425 3300044719 Bacteria 4061
390 Ga0466971_0053859 3300044719 Unclassified 1813
391 Ga0466971_0100146 3300044719 Bacteria 1331
392 Ga0466971_0100160 3300044719 Bacteria 1331
393 Ga0466971_0120057 3300044719 Bacteria 1216
394 Ga0466968_0013251 3300044735 Bacteria 3240
395 Ga0466968_0033709 3300044735 Bacteria 2134
396 Ga0466968_0078103 3300044735 Bacteria 1450
397 Ga0466968_0185760 3300044735 Bacteria 968
398 Ga0466970_0019344 3300044765 Bacteria 3529
399 Ga0466970_0081194 3300044765 Bacteria 1753
400 Ga0466970_0240313 3300044765 Bacteria 1013
401 Ga0466957_0000320 3300044842 Bacteria 23320
402 Ga0466957_0002697 3300044842 Bacteria 9597
403 Ga0466957_0008188 3300044842 Bacteria 5935
404 Ga0466957_0009467 3300044842 Bacteria 5562
405 Ga0466957_0012058 3300044842 Bacteria 4997
406 Ga0466957_0022846 3300044842 Unclassified 3693
407 Ga0466957_0024673 3300044842 Bacteria 3560
408 Ga0466957_0038706 3300044842 Bacteria 2874
409 Ga0466957_0044447 3300044842 Bacteria 2691
410 Ga0466957_0061912 3300044842 Bacteria 2298
411 Ga0466957_0078882 3300044842 Bacteria 2048
412 Ga0466957_0092865 3300044842 Bacteria 1893
413 Ga0466957_0120781 3300044842 Unclassified 1670
414 Ga0466957_0138165 3300044842 Bacteria 1568
415 Ga0466957_0292194 3300044842 Bacteria 1093
416 Ga0466957_0579880 3300044842 Bacteria 784
417 Ga0466960_0021185 3300044901 Bacteria 2891
418 Ga0466960_0083647 3300044901 Bacteria 1613
419 Ga0466960_0117558 3300044901 Archaea 1389
420 Ga0466960_0365764 3300044901 Unclassified 825
421 Ga0466959_0008653 3300045049 Bacteria 7204
422 Ga0466959_0010156 3300045049 Bacteria 6718
423 Ga0466959_0072562 3300045049 Bacteria 2491
424 Ga0466959_0097887 3300045049 Unclassified 2102
425 Ga0466959_0103272 3300045049 Bacteria 2039
426 Ga0466959_0124651 3300045049 Unclassified 1829
427 Ga0466959_0167630 3300045049 Bacteria 1541
428 Ga0466959_0234981 3300045049 Bacteria 1268
429 Ga0466959_0238662 3300045049 Bacteria 1256
430 Ga0466959_0280720 3300045049 Bacteria 1143
431 Ga0466958_0005130 3300045836 Bacteria 7002
432 Ga0466958_0007009 3300045836 Bacteria 6165
433 Ga0466958_0007207 3300045836 Bacteria 6097
434 Ga0466958_0007488 3300045836 Bacteria 6008
435 Ga0466958_0008663 3300045836 Bacteria 5649
436 Ga0466958_0019258 3300045836 Bacteria 3972
437 Ga0466958_0020596 3300045836 Unclassified 3848
438 Ga0466958_0021364 3300045836 Bacteria 3781
439 Ga0466958_0057855 3300045836 Bacteria 2356
440 Ga0466958_0110090 3300045836 Bacteria 1719
441 Ga0466958_0117160 3300045836 Bacteria 1665
442 Ga0466958_0206714 3300045836 Bacteria 1250
443 Ga0466958_0225658 3300045836 Bacteria 1195
444 Ga0466958_0503048 3300045836 Bacteria 786
445 Ga0466967_0001867 3300045976 Bacteria 12701
446 Ga0466967_0006510 3300045976 Bacteria 8276
447 Ga0466967_0008137 3300045976 Bacteria 7653
448 Ga0466967_0012033 3300045976 Bacteria 6594
449 Ga0466967_0014542 3300045976 Bacteria 6135
450 Ga0466967_0016832 3300045976 Bacteria 5780
451 Ga0466967_0019357 3300045976 Bacteria 5471
452 Ga0466967_0020228 3300045976 Bacteria 5374
453 Ga0466967_0031882 3300045976 Bacteria 4443
454 Ga0466967_0039559 3300045976 Bacteria 4055
455 Ga0466967_0043872 3300045976 Bacteria 3874
456 Ga0466967_0058802 3300045976 Bacteria 3399
457 Ga0466967_0059022 3300045976 Bacteria 3393
458 Ga0466967_0062419 3300045976 Bacteria 3307
459 Ga0466967_0063715 3300045976 Bacteria 3276
460 Ga0466967_0089713 3300045976 Bacteria 2792
461 Ga0466967_0105945 3300045976 Bacteria 2576
462 Ga0466967_0123476 3300045976 Bacteria 2395
463 Ga0466967_0132051 3300045976 Bacteria 2319
464 Ga0466967_0158329 3300045976 Bacteria 2124
465 Ga0466967_0160985 3300045976 Unclassified 2106
466 Ga0466967_0187938 3300045976 Bacteria 1951
467 Ga0466967_0194028 3300045976 Bacteria 1920
468 Ga0466967_0304742 3300045976 Bacteria 1533
469 Ga0466967_0435173 3300045976 Bacteria 1280
470 Ga0466967_0439866 3300045976 Unclassified 1273
471 Ga0466967_0483624 3300045976 Bacteria 1213
472 Ga0466967_0488663 3300045976 Bacteria 1207
473 Ga0466967_0508286 3300045976 Bacteria 1183
474 Ga0466967_0709555 3300045976 Bacteria 996
475 Ga0466967_0787632 3300045976 Unclassified 944
476 Ga0466967_0995956 3300045976 Bacteria 834
477 Ga0495592_0000048 3300046454 Bacteria 114599
478 Ga0495592_0051776 3300046454 Bacteria 3049
479 Ga0495592_0095414 3300046454 Bacteria 2127
480 Ga0495592_0204954 3300046454 Bacteria 1328
481 Ga0495592_0356833 3300046454 Bacteria 936
482 Ga0495629_0000983 3300046459 Bacteria 22888
483 Ga0495629_0015602 3300046459 Bacteria 5453
484 Ga0495629_0068901 3300046459 Bacteria 2468
485 Ga0495629_0083905 3300046459 Bacteria 2223
486 Ga0495629_0115477 3300046459 Bacteria 1871
487 Ga0495629_0237436 3300046459 Bacteria 1255
488 Ga0495641_0000513 3300046461 Bacteria 32468
489 Ga0495641_0001416 3300046461 Bacteria 20387
490 Ga0495641_0003996 3300046461 Bacteria 10695
491 Ga0495641_0037441 3300046461 Bacteria 2273
492 Ga0495641_0081260 3300046461 Bacteria 1452
493 Ga0495641_0213863 3300046461 Bacteria 864
494 Ga0495651_0000049 3300046462 Bacteria 88249
495 Ga0495651_0032397 3300046462 Bacteria 4076
496 Ga0495651_0072171 3300046462 Bacteria 2623
497 Ga0495651_0085130 3300046462 Bacteria 2381
498 Ga0495651_0092323 3300046462 Bacteria 2268
499 Ga0495651_0252547 3300046462 Bacteria 1203
500 Ga0495651_0454664 3300046462 Bacteria 827
501 Ga0495653_0000489 3300046463 Bacteria 30700
502 Ga0495653_0037793 3300046463 Bacteria 3790
503 Ga0495653_0039324 3300046463 Bacteria 3706
504 Ga0495653_0063593 3300046463 Bacteria 2784
505 Ga0495653_0074201 3300046463 Bacteria 2535
506 Ga0495653_0081218 3300046463 Unclassified 2396
507 Ga0495653_0097382 3300046463 Bacteria 2137
508 Ga0495653_0098842 3300046463 Bacteria 2118
509 Ga0495653_0115516 3300046463 Bacteria 1921
510 Ga0495580_0130815 3300046472 Bacteria 1741
511 Ga0495582_0000553 3300046473 Bacteria 20635
512 Ga0495582_0047087 3300046473 Bacteria 2374
513 Ga0495605_0038854 3300046474 Unclassified 2386
514 Ga0495639_0000180 3300046475 Bacteria 33280
515 Ga0495639_0009403 3300046475 Bacteria 4192
516 Ga0495639_0074972 3300046475 Bacteria 1568
517 Ga0495662_0003722 3300046476 Bacteria 7680
518 Ga0495662_0007890 3300046476 Bacteria 5240
519 Ga0495662_0138274 3300046476 Bacteria 1198
520 Ga0495664_0016483 3300046477 Bacteria 4211
521 Ga0495664_0081742 3300046477 Bacteria 1937
522 Ga0495664_0087336 3300046477 Bacteria 1873
523 Ga0495664_0102766 3300046477 Bacteria 1722
524 Ga0495664_0106459 3300046477 Bacteria 1691
525 Ga0495664_0161528 3300046477 Bacteria 1359
526 Ga0495585_0033720 3300046492 Bacteria 2897
527 Ga0495594_0020401 3300046499 Bacteria 3530
528 Ga0495607_0010453 3300046501 Bacteria 6239
529 Ga0495608_0003026 3300046511 Bacteria 11997
530 Ga0495608_0005307 3300046511 Bacteria 9210
531 Ga0495608_0019694 3300046511 Bacteria 4642
532 Ga0495608_0023644 3300046511 Bacteria 4209
533 Ga0495608_0118017 3300046511 Unclassified 1702
534 Ga0495608_0132207 3300046511 Bacteria 1596
535 Ga0495608_0190255 3300046511 Bacteria 1296
536 Ga0495618_0006054 3300046514 Bacteria 7342
537 Ga0495618_0024890 3300046514 Bacteria 3711
538 Ga0495618_0160286 3300046514 Bacteria 1434
539 Ga0495618_0161319 3300046514 Bacteria 1429
540 Ga0495628_0000026 3300046516 Bacteria 127398
541 Ga0495628_0004120 3300046516 Bacteria 12929
542 Ga0495628_0109524 3300046516 Bacteria 2125
543 Ga0495630_0012886 3300046517 Bacteria 6074
544 Ga0495630_0014969 3300046517 Bacteria 5657
545 Ga0495630_0017466 3300046517 Bacteria 5257
546 Ga0495630_0018842 3300046517 Bacteria 5072
547 Ga0495630_0041071 3300046517 Bacteria 3455
548 Ga0495631_0079527 3300046518 Bacteria 1415
549 Ga0495644_0001562 3300046523 Bacteria 9331
550 Ga0495644_0078043 3300046523 Bacteria 1248
551 Ga0495663_0007171 3300046525 Bacteria 3077
552 Ga0495666_0003590 3300046526 Bacteria 7844
553 Ga0495652_0000172 3300046529 Bacteria 74042
554 Ga0495652_0103308 3300046529 Bacteria 2307
555 Ga0495652_0112881 3300046529 Bacteria 2182
556 Ga0495652_0149532 3300046529 Bacteria 1826
557 Ga0495652_0290800 3300046529 Bacteria 1192
558 Ga0495665_0005465 3300046531 Bacteria 6844
559 Ga0495665_0037122 3300046531 Bacteria 2600
560 Ga0495640_0004584 3300046533 Bacteria 11021
561 Ga0495640_0074153 3300046533 Bacteria 2276
562 Ga0495640_0074625 3300046533 Bacteria 2267
563 Ga0495640_0077028 3300046533 Bacteria 2224
564 Ga0495640_0089388 3300046533 Bacteria 2034
565 Ga0495640_0099037 3300046533 Bacteria 1915
566 Ga0495640_0131827 3300046533 Bacteria 1617
567 Ga0495640_0153882 3300046533 Bacteria 1476
568 Ga0495586_0042294 3300046535 Bacteria 2454
569 Ga0495586_0162558 3300046535 Bacteria 1259
570 Ga0495587_0000362 3300046536 Bacteria 32677
571 Ga0495587_0011402 3300046536 Bacteria 5635
572 Ga0495587_0016541 3300046536 Bacteria 4587
573 Ga0495587_0029918 3300046536 Bacteria 3304
574 Ga0495587_0153553 3300046536 Bacteria 1312
575 Ga0495645_0000016 3300046543 Bacteria 158415
576 Ga0495645_0037319 3300046543 Bacteria 3541
577 Ga0495645_0040045 3300046543 Bacteria 3418
578 Ga0495645_0077748 3300046543 Bacteria 2385
579 Ga0495645_0228406 3300046543 Bacteria 1248
580 Ga0495633_0117738 3300046558 Bacteria 1231
581 Ga0495667_0001379 3300046559 Bacteria 15997
582 Ga0495667_0028440 3300046559 Bacteria 3764
583 Ga0495667_0035465 3300046559 Bacteria 3333
584 Ga0495667_0043945 3300046559 Bacteria 2959
585 Ga0495667_0059847 3300046559 Bacteria 2499
586 Ga0495656_0013463 3300046615 Bacteria 3045
587 Ga0495634_0015592 3300046642 Bacteria 5454
588 Ga0495634_0043668 3300046642 Bacteria 3037
589 Ga0495634_0084951 3300046642 Bacteria 2063
590 Ga0495634_0109796 3300046642 Bacteria 1774
591 Ga0495634_0217356 3300046642 Bacteria 1181
592 Ga0495611_0043473 3300046648 Bacteria 2009
593 Ga0495635_0043056 3300046663 Bacteria 3116
594 Ga0495635_0050451 3300046663 Bacteria 2868
595 Ga0495635_0050772 3300046663 Bacteria 2858
596 Ga0495635_0072500 3300046663 Unclassified 2359
597 Ga0495635_0128518 3300046663 Bacteria 1727
598 Ga0495657_0002580 3300046675 Bacteria 15174
599 Ga0495657_0019102 3300046675 Bacteria 4950
600 Ga0495657_0020642 3300046675 Bacteria 4735
601 Ga0495657_0022694 3300046675 Bacteria 4491
602 Ga0495657_0118320 3300046675 Unclassified 1671
603 Ga0495657_0127897 3300046675 Bacteria 1594
604 Ga0495657_0179976 3300046675 Bacteria 1298
605 Ga0495657_0208544 3300046675 Bacteria 1188
606 Ga0495599_0000016 3300046678 Bacteria 169605
607 Ga0495599_0054948 3300046678 Bacteria 2494
608 Ga0495599_0109699 3300046678 Bacteria 1719
609 Ga0495599_0242133 3300046678 Bacteria 1099
610 Ga0495623_0000046 3300046679 Bacteria 74571
611 Ga0495623_0015074 3300046679 Bacteria 4998
612 Ga0495623_0056966 3300046679 Bacteria 2459
613 Ga0495623_0208768 3300046679 Unclassified 1119
614 Ga0495646_0003505 3300046680 Bacteria 9770
615 Ga0495646_0035631 3300046680 Bacteria 3086
616 Ga0495646_0079924 3300046680 Bacteria 1908
617 Ga0495646_0112795 3300046680 Bacteria 1546
618 Ga0495647_0001779 3300046681 Bacteria 6684
619 Ga0495647_0007902 3300046681 Bacteria 3573
620 Ga0495647_0010520 3300046681 Bacteria 3152
621 Ga0495658_0001696 3300046683 Bacteria 11445
622 Ga0495658_0002075 3300046683 Bacteria 10156
623 Ga0495658_0116693 3300046683 Bacteria 1610
624 Ga0495658_0199545 3300046683 Bacteria 1246
625 Ga0495613_0010668 3300046689 Bacteria 6816
626 Ga0495613_0020063 3300046689 Bacteria 4980
627 Ga0495613_0026728 3300046689 Bacteria 4298
628 Ga0495613_0028638 3300046689 Bacteria 4143
629 Ga0495613_0285032 3300046689 Bacteria 1146
630 Ga0495613_0350131 3300046689 Bacteria 1014
631 Ga0495624_0002088 3300046690 Bacteria 15229
632 Ga0495624_0003996 3300046690 Bacteria 10855
633 Ga0495624_0007147 3300046690 Bacteria 7857
634 Ga0495624_0038068 3300046690 Bacteria 3092
635 Ga0495670_0075765 3300046691 Bacteria 1708
636 Ga0495589_0124947 3300046794 Bacteria 1237
637 Ga0495600_0011642 3300046809 Bacteria 5486
638 Ga0495600_0020552 3300046809 Bacteria 4221
639 Ga0495600_0061348 3300046809 Bacteria 2456
640 Ga0495600_0065733 3300046809 Bacteria 2371
641 Ga0495600_0072025 3300046809 Unclassified 2258
642 Ga0495600_0112341 3300046809 Bacteria 1774
643 Ga0495581_0001833 3300047315 Bacteria 11890
644 Ga0495581_0011060 3300047315 Bacteria 5214
645 Ga0495604_0000004 3300047317 Bacteria 456385
646 Ga0495604_0064863 3300047317 Bacteria 2782
647 Ga0495604_0066552 3300047317 Bacteria 2740
648 Ga0495604_0085022 3300047317 Bacteria 2361
649 Ga0495604_0151265 3300047317 Bacteria 1649
650 Ga0495604_0460514 3300047317 Bacteria 830
651 Ga0495674_0003155 3300047319 Bacteria 16010
652 Ga0495674_0030477 3300047319 Bacteria 4905
653 Ga0495674_0049237 3300047319 Bacteria 3724
654 Ga0495674_0073031 3300047319 Bacteria 2958
655 Ga0495674_0118262 3300047319 Bacteria 2241
656 Ga0495674_0377983 3300047319 Bacteria 1146
657 Ga0495674_0410920 3300047319 Bacteria 1091
658 Ga0495676_0000766 3300047321 Bacteria 26783
659 Ga0495676_0002145 3300047321 Bacteria 17448
660 Ga0495676_0042185 3300047321 Bacteria 3748
661 Ga0495676_0079435 3300047321 Bacteria 2494
662 Ga0495676_0238259 3300047321 Bacteria 1247
663 Ga0495680_0004330 3300047322 Bacteria 13597
664 Ga0495680_0007287 3300047322 Bacteria 10179
665 Ga0495680_0009072 3300047322 Bacteria 8980
666 Ga0495680_0019817 3300047322 Bacteria 5672
667 Ga0495680_0049855 3300047322 Bacteria 3276
668 Ga0495680_0057886 3300047322 Bacteria 2996
669 Ga0495680_0494077 3300047322 Bacteria 831
670 Ga0495675_0000079 3300047444 Bacteria 68947
671 Ga0495675_0186381 3300047444 Bacteria 1268
672 Ga0495677_0034607 3300047445 Bacteria 1843
673 Ga0495679_065949 3300047446 Bacteria 1052
674 Ga0495684_0008848 3300047471 Bacteria 7780
675 Ga0495684_0021761 3300047471 Bacteria 4936
676 Ga0495684_0029722 3300047471 Bacteria 4193
677 Ga0495684_0050341 3300047471 Bacteria 3181
678 Ga0495684_0060358 3300047471 Bacteria 2887
679 Ga0495684_0069180 3300047471 Bacteria 2684
680 Ga0495684_0122612 3300047471 Bacteria 1956
681 Ga0495684_0151204 3300047471 Bacteria 1735
682 Ga0495684_0221950 3300047471 Bacteria 1385
683 Ga0495593_0000866 3300047673 Bacteria 17530
684 Ga0495593_0009203 3300047673 Bacteria 5726
685 Ga0495593_0210671 3300047673 Bacteria 976
686 Ga0495602_0000351 3300048088 Bacteria 42756
687 Ga0495602_0087729 3300048088 Bacteria 2592
688 Ga0495602_0130295 3300048088 Bacteria 2007
689 Ga0495614_0000786 3300048089 Bacteria 13431
690 Ga0495614_0057148 3300048089 Bacteria 1675
691 Ga0496100_0005276 3300048903 Bacteria 6943
692 Ga0496100_0011540 3300048903 Bacteria 5032
693 Ga0496100_0038534 3300048903 Bacteria 3029
694 Ga0496100_0087188 3300048903 Bacteria 2122
695 Ga0496100_0096497 3300048903 Bacteria 2028
696 Ga0496100_0126495 3300048903 Bacteria 1794
697 Ga0496101_0001389 3300048904 Bacteria 14495
698 Ga0496101_0007270 3300048904 Bacteria 7166
699 Ga0496101_0012442 3300048904 Bacteria 5679
700 Ga0496101_0016057 3300048904 Bacteria 5054
701 Ga0496101_0017035 3300048904 Bacteria 4921
702 Ga0496101_0017364 3300048904 Bacteria 4883
703 Ga0496101_0082091 3300048904 Bacteria 2385
704 Ga0496101_0352107 3300048904 Bacteria 1157
705 Ga0496102_0006447 3300048905 Bacteria 10007
706 Ga0496102_0056517 3300048905 Bacteria 3580
707 Ga0496102_0152218 3300048905 Unclassified 2174
708 Ga0496102_0232278 3300048905 Bacteria 1739
709 Ga0496103_0048062 3300048906 Bacteria 2636
710 Ga0496103_0062247 3300048906 Bacteria 2322
711 Ga0496104_0008448 3300048907 Bacteria 9155
712 Ga0496104_0024421 3300048907 Bacteria 5558
713 Ga0496104_0189543 3300048907 Bacteria 1967
714 Ga0496104_0274881 3300048907 Bacteria 1597
715 Ga0496104_0617315 3300048907 Bacteria 994
716 Ga0496105_0050926 3300048908 Bacteria 3421
717 Ga0496105_0094856 3300048908 Bacteria 2464
718 Ga0496106_0014533 3300048909 Bacteria 5816
719 Ga0496106_0111042 3300048909 Bacteria 2134
720 Ga0496106_0230326 3300048909 Unclassified 1479
721 Ga0496107_0001958 3300048910 Bacteria 13084
722 Ga0496107_0084235 3300048910 Bacteria 2319
723 Ga0496107_0142804 3300048910 Bacteria 1770
724 Ga0496108_0004497 3300048911 Bacteria 11232
725 Ga0496108_0128035 3300048911 Bacteria 2181
726 Ga0496108_0158050 3300048911 Bacteria 1958
727 Ga0496109_0030256 3300048912 Bacteria 4853
728 Ga0496109_0033699 3300048912 Bacteria 4608
729 Ga0496109_0108207 3300048912 Bacteria 2583
730 Ga0496109_0170395 3300048912 Bacteria 2042
731 Ga0496109_0222574 3300048912 Bacteria 1775
732 Ga0496109_0240833 3300048912 Bacteria 1702
733 Ga0496109_0294785 3300048912 Bacteria 1529
734 Ga0496109_0386951 3300048912 Bacteria 1321
735 Ga0496110_0021361 3300048913 Archaea 5478
736 Ga0496110_0476628 3300048913 Bacteria 1137
737 Ga0496111_0404952 3300048914 Bacteria 1008
738 Ga0496111_0428045 3300048914 Bacteria 977
739 Ga0496112_0020392 3300048915 Bacteria 6283
740 Ga0496112_0028531 3300048915 Bacteria 5387
741 Ga0496112_0032281 3300048915 Bacteria 5083
742 Ga0496112_0121171 3300048915 Bacteria 2585
743 Ga0496112_0126419 3300048915 Bacteria 2527
744 Ga0496112_0155078 3300048915 Bacteria 2257
745 Ga0496112_0309171 3300048915 Bacteria 1526
746 Ga0496112_0601598 3300048915 Bacteria 1031
747 Ga0496113_0108856 3300048916 Bacteria 2154
748 Ga0496114_0004690 3300048917 Bacteria 10629
749 Ga0496114_0004918 3300048917 Bacteria 10410
750 Ga0496114_0010417 3300048917 Bacteria 7395
751 Ga0496114_0011796 3300048917 Bacteria 6992
752 Ga0496114_0013266 3300048917 Bacteria 6606
753 Ga0496114_0043657 3300048917 Bacteria 3717
754 Ga0496114_0058192 3300048917 Bacteria 3227
755 Ga0496114_0093644 3300048917 Bacteria 2555
756 Ga0496114_0104845 3300048917 Bacteria 2418
757 Ga0496115_0004959 3300048918 Bacteria 9670
758 Ga0496115_0046844 3300048918 Bacteria 3457
759 Ga0496115_0101763 3300048918 Bacteria 2356
760 Ga0496115_0172135 3300048918 Bacteria 1790
761 Ga0496115_0230547 3300048918 Bacteria 1527
762 Ga0496115_0381820 3300048918 Bacteria 1145
763 Ga0496115_0485199 3300048918 Bacteria 995
764 Ga0501034_0005913 3300049571 Bacteria 13279
765 Ga0501043_0344566 3300049579 Unclassified 1133
766 Ga0501043_0390358 3300049579 Bacteria 1053
767 Ga0501047_0349098 3300049581 Bacteria 1316
768 Ga0501067_0007804 3300049583 Bacteria 5951
769 Ga0501067_0016686 3300049583 Bacteria 4058
770 Ga0501067_0081102 3300049583 Unclassified 1798
771 Ga0501067_0092265 3300049583 Bacteria 1681
772 Ga0501067_0221090 3300049583 Unclassified 1055
773 Ga0501068_0023828 3300049584 Unclassified 3590
774 Ga0501068_0042839 3300049584 Unclassified 2722
775 Ga0501069_0025485 3300049585 Bacteria 3233
776 Ga0501069_0026029 3300049585 Bacteria 3203
777 Ga0501069_0030717 3300049585 Bacteria 2952
778 Ga0501069_0037271 3300049585 Unclassified 2683
779 Ga0501069_0071001 3300049585 Bacteria 1951
780 Ga0501070_0000932 3300049586 Bacteria 26359
781 Ga0501070_0002071 3300049586 Bacteria 17606
782 Ga0501070_0006123 3300049586 Bacteria 10253
783 Ga0501070_0030930 3300049586 Bacteria 4484
784 Ga0501070_0240218 3300049586 Bacteria 1483
785 Ga0501072_0035119 3300049588 Bacteria 3929
786 Ga0501072_0149971 3300049588 Bacteria 1859
787 Ga0501073_0010184 3300049589 Bacteria 6906
788 Ga0501074_0008573 3300049590 Bacteria 7406
789 Ga0501080_0025463 3300049742 Bacteria 5491
790 Ga0501080_0122183 3300049742 Bacteria 2412
791 Ga0501080_0129241 3300049742 Unclassified 2338
792 Ga0501080_0198548 3300049742 Bacteria 1842
793 Ga0501080_0311115 3300049742 Bacteria 1427
794 Ga0501083_0198588 3300049744 Bacteria 1308
795 Ga0501035_0209986 3300049822 Bacteria 1666
796 Ga0501044_0246295 3300049823 Bacteria 1730
797 Ga0501044_0337246 3300049823 Bacteria 1429
798 nmdc:mga05p37_55864_c1 3300050507 Bacteria 4860
799 nmdc:mga08y16_309851_c1 3300050511 Bacteria 1626
800 nmdc:mga0n895_19278_c1 3300050512 Bacteria 6336
801 nmdc:mga0n895_3110_c1 3300050512 Bacteria 13221
802 nmdc:mga0n895_88907_c1 3300050512 Bacteria 3089
803 nmdc:mga08x19_246610_c1 3300050514 Bacteria 1232
804 nmdc:mga08x19_450061_c1 3300050514 Unclassified 906
805 nmdc:mga0a205_61564_c1 3300050515 Bacteria 3625
806 Ga0495601_0000896 3300053077 Bacteria 16243
807 Ga0495601_0041360 3300053077 Bacteria 2889
808 Ga0495601_0070231 3300053077 Bacteria 2235
809 Ga0495601_0076899 3300053077 Bacteria 2137
810 Ga0495601_0105556 3300053077 Bacteria 1821
811 Ga0495601_0130433 3300053077 Bacteria 1637
812 Ga0495601_0169850 3300053077 Bacteria 1425
813 Ga0495612_0002591 3300053078 Bacteria 7456
814 Ga0495612_0003142 3300053078 Bacteria 6841
815 Ga0495612_0151572 3300053078 Bacteria 1009
816 Ga0495595_0010349 3300053084 Bacteria 3874
817 Ga0495595_0013489 3300053084 Bacteria 3452
818 Ga0495595_0022850 3300053084 Bacteria 2748
819 Ga0495595_0260290 3300053084 Bacteria 869
820 Ga0495619_0006645 3300053085 Bacteria 7320
821 Ga0495619_0010604 3300053085 Bacteria 5797
822 Ga0495619_0011265 3300053085 Bacteria 5625
823 Ga0495619_0018172 3300053085 Bacteria 4459
824 Ga0495619_0055610 3300053085 Bacteria 2621
825 Ga0495619_0163991 3300053085 Bacteria 1535
826 Ga0466962_0000230 3300061719 Bacteria 23282
827 Ga0466962_0000378 3300061719 Bacteria 19231
828 Ga0466962_0005450 3300061719 Bacteria 6114
829 Ga0466962_0017794 3300061719 Bacteria 3421
830 Ga0466962_0043693 3300061719 Bacteria 2144
831 Ga0466962_0064658 3300061719 Bacteria 1746
832 Ga0466962_0082666 3300061719 Bacteria 1536
833 Ga0530510_0102195 3300061734 Unclassified 2096
834 Ga0530510_0570723 3300061734 Unclassified 860
835 Ga0395900_0442980
836 Ga0070658_10007803
837 Ga0070658_10015001
838 Ga0070658_10017256
839 Ga0070658_10142602
840 Ga0070658_10201183
841 Ga0070658_10247057
842 Ga0070683_100029811
843 Ga0070683_100097492
844 Ga0070683_100181009
845 Ga0070683_100298884
846 Ga0070680_100012026
847 Ga0070680_100024864
848 Ga0070680_100048592
849 Ga0070680_100516351
850 Ga0070682_100100957
851 Ga0070682_100231633
852 Ga0070660_100033559
853 Ga0070660_100045246
854 Ga0070660_100071914
855 Ga0070660_100097205
856 Ga0070660_100206388
857 Ga0070660_100495756
858 Ga0070691_10056721
859 Ga0070661_100006585
860 Ga0070661_100041553
861 Ga0070661_100097230
862 Ga0070661_100108232
863 Ga0070661_100116470
864 Ga0070661_100405963
865 Ga0070692_10100763
866 Ga0070659_100079029
867 Ga0070659_100090667
868 Ga0070714_100025605
869 Ga0070714_100032003
870 Ga0070714_100048415
871 Ga0070714_100360041
872 Ga0070714_100423410
873 Ga0070713_100024280
874 Ga0070713_100042102
875 Ga0070713_100511542
876 Ga0070710_10005611
877 Ga0070711_100013831
878 Ga0070711_100019156
879 Ga0070711_100076504
880 Ga0070708_100014184
881 Ga0070663_100094069
882 Ga0070663_100541784
883 Ga0070678_100056276
884 Ga0070662_100615762
885 Ga0070681_10000749
886 Ga0070681_10006655
887 Ga0070681_10008242
888 Ga0070681_10047094
889 Ga0070681_10067249
890 Ga0070681_10093404
891 Ga0070681_10108465
892 Ga0070681_10122719
893 Ga0070681_10187266
894 Ga0070707_100001944
895 Ga0070707_100464407
896 Ga0070698_100037762
897 Ga0070699_100020721
898 Ga0070699_100607028
899 Ga0070679_100015385
900 Ga0070679_100049409
901 Ga0070679_100053394
902 Ga0070679_100067376
903 Ga0070679_100075416
904 Ga0070679_100089663
905 Ga0070679_100102155
906 Ga0070679_100186474
907 Ga0070679_100780560
908 Ga0070684_100005027
909 Ga0070684_100017563
910 Ga0068853_100114568
911 Ga0068853_100393157
912 Ga0070695_100001116
913 Ga0070695_100262849
914 Ga0070665_100177084
915 Ga0070704_100236813
916 Ga0068855_100019092
917 Ga0068855_100032562
918 Ga0068855_100045854
919 Ga0068855_100050832
920 Ga0068855_100080104
921 Ga0068855_100397134
922 Ga0068857_100607164
923 Ga0068854_100717078
924 Ga0068856_100028398
925 Ga0068856_100048093
926 Ga0068856_100154480
927 Ga0068852_100075877
928 Ga0068864_100336506
929 Ga0070717_10002024
930 Ga0070717_10025828
931 Ga0070717_10048900
932 Ga0070715_10000285
933 Ga0070715_10062010
934 Ga0070716_100011760
935 Ga0070712_100018785
936 Ga0070712_100726324
937 Ga0097621_100681889
938 Ga0075433_10131136
939 Ga0075434_100006735
940 Ga0075434_100052890
941 Ga0068865_100257097
942 Ga0075436_100352922
943 Ga0105240_10004372
944 Ga0105240_10026508
945 Ga0105240_10151987
946 Ga0105240_10189040
947 Ga0105240_10357338
948 Ga0105240_10950146
949 Ga0105245_10210947
950 Ga0114129_10033307
951 Ga0105241_10874689
952 Ga0105242_10036689
953 Ga0105248_10680605
954 Ga0105237_10026492
955 Ga0105237_10032639
956 Ga0105238_10010250
957 Ga0105238_10150583
958 Ga0105239_10934705
959 Ga0105239_10936412
960 Ga0157373_10138625
961 Ga0157370_10015065
962 Ga0157370_10050383
963 Ga0157370_10057103
964 Ga0157370_10066410
965 Ga0157370_10120191
966 Ga0157369_10003856
967 Ga0157369_10040278
968 Ga0157369_10045651
969 Ga0157369_10078926
970 Ga0157369_10106748
971 Ga0157369_10176982
972 Ga0157369_10195652
973 Ga0157369_10320206
974 Ga0157374_10630269
975 Ga0157372_10059594
976 Ga0157372_10085387
977 Ga0157372_10378585
978 Ga0157372_10670807
979 Ga0182008_10027288
980 Ga0157377_10395737
981 Ga0157376_10028299
982 Ga0197907_11375264
983 Ga0206354_10233267
984 Ga0206354_10383196
985 Ga0206354_11613024
986 Ga0206353_10115099
987 Ga0206353_11084915
988 Ga0206353_11117654
989 Ga0213871_10049500
990 Ga0207692_10078368
991 Ga0207685_10059620
992 Ga0207699_10041401
993 Ga0207699_10280642
994 Ga0207705_10017363
995 Ga0207705_10021630
996 Ga0207705_10140330
997 Ga0207654_10042579
998 Ga0207707_10023124
999 Ga0207707_10044759
1000 Ga0207707_10048038
1001 Ga0207707_10086901
1002 Ga0207707_10122857
1003 Ga0207707_10148217
1004 Ga0207707_10693801
1005 Ga0207695_10039360
1006 Ga0207695_10057395
1007 Ga0207695_10073223
1008 Ga0207695_10134669
1009 Ga0207671_10146825
1010 Ga0207671_10213610
1011 Ga0207693_10001514
1012 Ga0207693_10005278
1013 Ga0207693_10084722
1014 Ga0207693_10166901
1015 Ga0207663_10006744
1016 Ga0207663_10014649
1017 Ga0207663_10050193
1018 Ga0207660_10008175
1019 Ga0207660_10079599
1020 Ga0207660_10229556
1021 Ga0207657_10000486
1022 Ga0207657_10004929
1023 Ga0207657_10006205
1024 Ga0207657_10008281
1025 Ga0207657_10012639
1026 Ga0207657_10015181
1027 Ga0207657_10033940
1028 Ga0207657_10055140
1029 Ga0207657_10287636
1030 Ga0207649_10042731
1031 Ga0207649_10053430
1032 Ga0207649_10089346
1033 Ga0207649_10158878
1034 Ga0207649_10194620
1035 Ga0207649_10253619
1036 Ga0207649_10342637
1037 Ga0207652_10006427
1038 Ga0207652_10021225
1039 Ga0207652_10069815
1040 Ga0207652_10080801
1041 Ga0207652_10188799
1042 Ga0207652_10739555
1043 Ga0207646_10006959
1044 Ga0207694_10061636
1045 Ga0207694_10136324
1046 Ga0207687_10371965
1047 Ga0207700_10050604
1048 Ga0207700_10773398
1049 Ga0207664_10024679
1050 Ga0207664_10032537
1051 Ga0207664_10059949
1052 Ga0207664_10127389
1053 Ga0207664_10292601
1054 Ga0207664_10306677
1055 Ga0207664_10414274
1056 Ga0207664_10522743
1057 Ga0207644_10195967
1058 Ga0207690_10099925
1059 Ga0207690_10166319
1060 Ga0207690_10314237
1061 Ga0207690_10451338
1062 Ga0207690_10504610
1063 Ga0207686_10056395
1064 Ga0207665_10013702
1065 Ga0207661_10005380
1066 Ga0207661_10062334
1067 Ga0207661_10182567
1068 Ga0207661_10198935
1069 Ga0207661_10255796
1070 Ga0207679_10305790
1071 Ga0207667_10046352
1072 Ga0207667_10074638
1073 Ga0207667_10100363
1074 Ga0207667_10103375
1075 Ga0207667_10106933
1076 Ga0207667_10200091
1077 Ga0207667_10335588
1078 Ga0207667_10379866
1079 Ga0207667_10404819
1080 Ga0207640_10199928
1081 Ga0207677_10158125
1082 Ga0207677_10278865
1083 Ga0207639_10490479
1084 Ga0207678_10086611
1085 Ga0207678_10160144
1086 Ga0207702_10102866
1087 Ga0207702_10174412
1088 Ga0207702_10298824
1089 Ga0207702_10307111
1090 Ga0207676_10336484
1091 Ga0207674_10030732
1092 Ga0207674_10078247
1093 Ga0207683_10297683
1094 Ga0207698_10008070
1095 Ga0207698_10060354
1096 Ga0207698_10198309
1097 Ga0265319_1007255
1098 Ga0265319_1032102
1099 Ga0265318_10022142
1100 Ga0265338_10003469
1101 Ga0265338_10006363
1102 Ga0265338_10011492
1103 Ga0265338_10016336
1104 Ga0265338_10028196
1105 Ga0265338_10125062
1106 Ga0265338_10169009
1107 Ga0265324_10034777
1108 Ga0265330_10092095
1109 Ga0265320_10012728
1110 Ga0265340_10092764
1111 Ga0265339_10037237
1112 Ga0265327_10087079
1113 Ga0265313_10004167
1114 Ga0307409_100171156
1115 Ga0307416_100012377
1116 Ga0307416_100329940
1117 Ga0307415_100504330
1118 Ga0373934_0071044
1119 Ga0373944_0003460
1120 Ga0373932_0060733
1121 Ga0373945_0017396
1122 Ga0373945_0094327
1123 Ga0373953_0026174
1124 Ga0373956_0100892
1125 Ga0373957_0059544
1126 Ga0373943_0001557
1127 Ga0373943_0004770
1128 Ga0373943_0029675
1129 Ga0373946_0029927
1130 Ga0373955_0108397
1131 Ga0373924_0024003
1132 Ga0373924_0213580
1133 Ga0373931_0025549
1134 Ga0373935_0018087
1135 Ga0373927_0028847
1136 Ga0373927_0076703
1137 Ga0373933_0074530
1138 Ga0373947_0000833
1139 Ga0373947_0001304
1140 Ga0373947_0004241
1141 Ga0373937_0001461
1142 Ga0373937_0016157
1143 Ga0373937_0751835
1144 Ga0373925_0003428
1145 Ga0373925_0015724
1146 Ga0395899_0024329
1147 Ga0395900_0017016
1148 Ga0395900_0017733
1149 Ga0395900_0077576
1150 Ga0395900_0579189
1151 Ga0395900_0585131
1152 Ga0395898_0027463
1153 Ga0395898_0034193
1154 Ga0395898_0066172
1155 Ga0395898_0073578
1156 Ga0395898_0086574
1157 Ga0395898_0225352
1158 Ga0395898_0474683
1159 Ga0395905_0050603
1160 Ga0436364_1212053
1161 Ga0395901_0042245
1162 Ga0395901_0055019
1163 Ga0395901_0078826
1164 Ga0395901_0104986
1165 Ga0436365_1019739
1166 Ga0436360_0815520
1167 Ga0436363_0106831
1168 Ga0439436_0012362
1169 Ga0439439_0016008
1170 Ga0439431_0002269
1171 Ga0439448_0134255
1172 Ga0439457_042944
1173 Ga0439446_0002256
1174 Ga0439434_0007674
1175 Ga0466969_0000408
1176 Ga0466969_0070411
1177 Ga0466972_0013763
1178 Ga0466965_0004049
1179 Ga0466966_0004115
1180 Ga0466966_0056747
1181 Ga0466966_0107675
1182 Ga0466966_0260045
1183 Ga0466966_0292199
1184 Ga0466961_0003343
1185 Ga0466961_0018160
1186 Ga0466961_0024084
1187 Ga0466961_0040880
1188 Ga0466961_0065232
1189 Ga0466961_0144466
1190 Ga0466963_0000752
1191 Ga0466963_0000760
1192 Ga0466963_0001436
1193 Ga0466963_0003818
1194 Ga0466963_0011658
1195 Ga0466963_0024964
1196 Ga0466963_0026442
1197 Ga0466963_0026995
1198 Ga0466963_0028399
1199 Ga0466963_0029963
1200 Ga0466963_0045069
1201 Ga0466963_0069877
1202 Ga0466963_0070413
1203 Ga0466963_0089111
1204 Ga0466963_0091966
1205 Ga0466963_0102932
1206 Ga0466963_0171660
1207 Ga0466963_0231732
1208 Ga0466963_0260560
1209 Ga0466963_0290401
1210 Ga0466963_0300212
1211 Ga0466963_0395449
1212 Ga0466963_0518671
1213 Ga0466964_0000980
1214 Ga0466964_0001835
1215 Ga0466964_0004614
1216 Ga0466964_0019307
1217 Ga0466964_0021445
1218 Ga0466964_0055934
1219 Ga0466964_0068277
1220 Ga0466964_0144131
1221 Ga0466971_0000854
1222 Ga0466971_0006026
1223 Ga0466971_0010425
1224 Ga0466971_0053859
1225 Ga0466971_0100146
1226 Ga0466971_0100160
1227 Ga0466971_0120057
1228 Ga0466968_0013251
1229 Ga0466968_0033709
1230 Ga0466968_0078103
1231 Ga0466968_0185760
1232 Ga0466970_0019344
1233 Ga0466970_0081194
1234 Ga0466970_0240313
1235 Ga0466957_0000320
1236 Ga0466957_0002697
1237 Ga0466957_0008188
1238 Ga0466957_0009467
1239 Ga0466957_0012058
1240 Ga0466957_0022846
1241 Ga0466957_0024673
1242 Ga0466957_0038706
1243 Ga0466957_0044447
1244 Ga0466957_0061912
1245 Ga0466957_0078882
1246 Ga0466957_0092865
1247 Ga0466957_0120781
1248 Ga0466957_0138165
1249 Ga0466957_0292194
1250 Ga0466957_0579880
1251 Ga0466960_0021185
1252 Ga0466960_0083647
1253 Ga0466960_0117558
1254 Ga0466960_0365764
1255 Ga0466959_0008653
1256 Ga0466959_0010156
1257 Ga0466959_0072562
1258 Ga0466959_0097887
1259 Ga0466959_0103272
1260 Ga0466959_0124651
1261 Ga0466959_0167630
1262 Ga0466959_0234981
1263 Ga0466959_0238662
1264 Ga0466959_0280720
1265 Ga0466958_0005130
1266 Ga0466958_0007009
1267 Ga0466958_0007207
1268 Ga0466958_0007488
1269 Ga0466958_0008663
1270 Ga0466958_0019258
1271 Ga0466958_0020596
1272 Ga0466958_0021364
1273 Ga0466958_0057855
1274 Ga0466958_0110090
1275 Ga0466958_0117160
1276 Ga0466958_0206714
1277 Ga0466958_0225658
1278 Ga0466958_0503048
1279 Ga0466967_0001867
1280 Ga0466967_0006510
1281 Ga0466967_0008137
1282 Ga0466967_0012033
1283 Ga0466967_0014542
1284 Ga0466967_0016832
1285 Ga0466967_0019357
1286 Ga0466967_0020228
1287 Ga0466967_0031882
1288 Ga0466967_0039559
1289 Ga0466967_0043872
1290 Ga0466967_0058802
1291 Ga0466967_0059022
1292 Ga0466967_0062419
1293 Ga0466967_0063715
1294 Ga0466967_0089713
1295 Ga0466967_0105945
1296 Ga0466967_0123476
1297 Ga0466967_0132051
1298 Ga0466967_0158329
1299 Ga0466967_0160985
1300 Ga0466967_0187938
1301 Ga0466967_0194028
1302 Ga0466967_0304742
1303 Ga0466967_0435173
1304 Ga0466967_0439866
1305 Ga0466967_0483624
1306 Ga0466967_0488663
1307 Ga0466967_0508286
1308 Ga0466967_0709555
1309 Ga0466967_0787632
1310 Ga0466967_0995956
1311 Ga0495592_0000048
1312 Ga0495592_0051776
1313 Ga0495592_0095414
1314 Ga0495592_0204954
1315 Ga0495592_0356833
1316 Ga0495629_0000983
1317 Ga0495629_0015602
1318 Ga0495629_0068901
1319 Ga0495629_0083905
1320 Ga0495629_0115477
1321 Ga0495629_0237436
1322 Ga0495641_0000513
1323 Ga0495641_0001416
1324 Ga0495641_0003996
1325 Ga0495641_0037441
1326 Ga0495641_0081260
1327 Ga0495641_0213863
1328 Ga0495651_0000049
1329 Ga0495651_0032397
1330 Ga0495651_0072171
1331 Ga0495651_0085130
1332 Ga0495651_0092323
1333 Ga0495651_0252547
1334 Ga0495651_0454664
1335 Ga0495653_0000489
1336 Ga0495653_0037793
1337 Ga0495653_0039324
1338 Ga0495653_0063593
1339 Ga0495653_0074201
1340 Ga0495653_0081218
1341 Ga0495653_0097382
1342 Ga0495653_0098842
1343 Ga0495653_0115516
1344 Ga0495580_0130815
1345 Ga0495582_0000553
1346 Ga0495582_0047087
1347 Ga0495605_0038854
1348 Ga0495639_0000180
1349 Ga0495639_0009403
1350 Ga0495639_0074972
1351 Ga0495662_0003722
1352 Ga0495662_0007890
1353 Ga0495662_0138274
1354 Ga0495664_0016483
1355 Ga0495664_0081742
1356 Ga0495664_0087336
1357 Ga0495664_0102766
1358 Ga0495664_0106459
1359 Ga0495664_0161528
1360 Ga0495585_0033720
1361 Ga0495594_0020401
1362 Ga0495607_0010453
1363 Ga0495608_0003026
1364 Ga0495608_0005307
1365 Ga0495608_0019694
1366 Ga0495608_0023644
1367 Ga0495608_0118017
1368 Ga0495608_0132207
1369 Ga0495608_0190255
1370 Ga0495618_0006054
1371 Ga0495618_0024890
1372 Ga0495618_0160286
1373 Ga0495618_0161319
1374 Ga0495628_0000026
1375 Ga0495628_0004120
1376 Ga0495628_0109524
1377 Ga0495630_0012886
1378 Ga0495630_0014969
1379 Ga0495630_0017466
1380 Ga0495630_0018842
1381 Ga0495630_0041071
1382 Ga0495631_0079527
1383 Ga0495644_0001562
1384 Ga0495644_0078043
1385 Ga0495663_0007171
1386 Ga0495666_0003590
1387 Ga0495652_0000172
1388 Ga0495652_0103308
1389 Ga0495652_0112881
1390 Ga0495652_0149532
1391 Ga0495652_0290800
1392 Ga0495665_0005465
1393 Ga0495665_0037122
1394 Ga0495640_0004584
1395 Ga0495640_0074153
1396 Ga0495640_0074625
1397 Ga0495640_0077028
1398 Ga0495640_0089388
1399 Ga0495640_0099037
1400 Ga0495640_0131827
1401 Ga0495640_0153882
1402 Ga0495586_0042294
1403 Ga0495586_0162558
1404 Ga0495587_0000362
1405 Ga0495587_0011402
1406 Ga0495587_0016541
1407 Ga0495587_0029918
1408 Ga0495587_0153553
1409 Ga0495645_0000016
1410 Ga0495645_0037319
1411 Ga0495645_0040045
1412 Ga0495645_0077748
1413 Ga0495645_0228406
1414 Ga0495633_0117738
1415 Ga0495667_0001379
1416 Ga0495667_0028440
1417 Ga0495667_0035465
1418 Ga0495667_0043945
1419 Ga0495667_0059847
1420 Ga0495656_0013463
1421 Ga0495634_0015592
1422 Ga0495634_0043668
1423 Ga0495634_0084951
1424 Ga0495634_0109796
1425 Ga0495634_0217356
1426 Ga0495611_0043473
1427 Ga0495635_0043056
1428 Ga0495635_0050451
1429 Ga0495635_0050772
1430 Ga0495635_0072500
1431 Ga0495635_0128518
1432 Ga0495657_0002580
1433 Ga0495657_0019102
1434 Ga0495657_0020642
1435 Ga0495657_0022694
1436 Ga0495657_0118320
1437 Ga0495657_0127897
1438 Ga0495657_0179976
1439 Ga0495657_0208544
1440 Ga0495599_0000016
1441 Ga0495599_0054948
1442 Ga0495599_0109699
1443 Ga0495599_0242133
1444 Ga0495623_0000046
1445 Ga0495623_0015074
1446 Ga0495623_0056966
1447 Ga0495623_0208768
1448 Ga0495646_0003505
1449 Ga0495646_0035631
1450 Ga0495646_0079924
1451 Ga0495646_0112795
1452 Ga0495647_0001779
1453 Ga0495647_0007902
1454 Ga0495647_0010520
1455 Ga0495658_0001696
1456 Ga0495658_0002075
1457 Ga0495658_0116693
1458 Ga0495658_0199545
1459 Ga0495613_0010668
1460 Ga0495613_0020063
1461 Ga0495613_0026728
1462 Ga0495613_0028638
1463 Ga0495613_0285032
1464 Ga0495613_0350131
1465 Ga0495624_0002088
1466 Ga0495624_0003996
1467 Ga0495624_0007147
1468 Ga0495624_0038068
1469 Ga0495670_0075765
1470 Ga0495589_0124947
1471 Ga0495600_0011642
1472 Ga0495600_0020552
1473 Ga0495600_0061348
1474 Ga0495600_0065733
1475 Ga0495600_0072025
1476 Ga0495600_0112341
1477 Ga0495581_0001833
1478 Ga0495581_0011060
1479 Ga0495604_0000004
1480 Ga0495604_0064863
1481 Ga0495604_0066552
1482 Ga0495604_0085022
1483 Ga0495604_0151265
1484 Ga0495604_0460514
1485 Ga0495674_0003155
1486 Ga0495674_0030477
1487 Ga0495674_0049237
1488 Ga0495674_0073031
1489 Ga0495674_0118262
1490 Ga0495674_0377983
1491 Ga0495674_0410920
1492 Ga0495676_0000766
1493 Ga0495676_0002145
1494 Ga0495676_0042185
1495 Ga0495676_0079435
1496 Ga0495676_0238259
1497 Ga0495680_0004330
1498 Ga0495680_0007287
1499 Ga0495680_0009072
1500 Ga0495680_0019817
1501 Ga0495680_0049855
1502 Ga0495680_0057886
1503 Ga0495680_0494077
1504 Ga0495675_0000079
1505 Ga0495675_0186381
1506 Ga0495677_0034607
1507 Ga0495679_065949
1508 Ga0495684_0008848
1509 Ga0495684_0021761
1510 Ga0495684_0029722
1511 Ga0495684_0050341
1512 Ga0495684_0060358
1513 Ga0495684_0069180
1514 Ga0495684_0122612
1515 Ga0495684_0151204
1516 Ga0495684_0221950
1517 Ga0495593_0000866
1518 Ga0495593_0009203
1519 Ga0495593_0210671
1520 Ga0495602_0000351
1521 Ga0495602_0087729
1522 Ga0495602_0130295
1523 Ga0495614_0000786
1524 Ga0495614_0057148
1525 Ga0496100_0005276
1526 Ga0496100_0011540
1527 Ga0496100_0038534
1528 Ga0496100_0087188
1529 Ga0496100_0096497
1530 Ga0496100_0126495
1531 Ga0496101_0001389
1532 Ga0496101_0007270
1533 Ga0496101_0012442
1534 Ga0496101_0016057
1535 Ga0496101_0017035
1536 Ga0496101_0017364
1537 Ga0496101_0082091
1538 Ga0496101_0352107
1539 Ga0496102_0006447
1540 Ga0496102_0056517
1541 Ga0496102_0152218
1542 Ga0496102_0232278
1543 Ga0496103_0048062
1544 Ga0496103_0062247
1545 Ga0496104_0008448
1546 Ga0496104_0024421
1547 Ga0496104_0189543
1548 Ga0496104_0274881
1549 Ga0496104_0617315
1550 Ga0496105_0050926
1551 Ga0496105_0094856
1552 Ga0496106_0014533
1553 Ga0496106_0111042
1554 Ga0496106_0230326
1555 Ga0496107_0001958
1556 Ga0496107_0084235
1557 Ga0496107_0142804
1558 Ga0496108_0004497
1559 Ga0496108_0128035
1560 Ga0496108_0158050
1561 Ga0496109_0030256
1562 Ga0496109_0033699
1563 Ga0496109_0108207
1564 Ga0496109_0170395
1565 Ga0496109_0222574
1566 Ga0496109_0240833
1567 Ga0496109_0294785
1568 Ga0496109_0386951
1569 Ga0496110_0021361
1570 Ga0496110_0476628
1571 Ga0496111_0404952
1572 Ga0496111_0428045
1573 Ga0496112_0020392
1574 Ga0496112_0028531
1575 Ga0496112_0032281
1576 Ga0496112_0121171
1577 Ga0496112_0126419
1578 Ga0496112_0155078
1579 Ga0496112_0309171
1580 Ga0496112_0601598
1581 Ga0496113_0108856
1582 Ga0496114_0004690
1583 Ga0496114_0004918
1584 Ga0496114_0010417
1585 Ga0496114_0011796
1586 Ga0496114_0013266
1587 Ga0496114_0043657
1588 Ga0496114_0058192
1589 Ga0496114_0093644
1590 Ga0496114_0104845
1591 Ga0496115_0004959
1592 Ga0496115_0046844
1593 Ga0496115_0101763
1594 Ga0496115_0172135
1595 Ga0496115_0230547
1596 Ga0496115_0381820
1597 Ga0496115_0485199
1598 Ga0501034_0005913
1599 Ga0501043_0344566
1600 Ga0501043_0390358
1601 Ga0501047_0349098
1602 Ga0501067_0007804
1603 Ga0501067_0016686
1604 Ga0501067_0081102
1605 Ga0501067_0092265
1606 Ga0501067_0221090
1607 Ga0501068_0023828
1608 Ga0501068_0042839
1609 Ga0501069_0025485
1610 Ga0501069_0026029
1611 Ga0501069_0030717
1612 Ga0501069_0037271
1613 Ga0501069_0071001
1614 Ga0501070_0000932
1615 Ga0501070_0002071
1616 Ga0501070_0006123
1617 Ga0501070_0030930
1618 Ga0501070_0240218
1619 Ga0501072_0035119
1620 Ga0501072_0149971
1621 Ga0501073_0010184
1622 Ga0501074_0008573
1623 Ga0501080_0025463
1624 Ga0501080_0122183
1625 Ga0501080_0129241
1626 Ga0501080_0198548
1627 Ga0501080_0311115
1628 Ga0501083_0198588
1629 Ga0501035_0209986
1630 Ga0501044_0246295
1631 Ga0501044_0337246
1632 nmdc:mga05p37_55864_c1
1633 nmdc:mga08y16_309851_c1
1634 nmdc:mga0n895_19278_c1
1635 nmdc:mga0n895_3110_c1
1636 nmdc:mga0n895_88907_c1
1637 nmdc:mga08x19_246610_c1
1638 nmdc:mga08x19_450061_c1
1639 nmdc:mga0a205_61564_c1
1640 Ga0495601_0000896
1641 Ga0495601_0041360
1642 Ga0495601_0070231
1643 Ga0495601_0076899
1644 Ga0495601_0105556
1645 Ga0495601_0130433
1646 Ga0495601_0169850
1647 Ga0495612_0002591
1648 Ga0495612_0003142
1649 Ga0495612_0151572
1650 Ga0495595_0010349
1651 Ga0495595_0013489
1652 Ga0495595_0022850
1653 Ga0495595_0260290
1654 Ga0495619_0006645
1655 Ga0495619_0010604
1656 Ga0495619_0011265
1657 Ga0495619_0018172
1658 Ga0495619_0055610
1659 Ga0495619_0163991
1660 Ga0466962_0000230
1661 Ga0466962_0000378
1662 Ga0466962_0005450
1663 Ga0466962_0017794
1664 Ga0466962_0043693
1665 Ga0466962_0064658
1666 Ga0466962_0082666
1667 Ga0530510_0102195
1668 Ga0530510_0570723

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

29

249

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aqu-assembly1.cif.gz_B crystal structure of plasmodium falciparum purine nucleoside phosphorylase: the m183l mutant 0.9152 4 240
3tl6-assembly1.cif.gz_D crystal structure of purine nucleoside phosphorylase from entamoeba histolytica 0.9097 3 239
1odk-assembly1.cif.gz_E purine nucleoside phosphorylase from thermus thermophilus 0.9083 1 239
3tl6-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase from entamoeba histolytica 0.9069 4 239
4d9h-assembly1.cif.gz_B crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenosine 0.906 3 239
ID Description Score Start End Superfamily
3tl6D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9097 3 239 3.40.50.1580
1odkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8969 1 239 3.40.50.1580
1odkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8816 1 239 3.40.50.1580
4tymA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.877 3 242 3.40.50.1580
4ldnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8756 1 243 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A257ATK0-F1-model_v4 5'-methylthioadenosine phosphorylase 0.9746 4 101 GO:0003824
GO:0005829
GO:0009116
AF-G5LXY5-F1-model_v4 Purine nucleoside phosphorylase 0.9671 10 153 GO:0004731
GO:0005829
GO:0006152
AF-A0A2S5EJU0-F1-model_v4 Uridine phosphorylase (EC 2.4.2.3) 0.9615 4 154 GO:0005829
GO:0009164
GO:0016763
AF-R7A9H6-F1-model_v4 deleted 0.961 3 99
AF-A0A7J6LA44-F1-model_v4 Nucleoside phosphorylase domain-containing protein 0.9601 4 91 GO:0004850
GO:0005829
GO:0006218

Map