F482798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 834 | 258 | 1668 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0442980|Ga0395900_0442980_482_1240 |
| Length | 252 |
| Sequence | MSADPLLAGQSMVAAMPIHVRAAPGEYAEAVLLPGDPLRAKYIADTYLDNVQQRNAERGLLGFTGDWEGKPVSVQGTGMGCPGATIVFEELIQLGCKKLMRVGTCGGLQPHHQLGDLIVALSAVPADATAMHLVANEPHCPTASWSLIHGAVHVAKGIGQDMHVGPIVSSDLFYNPDEGQYERWSKRGVLAVEMEAAALFTIGALRGVETGCLLTVSDIVVEGVFTRISDDELRAAVDRMTRVALDTVTAQH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 65 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 140 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 141 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 142 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 143 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 144 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 145 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.16 |
| Metatranscriptomes | 0.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 90.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0442980 | 3300037418 | Bacteria | 1256 |
| 2 | Ga0070658_10007803 | 3300005327 | Bacteria | 8622 |
| 3 | Ga0070658_10015001 | 3300005327 | Bacteria | 6203 |
| 4 | Ga0070658_10017256 | 3300005327 | Bacteria | 5777 |
| 5 | Ga0070658_10142602 | 3300005327 | Bacteria | 2002 |
| 6 | Ga0070658_10201183 | 3300005327 | Bacteria | 1681 |
| 7 | Ga0070658_10247057 | 3300005327 | Bacteria | 1513 |
| 8 | Ga0070683_100029811 | 3300005329 | Bacteria | 4944 |
| 9 | Ga0070683_100097492 | 3300005329 | Bacteria | 2766 |
| 10 | Ga0070683_100181009 | 3300005329 | Unclassified | 2001 |
| 11 | Ga0070683_100298884 | 3300005329 | Unclassified | 1531 |
| 12 | Ga0070680_100012026 | 3300005336 | Bacteria | 6714 |
| 13 | Ga0070680_100024864 | 3300005336 | Bacteria | 4787 |
| 14 | Ga0070680_100048592 | 3300005336 | Bacteria | 3458 |
| 15 | Ga0070680_100516351 | 3300005336 | Unclassified | 1023 |
| 16 | Ga0070682_100100957 | 3300005337 | Bacteria | 1904 |
| 17 | Ga0070682_100231633 | 3300005337 | Unclassified | 1321 |
| 18 | Ga0070660_100033559 | 3300005339 | Bacteria | 3869 |
| 19 | Ga0070660_100045246 | 3300005339 | Bacteria | 3368 |
| 20 | Ga0070660_100071914 | 3300005339 | Bacteria | 2701 |
| 21 | Ga0070660_100097205 | 3300005339 | Unclassified | 2329 |
| 22 | Ga0070660_100206388 | 3300005339 | Bacteria | 1594 |
| 23 | Ga0070660_100495756 | 3300005339 | Bacteria | 1016 |
| 24 | Ga0070691_10056721 | 3300005341 | Bacteria | 1878 |
| 25 | Ga0070661_100006585 | 3300005344 | Bacteria | 8009 |
| 26 | Ga0070661_100041553 | 3300005344 | Bacteria | 3356 |
| 27 | Ga0070661_100097230 | 3300005344 | Unclassified | 2186 |
| 28 | Ga0070661_100108232 | 3300005344 | Bacteria | 2074 |
| 29 | Ga0070661_100116470 | 3300005344 | Unclassified | 1999 |
| 30 | Ga0070661_100405963 | 3300005344 | Unclassified | 1078 |
| 31 | Ga0070692_10100763 | 3300005345 | Bacteria | 1583 |
| 32 | Ga0070659_100079029 | 3300005366 | Bacteria | 2625 |
| 33 | Ga0070659_100090667 | 3300005366 | Unclassified | 2450 |
| 34 | Ga0070714_100025605 | 3300005435 | Bacteria | 4870 |
| 35 | Ga0070714_100032003 | 3300005435 | Bacteria | 4391 |
| 36 | Ga0070714_100048415 | 3300005435 | Bacteria | 3615 |
| 37 | Ga0070714_100360041 | 3300005435 | Bacteria | 1368 |
| 38 | Ga0070714_100423410 | 3300005435 | Bacteria | 1262 |
| 39 | Ga0070713_100024280 | 3300005436 | Bacteria | 4720 |
| 40 | Ga0070713_100042102 | 3300005436 | Bacteria | 3725 |
| 41 | Ga0070713_100511542 | 3300005436 | Bacteria | 1134 |
| 42 | Ga0070710_10005611 | 3300005437 | Bacteria | 5977 |
| 43 | Ga0070711_100013831 | 3300005439 | Bacteria | 5075 |
| 44 | Ga0070711_100019156 | 3300005439 | Bacteria | 4386 |
| 45 | Ga0070711_100076504 | 3300005439 | Bacteria | 2373 |
| 46 | Ga0070708_100014184 | 3300005445 | Bacteria | 6548 |
| 47 | Ga0070663_100094069 | 3300005455 | Bacteria | 2225 |
| 48 | Ga0070663_100541784 | 3300005455 | Bacteria | 972 |
| 49 | Ga0070678_100056276 | 3300005456 | Bacteria | 2876 |
| 50 | Ga0070662_100615762 | 3300005457 | Bacteria | 914 |
| 51 | Ga0070681_10000749 | 3300005458 | Bacteria | 26980 |
| 52 | Ga0070681_10006655 | 3300005458 | Bacteria | 11248 |
| 53 | Ga0070681_10008242 | 3300005458 | Bacteria | 10196 |
| 54 | Ga0070681_10047094 | 3300005458 | Bacteria | 4309 |
| 55 | Ga0070681_10067249 | 3300005458 | Bacteria | 3552 |
| 56 | Ga0070681_10093404 | 3300005458 | Unclassified | 2957 |
| 57 | Ga0070681_10108465 | 3300005458 | Bacteria | 2716 |
| 58 | Ga0070681_10122719 | 3300005458 | Unclassified | 2531 |
| 59 | Ga0070681_10187266 | 3300005458 | Bacteria | 1990 |
| 60 | Ga0070707_100001944 | 3300005468 | Bacteria | 19823 |
| 61 | Ga0070707_100464407 | 3300005468 | Bacteria | 1227 |
| 62 | Ga0070698_100037762 | 3300005471 | Bacteria | 4979 |
| 63 | Ga0070699_100020721 | 3300005518 | Bacteria | 5671 |
| 64 | Ga0070699_100607028 | 3300005518 | Bacteria | 998 |
| 65 | Ga0070679_100015385 | 3300005530 | Bacteria | 7351 |
| 66 | Ga0070679_100049409 | 3300005530 | Bacteria | 4189 |
| 67 | Ga0070679_100053394 | 3300005530 | Bacteria | 4023 |
| 68 | Ga0070679_100067376 | 3300005530 | Bacteria | 3570 |
| 69 | Ga0070679_100075416 | 3300005530 | Bacteria | 3362 |
| 70 | Ga0070679_100089663 | 3300005530 | Bacteria | 3062 |
| 71 | Ga0070679_100102155 | 3300005530 | Bacteria | 2853 |
| 72 | Ga0070679_100186474 | 3300005530 | Bacteria | 2045 |
| 73 | Ga0070679_100780560 | 3300005530 | Unclassified | 899 |
| 74 | Ga0070684_100005027 | 3300005535 | Bacteria | 10099 |
| 75 | Ga0070684_100017563 | 3300005535 | Bacteria | 5876 |
| 76 | Ga0068853_100114568 | 3300005539 | Unclassified | 2398 |
| 77 | Ga0068853_100393157 | 3300005539 | Unclassified | 1296 |
| 78 | Ga0070695_100001116 | 3300005545 | Bacteria | 14717 |
| 79 | Ga0070695_100262849 | 3300005545 | Bacteria | 1261 |
| 80 | Ga0070665_100177084 | 3300005548 | Bacteria | 2133 |
| 81 | Ga0070704_100236813 | 3300005549 | Bacteria | 1492 |
| 82 | Ga0068855_100019092 | 3300005563 | Bacteria | 8239 |
| 83 | Ga0068855_100032562 | 3300005563 | Bacteria | 6223 |
| 84 | Ga0068855_100045854 | 3300005563 | Bacteria | 5168 |
| 85 | Ga0068855_100050832 | 3300005563 | Bacteria | 4883 |
| 86 | Ga0068855_100080104 | 3300005563 | Bacteria | 3787 |
| 87 | Ga0068855_100397134 | 3300005563 | Bacteria | 1512 |
| 88 | Ga0068857_100607164 | 3300005577 | Unclassified | 1034 |
| 89 | Ga0068854_100717078 | 3300005578 | Bacteria | 865 |
| 90 | Ga0068856_100028398 | 3300005614 | Bacteria | 5463 |
| 91 | Ga0068856_100048093 | 3300005614 | Bacteria | 4202 |
| 92 | Ga0068856_100154480 | 3300005614 | Bacteria | 2305 |
| 93 | Ga0068852_100075877 | 3300005616 | Bacteria | 2967 |
| 94 | Ga0068864_100336506 | 3300005618 | Bacteria | 1421 |
| 95 | Ga0070717_10002024 | 3300006028 | Bacteria | 14193 |
| 96 | Ga0070717_10025828 | 3300006028 | Bacteria | 4678 |
| 97 | Ga0070717_10048900 | 3300006028 | Bacteria | 3470 |
| 98 | Ga0070715_10000285 | 3300006163 | Bacteria | 12378 |
| 99 | Ga0070715_10062010 | 3300006163 | Bacteria | 1644 |
| 100 | Ga0070716_100011760 | 3300006173 | Bacteria | 4414 |
| 101 | Ga0070712_100018785 | 3300006175 | Bacteria | 4496 |
| 102 | Ga0070712_100726324 | 3300006175 | Bacteria | 848 |
| 103 | Ga0097621_100681889 | 3300006237 | Bacteria | 945 |
| 104 | Ga0075433_10131136 | 3300006852 | Bacteria | 2227 |
| 105 | Ga0075434_100006735 | 3300006871 | Bacteria | 10557 |
| 106 | Ga0075434_100052890 | 3300006871 | Bacteria | 4036 |
| 107 | Ga0068865_100257097 | 3300006881 | Bacteria | 1381 |
| 108 | Ga0075436_100352922 | 3300006914 | Unclassified | 1060 |
| 109 | Ga0105240_10004372 | 3300009093 | Bacteria | 21577 |
| 110 | Ga0105240_10026508 | 3300009093 | Bacteria | 7605 |
| 111 | Ga0105240_10151987 | 3300009093 | Bacteria | 2756 |
| 112 | Ga0105240_10189040 | 3300009093 | Bacteria | 2423 |
| 113 | Ga0105240_10357338 | 3300009093 | Bacteria | 1656 |
| 114 | Ga0105240_10950146 | 3300009093 | Unclassified | 922 |
| 115 | Ga0105245_10210947 | 3300009098 | Bacteria | 1869 |
| 116 | Ga0114129_10033307 | 3300009147 | Bacteria | 7281 |
| 117 | Ga0105241_10874689 | 3300009174 | Bacteria | 833 |
| 118 | Ga0105242_10036689 | 3300009176 | Bacteria | 3934 |
| 119 | Ga0105248_10680605 | 3300009177 | Bacteria | 1160 |
| 120 | Ga0105237_10026492 | 3300009545 | Bacteria | 5926 |
| 121 | Ga0105237_10032639 | 3300009545 | Bacteria | 5271 |
| 122 | Ga0105238_10010250 | 3300009551 | Bacteria | 9401 |
| 123 | Ga0105238_10150583 | 3300009551 | Bacteria | 2302 |
| 124 | Ga0105239_10934705 | 3300010375 | Bacteria | 996 |
| 125 | Ga0105239_10936412 | 3300010375 | Bacteria | 995 |
| 126 | Ga0157373_10138625 | 3300013100 | Bacteria | 1710 |
| 127 | Ga0157370_10015065 | 3300013104 | Bacteria | 7878 |
| 128 | Ga0157370_10050383 | 3300013104 | Bacteria | 3980 |
| 129 | Ga0157370_10057103 | 3300013104 | Bacteria | 3713 |
| 130 | Ga0157370_10066410 | 3300013104 | Bacteria | 3412 |
| 131 | Ga0157370_10120191 | 3300013104 | Bacteria | 2453 |
| 132 | Ga0157369_10003856 | 3300013105 | Bacteria | 17824 |
| 133 | Ga0157369_10040278 | 3300013105 | Bacteria | 5101 |
| 134 | Ga0157369_10045651 | 3300013105 | Bacteria | 4763 |
| 135 | Ga0157369_10078926 | 3300013105 | Bacteria | 3526 |
| 136 | Ga0157369_10106748 | 3300013105 | Bacteria | 2980 |
| 137 | Ga0157369_10176982 | 3300013105 | Bacteria | 2246 |
| 138 | Ga0157369_10195652 | 3300013105 | Unclassified | 2123 |
| 139 | Ga0157369_10320206 | 3300013105 | Bacteria | 1612 |
| 140 | Ga0157374_10630269 | 3300013296 | Bacteria | 1083 |
| 141 | Ga0157372_10059594 | 3300013307 | Bacteria | 4270 |
| 142 | Ga0157372_10085387 | 3300013307 | Bacteria | 3579 |
| 143 | Ga0157372_10378585 | 3300013307 | Unclassified | 1649 |
| 144 | Ga0157372_10670807 | 3300013307 | Bacteria | 1207 |
| 145 | Ga0182008_10027288 | 3300014497 | Bacteria | 2894 |
| 146 | Ga0157377_10395737 | 3300014745 | Bacteria | 939 |
| 147 | Ga0157376_10028299 | 3300014969 | Bacteria | 4454 |
| 148 | Ga0197907_11375264 | 3300020069 | Bacteria | 939 |
| 149 | Ga0206354_10233267 | 3300020081 | Bacteria | 2808 |
| 150 | Ga0206354_10383196 | 3300020081 | Bacteria | 2439 |
| 151 | Ga0206354_11613024 | 3300020081 | Bacteria | 2564 |
| 152 | Ga0206353_10115099 | 3300020082 | Bacteria | 5737 |
| 153 | Ga0206353_11084915 | 3300020082 | Bacteria | 1579 |
| 154 | Ga0206353_11117654 | 3300020082 | Bacteria | 5681 |
| 155 | Ga0213871_10049500 | 3300021441 | Bacteria | 1148 |
| 156 | Ga0207692_10078368 | 3300025898 | Bacteria | 1760 |
| 157 | Ga0207685_10059620 | 3300025905 | Bacteria | 1506 |
| 158 | Ga0207699_10041401 | 3300025906 | Bacteria | 2660 |
| 159 | Ga0207699_10280642 | 3300025906 | Bacteria | 1157 |
| 160 | Ga0207705_10017363 | 3300025909 | Bacteria | 5154 |
| 161 | Ga0207705_10021630 | 3300025909 | Bacteria | 4590 |
| 162 | Ga0207705_10140330 | 3300025909 | Unclassified | 1804 |
| 163 | Ga0207654_10042579 | 3300025911 | Unclassified | 2571 |
| 164 | Ga0207707_10023124 | 3300025912 | Bacteria | 5439 |
| 165 | Ga0207707_10044759 | 3300025912 | Bacteria | 3857 |
| 166 | Ga0207707_10048038 | 3300025912 | Bacteria | 3718 |
| 167 | Ga0207707_10086901 | 3300025912 | Bacteria | 2732 |
| 168 | Ga0207707_10122857 | 3300025912 | Bacteria | 2270 |
| 169 | Ga0207707_10148217 | 3300025912 | Unclassified | 2051 |
| 170 | Ga0207707_10693801 | 3300025912 | Unclassified | 855 |
| 171 | Ga0207695_10039360 | 3300025913 | Bacteria | 5082 |
| 172 | Ga0207695_10057395 | 3300025913 | Bacteria | 4044 |
| 173 | Ga0207695_10073223 | 3300025913 | Bacteria | 3492 |
| 174 | Ga0207695_10134669 | 3300025913 | Unclassified | 2425 |
| 175 | Ga0207671_10146825 | 3300025914 | Unclassified | 1820 |
| 176 | Ga0207671_10213610 | 3300025914 | Bacteria | 1510 |
| 177 | Ga0207693_10001514 | 3300025915 | Bacteria | 20507 |
| 178 | Ga0207693_10005278 | 3300025915 | Bacteria | 10802 |
| 179 | Ga0207693_10084722 | 3300025915 | Bacteria | 2483 |
| 180 | Ga0207693_10166901 | 3300025915 | Bacteria | 1733 |
| 181 | Ga0207663_10006744 | 3300025916 | Bacteria | 5904 |
| 182 | Ga0207663_10014649 | 3300025916 | Bacteria | 4301 |
| 183 | Ga0207663_10050193 | 3300025916 | Bacteria | 2592 |
| 184 | Ga0207660_10008175 | 3300025917 | Bacteria | 6769 |
| 185 | Ga0207660_10079599 | 3300025917 | Bacteria | 2404 |
| 186 | Ga0207660_10229556 | 3300025917 | Bacteria | 1459 |
| 187 | Ga0207657_10000486 | 3300025919 | Bacteria | 41915 |
| 188 | Ga0207657_10004929 | 3300025919 | Bacteria | 14033 |
| 189 | Ga0207657_10006205 | 3300025919 | Bacteria | 12426 |
| 190 | Ga0207657_10008281 | 3300025919 | Bacteria | 10581 |
| 191 | Ga0207657_10012639 | 3300025919 | Bacteria | 8322 |
| 192 | Ga0207657_10015181 | 3300025919 | Bacteria | 7474 |
| 193 | Ga0207657_10033940 | 3300025919 | Bacteria | 4595 |
| 194 | Ga0207657_10055140 | 3300025919 | Bacteria | 3435 |
| 195 | Ga0207657_10287636 | 3300025919 | Unclassified | 1304 |
| 196 | Ga0207649_10042731 | 3300025920 | Bacteria | 2766 |
| 197 | Ga0207649_10053430 | 3300025920 | Bacteria | 2510 |
| 198 | Ga0207649_10089346 | 3300025920 | Bacteria | 2014 |
| 199 | Ga0207649_10158878 | 3300025920 | Bacteria | 1564 |
| 200 | Ga0207649_10194620 | 3300025920 | Unclassified | 1428 |
| 201 | Ga0207649_10253619 | 3300025920 | Unclassified | 1268 |
| 202 | Ga0207649_10342637 | 3300025920 | Bacteria | 1104 |
| 203 | Ga0207652_10006427 | 3300025921 | Bacteria | 9475 |
| 204 | Ga0207652_10021225 | 3300025921 | Bacteria | 5359 |
| 205 | Ga0207652_10069815 | 3300025921 | Bacteria | 3050 |
| 206 | Ga0207652_10080801 | 3300025921 | Unclassified | 2843 |
| 207 | Ga0207652_10188799 | 3300025921 | Bacteria | 1853 |
| 208 | Ga0207652_10739555 | 3300025921 | Unclassified | 876 |
| 209 | Ga0207646_10006959 | 3300025922 | Bacteria | 11595 |
| 210 | Ga0207694_10061636 | 3300025924 | Bacteria | 2919 |
| 211 | Ga0207694_10136324 | 3300025924 | Unclassified | 1971 |
| 212 | Ga0207687_10371965 | 3300025927 | Bacteria | 1169 |
| 213 | Ga0207700_10050604 | 3300025928 | Bacteria | 3096 |
| 214 | Ga0207700_10773398 | 3300025928 | Bacteria | 858 |
| 215 | Ga0207664_10024679 | 3300025929 | Bacteria | 4520 |
| 216 | Ga0207664_10032537 | 3300025929 | Bacteria | 3998 |
| 217 | Ga0207664_10059949 | 3300025929 | Bacteria | 3033 |
| 218 | Ga0207664_10127389 | 3300025929 | Unclassified | 2139 |
| 219 | Ga0207664_10292601 | 3300025929 | Bacteria | 1431 |
| 220 | Ga0207664_10306677 | 3300025929 | Bacteria | 1398 |
| 221 | Ga0207664_10414274 | 3300025929 | Bacteria | 1200 |
| 222 | Ga0207664_10522743 | 3300025929 | Bacteria | 1063 |
| 223 | Ga0207644_10195967 | 3300025931 | Bacteria | 1591 |
| 224 | Ga0207690_10099925 | 3300025932 | Unclassified | 2069 |
| 225 | Ga0207690_10166319 | 3300025932 | Unclassified | 1648 |
| 226 | Ga0207690_10314237 | 3300025932 | Bacteria | 1230 |
| 227 | Ga0207690_10451338 | 3300025932 | Bacteria | 1033 |
| 228 | Ga0207690_10504610 | 3300025932 | Unclassified | 979 |
| 229 | Ga0207686_10056395 | 3300025934 | Bacteria | 2469 |
| 230 | Ga0207665_10013702 | 3300025939 | Bacteria | 5332 |
| 231 | Ga0207661_10005380 | 3300025944 | Bacteria | 9019 |
| 232 | Ga0207661_10062334 | 3300025944 | Bacteria | 3016 |
| 233 | Ga0207661_10182567 | 3300025944 | Bacteria | 1834 |
| 234 | Ga0207661_10198935 | 3300025944 | Bacteria | 1761 |
| 235 | Ga0207661_10255796 | 3300025944 | Unclassified | 1558 |
| 236 | Ga0207679_10305790 | 3300025945 | Bacteria | 1372 |
| 237 | Ga0207667_10046352 | 3300025949 | Bacteria | 4602 |
| 238 | Ga0207667_10074638 | 3300025949 | Bacteria | 3522 |
| 239 | Ga0207667_10100363 | 3300025949 | Bacteria | 2985 |
| 240 | Ga0207667_10103375 | 3300025949 | Bacteria | 2938 |
| 241 | Ga0207667_10106933 | 3300025949 | Bacteria | 2886 |
| 242 | Ga0207667_10200091 | 3300025949 | Unclassified | 2049 |
| 243 | Ga0207667_10335588 | 3300025949 | Bacteria | 1543 |
| 244 | Ga0207667_10379866 | 3300025949 | Bacteria | 1439 |
| 245 | Ga0207667_10404819 | 3300025949 | Bacteria | 1389 |
| 246 | Ga0207640_10199928 | 3300025981 | Bacteria | 1514 |
| 247 | Ga0207677_10158125 | 3300026023 | Bacteria | 1757 |
| 248 | Ga0207677_10278865 | 3300026023 | Bacteria | 1371 |
| 249 | Ga0207639_10490479 | 3300026041 | Bacteria | 1121 |
| 250 | Ga0207678_10086611 | 3300026067 | Bacteria | 2677 |
| 251 | Ga0207678_10160144 | 3300026067 | Unclassified | 1922 |
| 252 | Ga0207702_10102866 | 3300026078 | Bacteria | 2525 |
| 253 | Ga0207702_10174412 | 3300026078 | Unclassified | 1974 |
| 254 | Ga0207702_10298824 | 3300026078 | Bacteria | 1527 |
| 255 | Ga0207702_10307111 | 3300026078 | Bacteria | 1507 |
| 256 | Ga0207676_10336484 | 3300026095 | Bacteria | 1391 |
| 257 | Ga0207674_10030732 | 3300026116 | Bacteria | 5645 |
| 258 | Ga0207674_10078247 | 3300026116 | Bacteria | 3312 |
| 259 | Ga0207683_10297683 | 3300026121 | Bacteria | 1476 |
| 260 | Ga0207698_10008070 | 3300026142 | Bacteria | 6639 |
| 261 | Ga0207698_10060354 | 3300026142 | Bacteria | 2949 |
| 262 | Ga0207698_10198309 | 3300026142 | Bacteria | 1795 |
| 263 | Ga0265319_1007255 | 3300028563 | Bacteria | 5012 |
| 264 | Ga0265319_1032102 | 3300028563 | Bacteria | 1824 |
| 265 | Ga0265318_10022142 | 3300028577 | Bacteria | 2544 |
| 266 | Ga0265338_10003469 | 3300028800 | Bacteria | 22183 |
| 267 | Ga0265338_10006363 | 3300028800 | Bacteria | 15074 |
| 268 | Ga0265338_10011492 | 3300028800 | Bacteria | 10221 |
| 269 | Ga0265338_10016336 | 3300028800 | Bacteria | 8084 |
| 270 | Ga0265338_10028196 | 3300028800 | Bacteria | 5606 |
| 271 | Ga0265338_10125062 | 3300028800 | Bacteria | 2042 |
| 272 | Ga0265338_10169009 | 3300028800 | Bacteria | 1679 |
| 273 | Ga0265324_10034777 | 3300029957 | Bacteria | 1754 |
| 274 | Ga0265330_10092095 | 3300031235 | Unclassified | 1301 |
| 275 | Ga0265320_10012728 | 3300031240 | Bacteria | 4879 |
| 276 | Ga0265340_10092764 | 3300031247 | Bacteria | 1410 |
| 277 | Ga0265339_10037237 | 3300031249 | Bacteria | 2719 |
| 278 | Ga0265327_10087079 | 3300031251 | Bacteria | 1530 |
| 279 | Ga0265313_10004167 | 3300031595 | Bacteria | 11226 |
| 280 | Ga0307409_100171156 | 3300031995 | Bacteria | 1912 |
| 281 | Ga0307416_100012377 | 3300032002 | Bacteria | 5746 |
| 282 | Ga0307416_100329940 | 3300032002 | Bacteria | 1533 |
| 283 | Ga0307415_100504330 | 3300032126 | Bacteria | 1059 |
| 284 | Ga0373934_0071044 | 3300035086 | Bacteria | 1392 |
| 285 | Ga0373944_0003460 | 3300035089 | Bacteria | 4078 |
| 286 | Ga0373932_0060733 | 3300035112 | Bacteria | 1148 |
| 287 | Ga0373945_0017396 | 3300035116 | Bacteria | 2434 |
| 288 | Ga0373945_0094327 | 3300035116 | Unclassified | 1163 |
| 289 | Ga0373953_0026174 | 3300035117 | Bacteria | 2234 |
| 290 | Ga0373956_0100892 | 3300035119 | Bacteria | 1339 |
| 291 | Ga0373957_0059544 | 3300035120 | Bacteria | 1477 |
| 292 | Ga0373943_0001557 | 3300035170 | Bacteria | 10374 |
| 293 | Ga0373943_0004770 | 3300035170 | Bacteria | 6128 |
| 294 | Ga0373943_0029675 | 3300035170 | Bacteria | 2584 |
| 295 | Ga0373946_0029927 | 3300035171 | Bacteria | 2171 |
| 296 | Ga0373955_0108397 | 3300035172 | Bacteria | 1603 |
| 297 | Ga0373924_0024003 | 3300035410 | Bacteria | 2399 |
| 298 | Ga0373924_0213580 | 3300035410 | Bacteria | 852 |
| 299 | Ga0373931_0025549 | 3300035691 | Bacteria | 3000 |
| 300 | Ga0373935_0018087 | 3300035692 | Bacteria | 4284 |
| 301 | Ga0373927_0028847 | 3300035695 | Bacteria | 3619 |
| 302 | Ga0373927_0076703 | 3300035695 | Bacteria | 2164 |
| 303 | Ga0373933_0074530 | 3300035724 | Bacteria | 2070 |
| 304 | Ga0373947_0000833 | 3300035725 | Bacteria | 18617 |
| 305 | Ga0373947_0001304 | 3300035725 | Bacteria | 15351 |
| 306 | Ga0373947_0004241 | 3300035725 | Bacteria | 8409 |
| 307 | Ga0373937_0001461 | 3300036401 | Bacteria | 19779 |
| 308 | Ga0373937_0016157 | 3300036401 | Bacteria | 6622 |
| 309 | Ga0373937_0751835 | 3300036401 | Bacteria | 922 |
| 310 | Ga0373925_0003428 | 3300037068 | Bacteria | 12278 |
| 311 | Ga0373925_0015724 | 3300037068 | Bacteria | 5477 |
| 312 | Ga0395899_0024329 | 3300037312 | Bacteria | 4579 |
| 313 | Ga0395900_0017016 | 3300037418 | Bacteria | 7421 |
| 314 | Ga0395900_0017733 | 3300037418 | Bacteria | 7265 |
| 315 | Ga0395900_0077576 | 3300037418 | Bacteria | 3413 |
| 316 | Ga0395900_0579189 | 3300037418 | Bacteria | 1064 |
| 317 | Ga0395900_0585131 | 3300037418 | Bacteria | 1058 |
| 318 | Ga0395898_0027463 | 3300037466 | Bacteria | 5712 |
| 319 | Ga0395898_0034193 | 3300037466 | Bacteria | 5068 |
| 320 | Ga0395898_0066172 | 3300037466 | Bacteria | 3502 |
| 321 | Ga0395898_0073578 | 3300037466 | Bacteria | 3301 |
| 322 | Ga0395898_0086574 | 3300037466 | Bacteria | 3019 |
| 323 | Ga0395898_0225352 | 3300037466 | Unclassified | 1788 |
| 324 | Ga0395898_0474683 | 3300037466 | Bacteria | 1190 |
| 325 | Ga0395905_0050603 | 3300037471 | Unclassified | 3892 |
| 326 | Ga0436364_1212053 | 3300037853 | Bacteria | 2039 |
| 327 | Ga0395901_0042245 | 3300038443 | Bacteria | 4726 |
| 328 | Ga0395901_0055019 | 3300038443 | Unclassified | 4137 |
| 329 | Ga0395901_0078826 | 3300038443 | Bacteria | 3440 |
| 330 | Ga0395901_0104986 | 3300038443 | Bacteria | 2965 |
| 331 | Ga0436365_1019739 | 3300039437 | Bacteria | 1923 |
| 332 | Ga0436360_0815520 | 3300039438 | Bacteria | 2284 |
| 333 | Ga0436363_0106831 | 3300039450 | Bacteria | 1104 |
| 334 | Ga0439436_0012362 | 3300041404 | Bacteria | 2592 |
| 335 | Ga0439439_0016008 | 3300041406 | Bacteria | 1834 |
| 336 | Ga0439431_0002269 | 3300041997 | Bacteria | 4241 |
| 337 | Ga0439448_0134255 | 3300042005 | Bacteria | 854 |
| 338 | Ga0439457_042944 | 3300042014 | Bacteria | 1008 |
| 339 | Ga0439446_0002256 | 3300042156 | Bacteria | 4602 |
| 340 | Ga0439434_0007674 | 3300042435 | Bacteria | 3160 |
| 341 | Ga0466969_0000408 | 3300044656 | Bacteria | 23689 |
| 342 | Ga0466969_0070411 | 3300044656 | Bacteria | 1682 |
| 343 | Ga0466972_0013763 | 3300044658 | Bacteria | 4061 |
| 344 | Ga0466965_0004049 | 3300044683 | Bacteria | 6503 |
| 345 | Ga0466966_0004115 | 3300044684 | Bacteria | 9606 |
| 346 | Ga0466966_0056747 | 3300044684 | Bacteria | 2477 |
| 347 | Ga0466966_0107675 | 3300044684 | Bacteria | 1719 |
| 348 | Ga0466966_0260045 | 3300044684 | Bacteria | 1045 |
| 349 | Ga0466966_0292199 | 3300044684 | Bacteria | 980 |
| 350 | Ga0466961_0003343 | 3300044693 | Bacteria | 10009 |
| 351 | Ga0466961_0018160 | 3300044693 | Bacteria | 4523 |
| 352 | Ga0466961_0024084 | 3300044693 | Bacteria | 3917 |
| 353 | Ga0466961_0040880 | 3300044693 | Bacteria | 2972 |
| 354 | Ga0466961_0065232 | 3300044693 | Bacteria | 2313 |
| 355 | Ga0466961_0144466 | 3300044693 | Unclassified | 1488 |
| 356 | Ga0466963_0000752 | 3300044694 | Bacteria | 16002 |
| 357 | Ga0466963_0000760 | 3300044694 | Bacteria | 15952 |
| 358 | Ga0466963_0001436 | 3300044694 | Bacteria | 12827 |
| 359 | Ga0466963_0003818 | 3300044694 | Bacteria | 8685 |
| 360 | Ga0466963_0011658 | 3300044694 | Bacteria | 5355 |
| 361 | Ga0466963_0024964 | 3300044694 | Bacteria | 3807 |
| 362 | Ga0466963_0026442 | 3300044694 | Bacteria | 3711 |
| 363 | Ga0466963_0026995 | 3300044694 | Bacteria | 3673 |
| 364 | Ga0466963_0028399 | 3300044694 | Bacteria | 3591 |
| 365 | Ga0466963_0029963 | 3300044694 | Bacteria | 3507 |
| 366 | Ga0466963_0045069 | 3300044694 | Bacteria | 2904 |
| 367 | Ga0466963_0069877 | 3300044694 | Bacteria | 2361 |
| 368 | Ga0466963_0070413 | 3300044694 | Bacteria | 2352 |
| 369 | Ga0466963_0089111 | 3300044694 | Bacteria | 2098 |
| 370 | Ga0466963_0091966 | 3300044694 | Bacteria | 2067 |
| 371 | Ga0466963_0102932 | 3300044694 | Bacteria | 1956 |
| 372 | Ga0466963_0171660 | 3300044694 | Bacteria | 1512 |
| 373 | Ga0466963_0231732 | 3300044694 | Bacteria | 1294 |
| 374 | Ga0466963_0260560 | 3300044694 | Bacteria | 1217 |
| 375 | Ga0466963_0290401 | 3300044694 | Bacteria | 1149 |
| 376 | Ga0466963_0300212 | 3300044694 | Bacteria | 1129 |
| 377 | Ga0466963_0395449 | 3300044694 | Bacteria | 974 |
| 378 | Ga0466963_0518671 | 3300044694 | Bacteria | 841 |
| 379 | Ga0466964_0000980 | 3300044706 | Bacteria | 9461 |
| 380 | Ga0466964_0001835 | 3300044706 | Bacteria | 7397 |
| 381 | Ga0466964_0004614 | 3300044706 | Bacteria | 5094 |
| 382 | Ga0466964_0019307 | 3300044706 | Bacteria | 2619 |
| 383 | Ga0466964_0021445 | 3300044706 | Bacteria | 2499 |
| 384 | Ga0466964_0055934 | 3300044706 | Bacteria | 1630 |
| 385 | Ga0466964_0068277 | 3300044706 | Bacteria | 1496 |
| 386 | Ga0466964_0144131 | 3300044706 | Bacteria | 1098 |
| 387 | Ga0466971_0000854 | 3300044719 | Bacteria | 12413 |
| 388 | Ga0466971_0006026 | 3300044719 | Bacteria | 5276 |
| 389 | Ga0466971_0010425 | 3300044719 | Bacteria | 4061 |
| 390 | Ga0466971_0053859 | 3300044719 | Unclassified | 1813 |
| 391 | Ga0466971_0100146 | 3300044719 | Bacteria | 1331 |
| 392 | Ga0466971_0100160 | 3300044719 | Bacteria | 1331 |
| 393 | Ga0466971_0120057 | 3300044719 | Bacteria | 1216 |
| 394 | Ga0466968_0013251 | 3300044735 | Bacteria | 3240 |
| 395 | Ga0466968_0033709 | 3300044735 | Bacteria | 2134 |
| 396 | Ga0466968_0078103 | 3300044735 | Bacteria | 1450 |
| 397 | Ga0466968_0185760 | 3300044735 | Bacteria | 968 |
| 398 | Ga0466970_0019344 | 3300044765 | Bacteria | 3529 |
| 399 | Ga0466970_0081194 | 3300044765 | Bacteria | 1753 |
| 400 | Ga0466970_0240313 | 3300044765 | Bacteria | 1013 |
| 401 | Ga0466957_0000320 | 3300044842 | Bacteria | 23320 |
| 402 | Ga0466957_0002697 | 3300044842 | Bacteria | 9597 |
| 403 | Ga0466957_0008188 | 3300044842 | Bacteria | 5935 |
| 404 | Ga0466957_0009467 | 3300044842 | Bacteria | 5562 |
| 405 | Ga0466957_0012058 | 3300044842 | Bacteria | 4997 |
| 406 | Ga0466957_0022846 | 3300044842 | Unclassified | 3693 |
| 407 | Ga0466957_0024673 | 3300044842 | Bacteria | 3560 |
| 408 | Ga0466957_0038706 | 3300044842 | Bacteria | 2874 |
| 409 | Ga0466957_0044447 | 3300044842 | Bacteria | 2691 |
| 410 | Ga0466957_0061912 | 3300044842 | Bacteria | 2298 |
| 411 | Ga0466957_0078882 | 3300044842 | Bacteria | 2048 |
| 412 | Ga0466957_0092865 | 3300044842 | Bacteria | 1893 |
| 413 | Ga0466957_0120781 | 3300044842 | Unclassified | 1670 |
| 414 | Ga0466957_0138165 | 3300044842 | Bacteria | 1568 |
| 415 | Ga0466957_0292194 | 3300044842 | Bacteria | 1093 |
| 416 | Ga0466957_0579880 | 3300044842 | Bacteria | 784 |
| 417 | Ga0466960_0021185 | 3300044901 | Bacteria | 2891 |
| 418 | Ga0466960_0083647 | 3300044901 | Bacteria | 1613 |
| 419 | Ga0466960_0117558 | 3300044901 | Archaea | 1389 |
| 420 | Ga0466960_0365764 | 3300044901 | Unclassified | 825 |
| 421 | Ga0466959_0008653 | 3300045049 | Bacteria | 7204 |
| 422 | Ga0466959_0010156 | 3300045049 | Bacteria | 6718 |
| 423 | Ga0466959_0072562 | 3300045049 | Bacteria | 2491 |
| 424 | Ga0466959_0097887 | 3300045049 | Unclassified | 2102 |
| 425 | Ga0466959_0103272 | 3300045049 | Bacteria | 2039 |
| 426 | Ga0466959_0124651 | 3300045049 | Unclassified | 1829 |
| 427 | Ga0466959_0167630 | 3300045049 | Bacteria | 1541 |
| 428 | Ga0466959_0234981 | 3300045049 | Bacteria | 1268 |
| 429 | Ga0466959_0238662 | 3300045049 | Bacteria | 1256 |
| 430 | Ga0466959_0280720 | 3300045049 | Bacteria | 1143 |
| 431 | Ga0466958_0005130 | 3300045836 | Bacteria | 7002 |
| 432 | Ga0466958_0007009 | 3300045836 | Bacteria | 6165 |
| 433 | Ga0466958_0007207 | 3300045836 | Bacteria | 6097 |
| 434 | Ga0466958_0007488 | 3300045836 | Bacteria | 6008 |
| 435 | Ga0466958_0008663 | 3300045836 | Bacteria | 5649 |
| 436 | Ga0466958_0019258 | 3300045836 | Bacteria | 3972 |
| 437 | Ga0466958_0020596 | 3300045836 | Unclassified | 3848 |
| 438 | Ga0466958_0021364 | 3300045836 | Bacteria | 3781 |
| 439 | Ga0466958_0057855 | 3300045836 | Bacteria | 2356 |
| 440 | Ga0466958_0110090 | 3300045836 | Bacteria | 1719 |
| 441 | Ga0466958_0117160 | 3300045836 | Bacteria | 1665 |
| 442 | Ga0466958_0206714 | 3300045836 | Bacteria | 1250 |
| 443 | Ga0466958_0225658 | 3300045836 | Bacteria | 1195 |
| 444 | Ga0466958_0503048 | 3300045836 | Bacteria | 786 |
| 445 | Ga0466967_0001867 | 3300045976 | Bacteria | 12701 |
| 446 | Ga0466967_0006510 | 3300045976 | Bacteria | 8276 |
| 447 | Ga0466967_0008137 | 3300045976 | Bacteria | 7653 |
| 448 | Ga0466967_0012033 | 3300045976 | Bacteria | 6594 |
| 449 | Ga0466967_0014542 | 3300045976 | Bacteria | 6135 |
| 450 | Ga0466967_0016832 | 3300045976 | Bacteria | 5780 |
| 451 | Ga0466967_0019357 | 3300045976 | Bacteria | 5471 |
| 452 | Ga0466967_0020228 | 3300045976 | Bacteria | 5374 |
| 453 | Ga0466967_0031882 | 3300045976 | Bacteria | 4443 |
| 454 | Ga0466967_0039559 | 3300045976 | Bacteria | 4055 |
| 455 | Ga0466967_0043872 | 3300045976 | Bacteria | 3874 |
| 456 | Ga0466967_0058802 | 3300045976 | Bacteria | 3399 |
| 457 | Ga0466967_0059022 | 3300045976 | Bacteria | 3393 |
| 458 | Ga0466967_0062419 | 3300045976 | Bacteria | 3307 |
| 459 | Ga0466967_0063715 | 3300045976 | Bacteria | 3276 |
| 460 | Ga0466967_0089713 | 3300045976 | Bacteria | 2792 |
| 461 | Ga0466967_0105945 | 3300045976 | Bacteria | 2576 |
| 462 | Ga0466967_0123476 | 3300045976 | Bacteria | 2395 |
| 463 | Ga0466967_0132051 | 3300045976 | Bacteria | 2319 |
| 464 | Ga0466967_0158329 | 3300045976 | Bacteria | 2124 |
| 465 | Ga0466967_0160985 | 3300045976 | Unclassified | 2106 |
| 466 | Ga0466967_0187938 | 3300045976 | Bacteria | 1951 |
| 467 | Ga0466967_0194028 | 3300045976 | Bacteria | 1920 |
| 468 | Ga0466967_0304742 | 3300045976 | Bacteria | 1533 |
| 469 | Ga0466967_0435173 | 3300045976 | Bacteria | 1280 |
| 470 | Ga0466967_0439866 | 3300045976 | Unclassified | 1273 |
| 471 | Ga0466967_0483624 | 3300045976 | Bacteria | 1213 |
| 472 | Ga0466967_0488663 | 3300045976 | Bacteria | 1207 |
| 473 | Ga0466967_0508286 | 3300045976 | Bacteria | 1183 |
| 474 | Ga0466967_0709555 | 3300045976 | Bacteria | 996 |
| 475 | Ga0466967_0787632 | 3300045976 | Unclassified | 944 |
| 476 | Ga0466967_0995956 | 3300045976 | Bacteria | 834 |
| 477 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 478 | Ga0495592_0051776 | 3300046454 | Bacteria | 3049 |
| 479 | Ga0495592_0095414 | 3300046454 | Bacteria | 2127 |
| 480 | Ga0495592_0204954 | 3300046454 | Bacteria | 1328 |
| 481 | Ga0495592_0356833 | 3300046454 | Bacteria | 936 |
| 482 | Ga0495629_0000983 | 3300046459 | Bacteria | 22888 |
| 483 | Ga0495629_0015602 | 3300046459 | Bacteria | 5453 |
| 484 | Ga0495629_0068901 | 3300046459 | Bacteria | 2468 |
| 485 | Ga0495629_0083905 | 3300046459 | Bacteria | 2223 |
| 486 | Ga0495629_0115477 | 3300046459 | Bacteria | 1871 |
| 487 | Ga0495629_0237436 | 3300046459 | Bacteria | 1255 |
| 488 | Ga0495641_0000513 | 3300046461 | Bacteria | 32468 |
| 489 | Ga0495641_0001416 | 3300046461 | Bacteria | 20387 |
| 490 | Ga0495641_0003996 | 3300046461 | Bacteria | 10695 |
| 491 | Ga0495641_0037441 | 3300046461 | Bacteria | 2273 |
| 492 | Ga0495641_0081260 | 3300046461 | Bacteria | 1452 |
| 493 | Ga0495641_0213863 | 3300046461 | Bacteria | 864 |
| 494 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 495 | Ga0495651_0032397 | 3300046462 | Bacteria | 4076 |
| 496 | Ga0495651_0072171 | 3300046462 | Bacteria | 2623 |
| 497 | Ga0495651_0085130 | 3300046462 | Bacteria | 2381 |
| 498 | Ga0495651_0092323 | 3300046462 | Bacteria | 2268 |
| 499 | Ga0495651_0252547 | 3300046462 | Bacteria | 1203 |
| 500 | Ga0495651_0454664 | 3300046462 | Bacteria | 827 |
| 501 | Ga0495653_0000489 | 3300046463 | Bacteria | 30700 |
| 502 | Ga0495653_0037793 | 3300046463 | Bacteria | 3790 |
| 503 | Ga0495653_0039324 | 3300046463 | Bacteria | 3706 |
| 504 | Ga0495653_0063593 | 3300046463 | Bacteria | 2784 |
| 505 | Ga0495653_0074201 | 3300046463 | Bacteria | 2535 |
| 506 | Ga0495653_0081218 | 3300046463 | Unclassified | 2396 |
| 507 | Ga0495653_0097382 | 3300046463 | Bacteria | 2137 |
| 508 | Ga0495653_0098842 | 3300046463 | Bacteria | 2118 |
| 509 | Ga0495653_0115516 | 3300046463 | Bacteria | 1921 |
| 510 | Ga0495580_0130815 | 3300046472 | Bacteria | 1741 |
| 511 | Ga0495582_0000553 | 3300046473 | Bacteria | 20635 |
| 512 | Ga0495582_0047087 | 3300046473 | Bacteria | 2374 |
| 513 | Ga0495605_0038854 | 3300046474 | Unclassified | 2386 |
| 514 | Ga0495639_0000180 | 3300046475 | Bacteria | 33280 |
| 515 | Ga0495639_0009403 | 3300046475 | Bacteria | 4192 |
| 516 | Ga0495639_0074972 | 3300046475 | Bacteria | 1568 |
| 517 | Ga0495662_0003722 | 3300046476 | Bacteria | 7680 |
| 518 | Ga0495662_0007890 | 3300046476 | Bacteria | 5240 |
| 519 | Ga0495662_0138274 | 3300046476 | Bacteria | 1198 |
| 520 | Ga0495664_0016483 | 3300046477 | Bacteria | 4211 |
| 521 | Ga0495664_0081742 | 3300046477 | Bacteria | 1937 |
| 522 | Ga0495664_0087336 | 3300046477 | Bacteria | 1873 |
| 523 | Ga0495664_0102766 | 3300046477 | Bacteria | 1722 |
| 524 | Ga0495664_0106459 | 3300046477 | Bacteria | 1691 |
| 525 | Ga0495664_0161528 | 3300046477 | Bacteria | 1359 |
| 526 | Ga0495585_0033720 | 3300046492 | Bacteria | 2897 |
| 527 | Ga0495594_0020401 | 3300046499 | Bacteria | 3530 |
| 528 | Ga0495607_0010453 | 3300046501 | Bacteria | 6239 |
| 529 | Ga0495608_0003026 | 3300046511 | Bacteria | 11997 |
| 530 | Ga0495608_0005307 | 3300046511 | Bacteria | 9210 |
| 531 | Ga0495608_0019694 | 3300046511 | Bacteria | 4642 |
| 532 | Ga0495608_0023644 | 3300046511 | Bacteria | 4209 |
| 533 | Ga0495608_0118017 | 3300046511 | Unclassified | 1702 |
| 534 | Ga0495608_0132207 | 3300046511 | Bacteria | 1596 |
| 535 | Ga0495608_0190255 | 3300046511 | Bacteria | 1296 |
| 536 | Ga0495618_0006054 | 3300046514 | Bacteria | 7342 |
| 537 | Ga0495618_0024890 | 3300046514 | Bacteria | 3711 |
| 538 | Ga0495618_0160286 | 3300046514 | Bacteria | 1434 |
| 539 | Ga0495618_0161319 | 3300046514 | Bacteria | 1429 |
| 540 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 541 | Ga0495628_0004120 | 3300046516 | Bacteria | 12929 |
| 542 | Ga0495628_0109524 | 3300046516 | Bacteria | 2125 |
| 543 | Ga0495630_0012886 | 3300046517 | Bacteria | 6074 |
| 544 | Ga0495630_0014969 | 3300046517 | Bacteria | 5657 |
| 545 | Ga0495630_0017466 | 3300046517 | Bacteria | 5257 |
| 546 | Ga0495630_0018842 | 3300046517 | Bacteria | 5072 |
| 547 | Ga0495630_0041071 | 3300046517 | Bacteria | 3455 |
| 548 | Ga0495631_0079527 | 3300046518 | Bacteria | 1415 |
| 549 | Ga0495644_0001562 | 3300046523 | Bacteria | 9331 |
| 550 | Ga0495644_0078043 | 3300046523 | Bacteria | 1248 |
| 551 | Ga0495663_0007171 | 3300046525 | Bacteria | 3077 |
| 552 | Ga0495666_0003590 | 3300046526 | Bacteria | 7844 |
| 553 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 554 | Ga0495652_0103308 | 3300046529 | Bacteria | 2307 |
| 555 | Ga0495652_0112881 | 3300046529 | Bacteria | 2182 |
| 556 | Ga0495652_0149532 | 3300046529 | Bacteria | 1826 |
| 557 | Ga0495652_0290800 | 3300046529 | Bacteria | 1192 |
| 558 | Ga0495665_0005465 | 3300046531 | Bacteria | 6844 |
| 559 | Ga0495665_0037122 | 3300046531 | Bacteria | 2600 |
| 560 | Ga0495640_0004584 | 3300046533 | Bacteria | 11021 |
| 561 | Ga0495640_0074153 | 3300046533 | Bacteria | 2276 |
| 562 | Ga0495640_0074625 | 3300046533 | Bacteria | 2267 |
| 563 | Ga0495640_0077028 | 3300046533 | Bacteria | 2224 |
| 564 | Ga0495640_0089388 | 3300046533 | Bacteria | 2034 |
| 565 | Ga0495640_0099037 | 3300046533 | Bacteria | 1915 |
| 566 | Ga0495640_0131827 | 3300046533 | Bacteria | 1617 |
| 567 | Ga0495640_0153882 | 3300046533 | Bacteria | 1476 |
| 568 | Ga0495586_0042294 | 3300046535 | Bacteria | 2454 |
| 569 | Ga0495586_0162558 | 3300046535 | Bacteria | 1259 |
| 570 | Ga0495587_0000362 | 3300046536 | Bacteria | 32677 |
| 571 | Ga0495587_0011402 | 3300046536 | Bacteria | 5635 |
| 572 | Ga0495587_0016541 | 3300046536 | Bacteria | 4587 |
| 573 | Ga0495587_0029918 | 3300046536 | Bacteria | 3304 |
| 574 | Ga0495587_0153553 | 3300046536 | Bacteria | 1312 |
| 575 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 576 | Ga0495645_0037319 | 3300046543 | Bacteria | 3541 |
| 577 | Ga0495645_0040045 | 3300046543 | Bacteria | 3418 |
| 578 | Ga0495645_0077748 | 3300046543 | Bacteria | 2385 |
| 579 | Ga0495645_0228406 | 3300046543 | Bacteria | 1248 |
| 580 | Ga0495633_0117738 | 3300046558 | Bacteria | 1231 |
| 581 | Ga0495667_0001379 | 3300046559 | Bacteria | 15997 |
| 582 | Ga0495667_0028440 | 3300046559 | Bacteria | 3764 |
| 583 | Ga0495667_0035465 | 3300046559 | Bacteria | 3333 |
| 584 | Ga0495667_0043945 | 3300046559 | Bacteria | 2959 |
| 585 | Ga0495667_0059847 | 3300046559 | Bacteria | 2499 |
| 586 | Ga0495656_0013463 | 3300046615 | Bacteria | 3045 |
| 587 | Ga0495634_0015592 | 3300046642 | Bacteria | 5454 |
| 588 | Ga0495634_0043668 | 3300046642 | Bacteria | 3037 |
| 589 | Ga0495634_0084951 | 3300046642 | Bacteria | 2063 |
| 590 | Ga0495634_0109796 | 3300046642 | Bacteria | 1774 |
| 591 | Ga0495634_0217356 | 3300046642 | Bacteria | 1181 |
| 592 | Ga0495611_0043473 | 3300046648 | Bacteria | 2009 |
| 593 | Ga0495635_0043056 | 3300046663 | Bacteria | 3116 |
| 594 | Ga0495635_0050451 | 3300046663 | Bacteria | 2868 |
| 595 | Ga0495635_0050772 | 3300046663 | Bacteria | 2858 |
| 596 | Ga0495635_0072500 | 3300046663 | Unclassified | 2359 |
| 597 | Ga0495635_0128518 | 3300046663 | Bacteria | 1727 |
| 598 | Ga0495657_0002580 | 3300046675 | Bacteria | 15174 |
| 599 | Ga0495657_0019102 | 3300046675 | Bacteria | 4950 |
| 600 | Ga0495657_0020642 | 3300046675 | Bacteria | 4735 |
| 601 | Ga0495657_0022694 | 3300046675 | Bacteria | 4491 |
| 602 | Ga0495657_0118320 | 3300046675 | Unclassified | 1671 |
| 603 | Ga0495657_0127897 | 3300046675 | Bacteria | 1594 |
| 604 | Ga0495657_0179976 | 3300046675 | Bacteria | 1298 |
| 605 | Ga0495657_0208544 | 3300046675 | Bacteria | 1188 |
| 606 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 607 | Ga0495599_0054948 | 3300046678 | Bacteria | 2494 |
| 608 | Ga0495599_0109699 | 3300046678 | Bacteria | 1719 |
| 609 | Ga0495599_0242133 | 3300046678 | Bacteria | 1099 |
| 610 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 611 | Ga0495623_0015074 | 3300046679 | Bacteria | 4998 |
| 612 | Ga0495623_0056966 | 3300046679 | Bacteria | 2459 |
| 613 | Ga0495623_0208768 | 3300046679 | Unclassified | 1119 |
| 614 | Ga0495646_0003505 | 3300046680 | Bacteria | 9770 |
| 615 | Ga0495646_0035631 | 3300046680 | Bacteria | 3086 |
| 616 | Ga0495646_0079924 | 3300046680 | Bacteria | 1908 |
| 617 | Ga0495646_0112795 | 3300046680 | Bacteria | 1546 |
| 618 | Ga0495647_0001779 | 3300046681 | Bacteria | 6684 |
| 619 | Ga0495647_0007902 | 3300046681 | Bacteria | 3573 |
| 620 | Ga0495647_0010520 | 3300046681 | Bacteria | 3152 |
| 621 | Ga0495658_0001696 | 3300046683 | Bacteria | 11445 |
| 622 | Ga0495658_0002075 | 3300046683 | Bacteria | 10156 |
| 623 | Ga0495658_0116693 | 3300046683 | Bacteria | 1610 |
| 624 | Ga0495658_0199545 | 3300046683 | Bacteria | 1246 |
| 625 | Ga0495613_0010668 | 3300046689 | Bacteria | 6816 |
| 626 | Ga0495613_0020063 | 3300046689 | Bacteria | 4980 |
| 627 | Ga0495613_0026728 | 3300046689 | Bacteria | 4298 |
| 628 | Ga0495613_0028638 | 3300046689 | Bacteria | 4143 |
| 629 | Ga0495613_0285032 | 3300046689 | Bacteria | 1146 |
| 630 | Ga0495613_0350131 | 3300046689 | Bacteria | 1014 |
| 631 | Ga0495624_0002088 | 3300046690 | Bacteria | 15229 |
| 632 | Ga0495624_0003996 | 3300046690 | Bacteria | 10855 |
| 633 | Ga0495624_0007147 | 3300046690 | Bacteria | 7857 |
| 634 | Ga0495624_0038068 | 3300046690 | Bacteria | 3092 |
| 635 | Ga0495670_0075765 | 3300046691 | Bacteria | 1708 |
| 636 | Ga0495589_0124947 | 3300046794 | Bacteria | 1237 |
| 637 | Ga0495600_0011642 | 3300046809 | Bacteria | 5486 |
| 638 | Ga0495600_0020552 | 3300046809 | Bacteria | 4221 |
| 639 | Ga0495600_0061348 | 3300046809 | Bacteria | 2456 |
| 640 | Ga0495600_0065733 | 3300046809 | Bacteria | 2371 |
| 641 | Ga0495600_0072025 | 3300046809 | Unclassified | 2258 |
| 642 | Ga0495600_0112341 | 3300046809 | Bacteria | 1774 |
| 643 | Ga0495581_0001833 | 3300047315 | Bacteria | 11890 |
| 644 | Ga0495581_0011060 | 3300047315 | Bacteria | 5214 |
| 645 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 646 | Ga0495604_0064863 | 3300047317 | Bacteria | 2782 |
| 647 | Ga0495604_0066552 | 3300047317 | Bacteria | 2740 |
| 648 | Ga0495604_0085022 | 3300047317 | Bacteria | 2361 |
| 649 | Ga0495604_0151265 | 3300047317 | Bacteria | 1649 |
| 650 | Ga0495604_0460514 | 3300047317 | Bacteria | 830 |
| 651 | Ga0495674_0003155 | 3300047319 | Bacteria | 16010 |
| 652 | Ga0495674_0030477 | 3300047319 | Bacteria | 4905 |
| 653 | Ga0495674_0049237 | 3300047319 | Bacteria | 3724 |
| 654 | Ga0495674_0073031 | 3300047319 | Bacteria | 2958 |
| 655 | Ga0495674_0118262 | 3300047319 | Bacteria | 2241 |
| 656 | Ga0495674_0377983 | 3300047319 | Bacteria | 1146 |
| 657 | Ga0495674_0410920 | 3300047319 | Bacteria | 1091 |
| 658 | Ga0495676_0000766 | 3300047321 | Bacteria | 26783 |
| 659 | Ga0495676_0002145 | 3300047321 | Bacteria | 17448 |
| 660 | Ga0495676_0042185 | 3300047321 | Bacteria | 3748 |
| 661 | Ga0495676_0079435 | 3300047321 | Bacteria | 2494 |
| 662 | Ga0495676_0238259 | 3300047321 | Bacteria | 1247 |
| 663 | Ga0495680_0004330 | 3300047322 | Bacteria | 13597 |
| 664 | Ga0495680_0007287 | 3300047322 | Bacteria | 10179 |
| 665 | Ga0495680_0009072 | 3300047322 | Bacteria | 8980 |
| 666 | Ga0495680_0019817 | 3300047322 | Bacteria | 5672 |
| 667 | Ga0495680_0049855 | 3300047322 | Bacteria | 3276 |
| 668 | Ga0495680_0057886 | 3300047322 | Bacteria | 2996 |
| 669 | Ga0495680_0494077 | 3300047322 | Bacteria | 831 |
| 670 | Ga0495675_0000079 | 3300047444 | Bacteria | 68947 |
| 671 | Ga0495675_0186381 | 3300047444 | Bacteria | 1268 |
| 672 | Ga0495677_0034607 | 3300047445 | Bacteria | 1843 |
| 673 | Ga0495679_065949 | 3300047446 | Bacteria | 1052 |
| 674 | Ga0495684_0008848 | 3300047471 | Bacteria | 7780 |
| 675 | Ga0495684_0021761 | 3300047471 | Bacteria | 4936 |
| 676 | Ga0495684_0029722 | 3300047471 | Bacteria | 4193 |
| 677 | Ga0495684_0050341 | 3300047471 | Bacteria | 3181 |
| 678 | Ga0495684_0060358 | 3300047471 | Bacteria | 2887 |
| 679 | Ga0495684_0069180 | 3300047471 | Bacteria | 2684 |
| 680 | Ga0495684_0122612 | 3300047471 | Bacteria | 1956 |
| 681 | Ga0495684_0151204 | 3300047471 | Bacteria | 1735 |
| 682 | Ga0495684_0221950 | 3300047471 | Bacteria | 1385 |
| 683 | Ga0495593_0000866 | 3300047673 | Bacteria | 17530 |
| 684 | Ga0495593_0009203 | 3300047673 | Bacteria | 5726 |
| 685 | Ga0495593_0210671 | 3300047673 | Bacteria | 976 |
| 686 | Ga0495602_0000351 | 3300048088 | Bacteria | 42756 |
| 687 | Ga0495602_0087729 | 3300048088 | Bacteria | 2592 |
| 688 | Ga0495602_0130295 | 3300048088 | Bacteria | 2007 |
| 689 | Ga0495614_0000786 | 3300048089 | Bacteria | 13431 |
| 690 | Ga0495614_0057148 | 3300048089 | Bacteria | 1675 |
| 691 | Ga0496100_0005276 | 3300048903 | Bacteria | 6943 |
| 692 | Ga0496100_0011540 | 3300048903 | Bacteria | 5032 |
| 693 | Ga0496100_0038534 | 3300048903 | Bacteria | 3029 |
| 694 | Ga0496100_0087188 | 3300048903 | Bacteria | 2122 |
| 695 | Ga0496100_0096497 | 3300048903 | Bacteria | 2028 |
| 696 | Ga0496100_0126495 | 3300048903 | Bacteria | 1794 |
| 697 | Ga0496101_0001389 | 3300048904 | Bacteria | 14495 |
| 698 | Ga0496101_0007270 | 3300048904 | Bacteria | 7166 |
| 699 | Ga0496101_0012442 | 3300048904 | Bacteria | 5679 |
| 700 | Ga0496101_0016057 | 3300048904 | Bacteria | 5054 |
| 701 | Ga0496101_0017035 | 3300048904 | Bacteria | 4921 |
| 702 | Ga0496101_0017364 | 3300048904 | Bacteria | 4883 |
| 703 | Ga0496101_0082091 | 3300048904 | Bacteria | 2385 |
| 704 | Ga0496101_0352107 | 3300048904 | Bacteria | 1157 |
| 705 | Ga0496102_0006447 | 3300048905 | Bacteria | 10007 |
| 706 | Ga0496102_0056517 | 3300048905 | Bacteria | 3580 |
| 707 | Ga0496102_0152218 | 3300048905 | Unclassified | 2174 |
| 708 | Ga0496102_0232278 | 3300048905 | Bacteria | 1739 |
| 709 | Ga0496103_0048062 | 3300048906 | Bacteria | 2636 |
| 710 | Ga0496103_0062247 | 3300048906 | Bacteria | 2322 |
| 711 | Ga0496104_0008448 | 3300048907 | Bacteria | 9155 |
| 712 | Ga0496104_0024421 | 3300048907 | Bacteria | 5558 |
| 713 | Ga0496104_0189543 | 3300048907 | Bacteria | 1967 |
| 714 | Ga0496104_0274881 | 3300048907 | Bacteria | 1597 |
| 715 | Ga0496104_0617315 | 3300048907 | Bacteria | 994 |
| 716 | Ga0496105_0050926 | 3300048908 | Bacteria | 3421 |
| 717 | Ga0496105_0094856 | 3300048908 | Bacteria | 2464 |
| 718 | Ga0496106_0014533 | 3300048909 | Bacteria | 5816 |
| 719 | Ga0496106_0111042 | 3300048909 | Bacteria | 2134 |
| 720 | Ga0496106_0230326 | 3300048909 | Unclassified | 1479 |
| 721 | Ga0496107_0001958 | 3300048910 | Bacteria | 13084 |
| 722 | Ga0496107_0084235 | 3300048910 | Bacteria | 2319 |
| 723 | Ga0496107_0142804 | 3300048910 | Bacteria | 1770 |
| 724 | Ga0496108_0004497 | 3300048911 | Bacteria | 11232 |
| 725 | Ga0496108_0128035 | 3300048911 | Bacteria | 2181 |
| 726 | Ga0496108_0158050 | 3300048911 | Bacteria | 1958 |
| 727 | Ga0496109_0030256 | 3300048912 | Bacteria | 4853 |
| 728 | Ga0496109_0033699 | 3300048912 | Bacteria | 4608 |
| 729 | Ga0496109_0108207 | 3300048912 | Bacteria | 2583 |
| 730 | Ga0496109_0170395 | 3300048912 | Bacteria | 2042 |
| 731 | Ga0496109_0222574 | 3300048912 | Bacteria | 1775 |
| 732 | Ga0496109_0240833 | 3300048912 | Bacteria | 1702 |
| 733 | Ga0496109_0294785 | 3300048912 | Bacteria | 1529 |
| 734 | Ga0496109_0386951 | 3300048912 | Bacteria | 1321 |
| 735 | Ga0496110_0021361 | 3300048913 | Archaea | 5478 |
| 736 | Ga0496110_0476628 | 3300048913 | Bacteria | 1137 |
| 737 | Ga0496111_0404952 | 3300048914 | Bacteria | 1008 |
| 738 | Ga0496111_0428045 | 3300048914 | Bacteria | 977 |
| 739 | Ga0496112_0020392 | 3300048915 | Bacteria | 6283 |
| 740 | Ga0496112_0028531 | 3300048915 | Bacteria | 5387 |
| 741 | Ga0496112_0032281 | 3300048915 | Bacteria | 5083 |
| 742 | Ga0496112_0121171 | 3300048915 | Bacteria | 2585 |
| 743 | Ga0496112_0126419 | 3300048915 | Bacteria | 2527 |
| 744 | Ga0496112_0155078 | 3300048915 | Bacteria | 2257 |
| 745 | Ga0496112_0309171 | 3300048915 | Bacteria | 1526 |
| 746 | Ga0496112_0601598 | 3300048915 | Bacteria | 1031 |
| 747 | Ga0496113_0108856 | 3300048916 | Bacteria | 2154 |
| 748 | Ga0496114_0004690 | 3300048917 | Bacteria | 10629 |
| 749 | Ga0496114_0004918 | 3300048917 | Bacteria | 10410 |
| 750 | Ga0496114_0010417 | 3300048917 | Bacteria | 7395 |
| 751 | Ga0496114_0011796 | 3300048917 | Bacteria | 6992 |
| 752 | Ga0496114_0013266 | 3300048917 | Bacteria | 6606 |
| 753 | Ga0496114_0043657 | 3300048917 | Bacteria | 3717 |
| 754 | Ga0496114_0058192 | 3300048917 | Bacteria | 3227 |
| 755 | Ga0496114_0093644 | 3300048917 | Bacteria | 2555 |
| 756 | Ga0496114_0104845 | 3300048917 | Bacteria | 2418 |
| 757 | Ga0496115_0004959 | 3300048918 | Bacteria | 9670 |
| 758 | Ga0496115_0046844 | 3300048918 | Bacteria | 3457 |
| 759 | Ga0496115_0101763 | 3300048918 | Bacteria | 2356 |
| 760 | Ga0496115_0172135 | 3300048918 | Bacteria | 1790 |
| 761 | Ga0496115_0230547 | 3300048918 | Bacteria | 1527 |
| 762 | Ga0496115_0381820 | 3300048918 | Bacteria | 1145 |
| 763 | Ga0496115_0485199 | 3300048918 | Bacteria | 995 |
| 764 | Ga0501034_0005913 | 3300049571 | Bacteria | 13279 |
| 765 | Ga0501043_0344566 | 3300049579 | Unclassified | 1133 |
| 766 | Ga0501043_0390358 | 3300049579 | Bacteria | 1053 |
| 767 | Ga0501047_0349098 | 3300049581 | Bacteria | 1316 |
| 768 | Ga0501067_0007804 | 3300049583 | Bacteria | 5951 |
| 769 | Ga0501067_0016686 | 3300049583 | Bacteria | 4058 |
| 770 | Ga0501067_0081102 | 3300049583 | Unclassified | 1798 |
| 771 | Ga0501067_0092265 | 3300049583 | Bacteria | 1681 |
| 772 | Ga0501067_0221090 | 3300049583 | Unclassified | 1055 |
| 773 | Ga0501068_0023828 | 3300049584 | Unclassified | 3590 |
| 774 | Ga0501068_0042839 | 3300049584 | Unclassified | 2722 |
| 775 | Ga0501069_0025485 | 3300049585 | Bacteria | 3233 |
| 776 | Ga0501069_0026029 | 3300049585 | Bacteria | 3203 |
| 777 | Ga0501069_0030717 | 3300049585 | Bacteria | 2952 |
| 778 | Ga0501069_0037271 | 3300049585 | Unclassified | 2683 |
| 779 | Ga0501069_0071001 | 3300049585 | Bacteria | 1951 |
| 780 | Ga0501070_0000932 | 3300049586 | Bacteria | 26359 |
| 781 | Ga0501070_0002071 | 3300049586 | Bacteria | 17606 |
| 782 | Ga0501070_0006123 | 3300049586 | Bacteria | 10253 |
| 783 | Ga0501070_0030930 | 3300049586 | Bacteria | 4484 |
| 784 | Ga0501070_0240218 | 3300049586 | Bacteria | 1483 |
| 785 | Ga0501072_0035119 | 3300049588 | Bacteria | 3929 |
| 786 | Ga0501072_0149971 | 3300049588 | Bacteria | 1859 |
| 787 | Ga0501073_0010184 | 3300049589 | Bacteria | 6906 |
| 788 | Ga0501074_0008573 | 3300049590 | Bacteria | 7406 |
| 789 | Ga0501080_0025463 | 3300049742 | Bacteria | 5491 |
| 790 | Ga0501080_0122183 | 3300049742 | Bacteria | 2412 |
| 791 | Ga0501080_0129241 | 3300049742 | Unclassified | 2338 |
| 792 | Ga0501080_0198548 | 3300049742 | Bacteria | 1842 |
| 793 | Ga0501080_0311115 | 3300049742 | Bacteria | 1427 |
| 794 | Ga0501083_0198588 | 3300049744 | Bacteria | 1308 |
| 795 | Ga0501035_0209986 | 3300049822 | Bacteria | 1666 |
| 796 | Ga0501044_0246295 | 3300049823 | Bacteria | 1730 |
| 797 | Ga0501044_0337246 | 3300049823 | Bacteria | 1429 |
| 798 | nmdc:mga05p37_55864_c1 | 3300050507 | Bacteria | 4860 |
| 799 | nmdc:mga08y16_309851_c1 | 3300050511 | Bacteria | 1626 |
| 800 | nmdc:mga0n895_19278_c1 | 3300050512 | Bacteria | 6336 |
| 801 | nmdc:mga0n895_3110_c1 | 3300050512 | Bacteria | 13221 |
| 802 | nmdc:mga0n895_88907_c1 | 3300050512 | Bacteria | 3089 |
| 803 | nmdc:mga08x19_246610_c1 | 3300050514 | Bacteria | 1232 |
| 804 | nmdc:mga08x19_450061_c1 | 3300050514 | Unclassified | 906 |
| 805 | nmdc:mga0a205_61564_c1 | 3300050515 | Bacteria | 3625 |
| 806 | Ga0495601_0000896 | 3300053077 | Bacteria | 16243 |
| 807 | Ga0495601_0041360 | 3300053077 | Bacteria | 2889 |
| 808 | Ga0495601_0070231 | 3300053077 | Bacteria | 2235 |
| 809 | Ga0495601_0076899 | 3300053077 | Bacteria | 2137 |
| 810 | Ga0495601_0105556 | 3300053077 | Bacteria | 1821 |
| 811 | Ga0495601_0130433 | 3300053077 | Bacteria | 1637 |
| 812 | Ga0495601_0169850 | 3300053077 | Bacteria | 1425 |
| 813 | Ga0495612_0002591 | 3300053078 | Bacteria | 7456 |
| 814 | Ga0495612_0003142 | 3300053078 | Bacteria | 6841 |
| 815 | Ga0495612_0151572 | 3300053078 | Bacteria | 1009 |
| 816 | Ga0495595_0010349 | 3300053084 | Bacteria | 3874 |
| 817 | Ga0495595_0013489 | 3300053084 | Bacteria | 3452 |
| 818 | Ga0495595_0022850 | 3300053084 | Bacteria | 2748 |
| 819 | Ga0495595_0260290 | 3300053084 | Bacteria | 869 |
| 820 | Ga0495619_0006645 | 3300053085 | Bacteria | 7320 |
| 821 | Ga0495619_0010604 | 3300053085 | Bacteria | 5797 |
| 822 | Ga0495619_0011265 | 3300053085 | Bacteria | 5625 |
| 823 | Ga0495619_0018172 | 3300053085 | Bacteria | 4459 |
| 824 | Ga0495619_0055610 | 3300053085 | Bacteria | 2621 |
| 825 | Ga0495619_0163991 | 3300053085 | Bacteria | 1535 |
| 826 | Ga0466962_0000230 | 3300061719 | Bacteria | 23282 |
| 827 | Ga0466962_0000378 | 3300061719 | Bacteria | 19231 |
| 828 | Ga0466962_0005450 | 3300061719 | Bacteria | 6114 |
| 829 | Ga0466962_0017794 | 3300061719 | Bacteria | 3421 |
| 830 | Ga0466962_0043693 | 3300061719 | Bacteria | 2144 |
| 831 | Ga0466962_0064658 | 3300061719 | Bacteria | 1746 |
| 832 | Ga0466962_0082666 | 3300061719 | Bacteria | 1536 |
| 833 | Ga0530510_0102195 | 3300061734 | Unclassified | 2096 |
| 834 | Ga0530510_0570723 | 3300061734 | Unclassified | 860 |
| 835 | Ga0395900_0442980 | |||
| 836 | Ga0070658_10007803 | |||
| 837 | Ga0070658_10015001 | |||
| 838 | Ga0070658_10017256 | |||
| 839 | Ga0070658_10142602 | |||
| 840 | Ga0070658_10201183 | |||
| 841 | Ga0070658_10247057 | |||
| 842 | Ga0070683_100029811 | |||
| 843 | Ga0070683_100097492 | |||
| 844 | Ga0070683_100181009 | |||
| 845 | Ga0070683_100298884 | |||
| 846 | Ga0070680_100012026 | |||
| 847 | Ga0070680_100024864 | |||
| 848 | Ga0070680_100048592 | |||
| 849 | Ga0070680_100516351 | |||
| 850 | Ga0070682_100100957 | |||
| 851 | Ga0070682_100231633 | |||
| 852 | Ga0070660_100033559 | |||
| 853 | Ga0070660_100045246 | |||
| 854 | Ga0070660_100071914 | |||
| 855 | Ga0070660_100097205 | |||
| 856 | Ga0070660_100206388 | |||
| 857 | Ga0070660_100495756 | |||
| 858 | Ga0070691_10056721 | |||
| 859 | Ga0070661_100006585 | |||
| 860 | Ga0070661_100041553 | |||
| 861 | Ga0070661_100097230 | |||
| 862 | Ga0070661_100108232 | |||
| 863 | Ga0070661_100116470 | |||
| 864 | Ga0070661_100405963 | |||
| 865 | Ga0070692_10100763 | |||
| 866 | Ga0070659_100079029 | |||
| 867 | Ga0070659_100090667 | |||
| 868 | Ga0070714_100025605 | |||
| 869 | Ga0070714_100032003 | |||
| 870 | Ga0070714_100048415 | |||
| 871 | Ga0070714_100360041 | |||
| 872 | Ga0070714_100423410 | |||
| 873 | Ga0070713_100024280 | |||
| 874 | Ga0070713_100042102 | |||
| 875 | Ga0070713_100511542 | |||
| 876 | Ga0070710_10005611 | |||
| 877 | Ga0070711_100013831 | |||
| 878 | Ga0070711_100019156 | |||
| 879 | Ga0070711_100076504 | |||
| 880 | Ga0070708_100014184 | |||
| 881 | Ga0070663_100094069 | |||
| 882 | Ga0070663_100541784 | |||
| 883 | Ga0070678_100056276 | |||
| 884 | Ga0070662_100615762 | |||
| 885 | Ga0070681_10000749 | |||
| 886 | Ga0070681_10006655 | |||
| 887 | Ga0070681_10008242 | |||
| 888 | Ga0070681_10047094 | |||
| 889 | Ga0070681_10067249 | |||
| 890 | Ga0070681_10093404 | |||
| 891 | Ga0070681_10108465 | |||
| 892 | Ga0070681_10122719 | |||
| 893 | Ga0070681_10187266 | |||
| 894 | Ga0070707_100001944 | |||
| 895 | Ga0070707_100464407 | |||
| 896 | Ga0070698_100037762 | |||
| 897 | Ga0070699_100020721 | |||
| 898 | Ga0070699_100607028 | |||
| 899 | Ga0070679_100015385 | |||
| 900 | Ga0070679_100049409 | |||
| 901 | Ga0070679_100053394 | |||
| 902 | Ga0070679_100067376 | |||
| 903 | Ga0070679_100075416 | |||
| 904 | Ga0070679_100089663 | |||
| 905 | Ga0070679_100102155 | |||
| 906 | Ga0070679_100186474 | |||
| 907 | Ga0070679_100780560 | |||
| 908 | Ga0070684_100005027 | |||
| 909 | Ga0070684_100017563 | |||
| 910 | Ga0068853_100114568 | |||
| 911 | Ga0068853_100393157 | |||
| 912 | Ga0070695_100001116 | |||
| 913 | Ga0070695_100262849 | |||
| 914 | Ga0070665_100177084 | |||
| 915 | Ga0070704_100236813 | |||
| 916 | Ga0068855_100019092 | |||
| 917 | Ga0068855_100032562 | |||
| 918 | Ga0068855_100045854 | |||
| 919 | Ga0068855_100050832 | |||
| 920 | Ga0068855_100080104 | |||
| 921 | Ga0068855_100397134 | |||
| 922 | Ga0068857_100607164 | |||
| 923 | Ga0068854_100717078 | |||
| 924 | Ga0068856_100028398 | |||
| 925 | Ga0068856_100048093 | |||
| 926 | Ga0068856_100154480 | |||
| 927 | Ga0068852_100075877 | |||
| 928 | Ga0068864_100336506 | |||
| 929 | Ga0070717_10002024 | |||
| 930 | Ga0070717_10025828 | |||
| 931 | Ga0070717_10048900 | |||
| 932 | Ga0070715_10000285 | |||
| 933 | Ga0070715_10062010 | |||
| 934 | Ga0070716_100011760 | |||
| 935 | Ga0070712_100018785 | |||
| 936 | Ga0070712_100726324 | |||
| 937 | Ga0097621_100681889 | |||
| 938 | Ga0075433_10131136 | |||
| 939 | Ga0075434_100006735 | |||
| 940 | Ga0075434_100052890 | |||
| 941 | Ga0068865_100257097 | |||
| 942 | Ga0075436_100352922 | |||
| 943 | Ga0105240_10004372 | |||
| 944 | Ga0105240_10026508 | |||
| 945 | Ga0105240_10151987 | |||
| 946 | Ga0105240_10189040 | |||
| 947 | Ga0105240_10357338 | |||
| 948 | Ga0105240_10950146 | |||
| 949 | Ga0105245_10210947 | |||
| 950 | Ga0114129_10033307 | |||
| 951 | Ga0105241_10874689 | |||
| 952 | Ga0105242_10036689 | |||
| 953 | Ga0105248_10680605 | |||
| 954 | Ga0105237_10026492 | |||
| 955 | Ga0105237_10032639 | |||
| 956 | Ga0105238_10010250 | |||
| 957 | Ga0105238_10150583 | |||
| 958 | Ga0105239_10934705 | |||
| 959 | Ga0105239_10936412 | |||
| 960 | Ga0157373_10138625 | |||
| 961 | Ga0157370_10015065 | |||
| 962 | Ga0157370_10050383 | |||
| 963 | Ga0157370_10057103 | |||
| 964 | Ga0157370_10066410 | |||
| 965 | Ga0157370_10120191 | |||
| 966 | Ga0157369_10003856 | |||
| 967 | Ga0157369_10040278 | |||
| 968 | Ga0157369_10045651 | |||
| 969 | Ga0157369_10078926 | |||
| 970 | Ga0157369_10106748 | |||
| 971 | Ga0157369_10176982 | |||
| 972 | Ga0157369_10195652 | |||
| 973 | Ga0157369_10320206 | |||
| 974 | Ga0157374_10630269 | |||
| 975 | Ga0157372_10059594 | |||
| 976 | Ga0157372_10085387 | |||
| 977 | Ga0157372_10378585 | |||
| 978 | Ga0157372_10670807 | |||
| 979 | Ga0182008_10027288 | |||
| 980 | Ga0157377_10395737 | |||
| 981 | Ga0157376_10028299 | |||
| 982 | Ga0197907_11375264 | |||
| 983 | Ga0206354_10233267 | |||
| 984 | Ga0206354_10383196 | |||
| 985 | Ga0206354_11613024 | |||
| 986 | Ga0206353_10115099 | |||
| 987 | Ga0206353_11084915 | |||
| 988 | Ga0206353_11117654 | |||
| 989 | Ga0213871_10049500 | |||
| 990 | Ga0207692_10078368 | |||
| 991 | Ga0207685_10059620 | |||
| 992 | Ga0207699_10041401 | |||
| 993 | Ga0207699_10280642 | |||
| 994 | Ga0207705_10017363 | |||
| 995 | Ga0207705_10021630 | |||
| 996 | Ga0207705_10140330 | |||
| 997 | Ga0207654_10042579 | |||
| 998 | Ga0207707_10023124 | |||
| 999 | Ga0207707_10044759 | |||
| 1000 | Ga0207707_10048038 | |||
| 1001 | Ga0207707_10086901 | |||
| 1002 | Ga0207707_10122857 | |||
| 1003 | Ga0207707_10148217 | |||
| 1004 | Ga0207707_10693801 | |||
| 1005 | Ga0207695_10039360 | |||
| 1006 | Ga0207695_10057395 | |||
| 1007 | Ga0207695_10073223 | |||
| 1008 | Ga0207695_10134669 | |||
| 1009 | Ga0207671_10146825 | |||
| 1010 | Ga0207671_10213610 | |||
| 1011 | Ga0207693_10001514 | |||
| 1012 | Ga0207693_10005278 | |||
| 1013 | Ga0207693_10084722 | |||
| 1014 | Ga0207693_10166901 | |||
| 1015 | Ga0207663_10006744 | |||
| 1016 | Ga0207663_10014649 | |||
| 1017 | Ga0207663_10050193 | |||
| 1018 | Ga0207660_10008175 | |||
| 1019 | Ga0207660_10079599 | |||
| 1020 | Ga0207660_10229556 | |||
| 1021 | Ga0207657_10000486 | |||
| 1022 | Ga0207657_10004929 | |||
| 1023 | Ga0207657_10006205 | |||
| 1024 | Ga0207657_10008281 | |||
| 1025 | Ga0207657_10012639 | |||
| 1026 | Ga0207657_10015181 | |||
| 1027 | Ga0207657_10033940 | |||
| 1028 | Ga0207657_10055140 | |||
| 1029 | Ga0207657_10287636 | |||
| 1030 | Ga0207649_10042731 | |||
| 1031 | Ga0207649_10053430 | |||
| 1032 | Ga0207649_10089346 | |||
| 1033 | Ga0207649_10158878 | |||
| 1034 | Ga0207649_10194620 | |||
| 1035 | Ga0207649_10253619 | |||
| 1036 | Ga0207649_10342637 | |||
| 1037 | Ga0207652_10006427 | |||
| 1038 | Ga0207652_10021225 | |||
| 1039 | Ga0207652_10069815 | |||
| 1040 | Ga0207652_10080801 | |||
| 1041 | Ga0207652_10188799 | |||
| 1042 | Ga0207652_10739555 | |||
| 1043 | Ga0207646_10006959 | |||
| 1044 | Ga0207694_10061636 | |||
| 1045 | Ga0207694_10136324 | |||
| 1046 | Ga0207687_10371965 | |||
| 1047 | Ga0207700_10050604 | |||
| 1048 | Ga0207700_10773398 | |||
| 1049 | Ga0207664_10024679 | |||
| 1050 | Ga0207664_10032537 | |||
| 1051 | Ga0207664_10059949 | |||
| 1052 | Ga0207664_10127389 | |||
| 1053 | Ga0207664_10292601 | |||
| 1054 | Ga0207664_10306677 | |||
| 1055 | Ga0207664_10414274 | |||
| 1056 | Ga0207664_10522743 | |||
| 1057 | Ga0207644_10195967 | |||
| 1058 | Ga0207690_10099925 | |||
| 1059 | Ga0207690_10166319 | |||
| 1060 | Ga0207690_10314237 | |||
| 1061 | Ga0207690_10451338 | |||
| 1062 | Ga0207690_10504610 | |||
| 1063 | Ga0207686_10056395 | |||
| 1064 | Ga0207665_10013702 | |||
| 1065 | Ga0207661_10005380 | |||
| 1066 | Ga0207661_10062334 | |||
| 1067 | Ga0207661_10182567 | |||
| 1068 | Ga0207661_10198935 | |||
| 1069 | Ga0207661_10255796 | |||
| 1070 | Ga0207679_10305790 | |||
| 1071 | Ga0207667_10046352 | |||
| 1072 | Ga0207667_10074638 | |||
| 1073 | Ga0207667_10100363 | |||
| 1074 | Ga0207667_10103375 | |||
| 1075 | Ga0207667_10106933 | |||
| 1076 | Ga0207667_10200091 | |||
| 1077 | Ga0207667_10335588 | |||
| 1078 | Ga0207667_10379866 | |||
| 1079 | Ga0207667_10404819 | |||
| 1080 | Ga0207640_10199928 | |||
| 1081 | Ga0207677_10158125 | |||
| 1082 | Ga0207677_10278865 | |||
| 1083 | Ga0207639_10490479 | |||
| 1084 | Ga0207678_10086611 | |||
| 1085 | Ga0207678_10160144 | |||
| 1086 | Ga0207702_10102866 | |||
| 1087 | Ga0207702_10174412 | |||
| 1088 | Ga0207702_10298824 | |||
| 1089 | Ga0207702_10307111 | |||
| 1090 | Ga0207676_10336484 | |||
| 1091 | Ga0207674_10030732 | |||
| 1092 | Ga0207674_10078247 | |||
| 1093 | Ga0207683_10297683 | |||
| 1094 | Ga0207698_10008070 | |||
| 1095 | Ga0207698_10060354 | |||
| 1096 | Ga0207698_10198309 | |||
| 1097 | Ga0265319_1007255 | |||
| 1098 | Ga0265319_1032102 | |||
| 1099 | Ga0265318_10022142 | |||
| 1100 | Ga0265338_10003469 | |||
| 1101 | Ga0265338_10006363 | |||
| 1102 | Ga0265338_10011492 | |||
| 1103 | Ga0265338_10016336 | |||
| 1104 | Ga0265338_10028196 | |||
| 1105 | Ga0265338_10125062 | |||
| 1106 | Ga0265338_10169009 | |||
| 1107 | Ga0265324_10034777 | |||
| 1108 | Ga0265330_10092095 | |||
| 1109 | Ga0265320_10012728 | |||
| 1110 | Ga0265340_10092764 | |||
| 1111 | Ga0265339_10037237 | |||
| 1112 | Ga0265327_10087079 | |||
| 1113 | Ga0265313_10004167 | |||
| 1114 | Ga0307409_100171156 | |||
| 1115 | Ga0307416_100012377 | |||
| 1116 | Ga0307416_100329940 | |||
| 1117 | Ga0307415_100504330 | |||
| 1118 | Ga0373934_0071044 | |||
| 1119 | Ga0373944_0003460 | |||
| 1120 | Ga0373932_0060733 | |||
| 1121 | Ga0373945_0017396 | |||
| 1122 | Ga0373945_0094327 | |||
| 1123 | Ga0373953_0026174 | |||
| 1124 | Ga0373956_0100892 | |||
| 1125 | Ga0373957_0059544 | |||
| 1126 | Ga0373943_0001557 | |||
| 1127 | Ga0373943_0004770 | |||
| 1128 | Ga0373943_0029675 | |||
| 1129 | Ga0373946_0029927 | |||
| 1130 | Ga0373955_0108397 | |||
| 1131 | Ga0373924_0024003 | |||
| 1132 | Ga0373924_0213580 | |||
| 1133 | Ga0373931_0025549 | |||
| 1134 | Ga0373935_0018087 | |||
| 1135 | Ga0373927_0028847 | |||
| 1136 | Ga0373927_0076703 | |||
| 1137 | Ga0373933_0074530 | |||
| 1138 | Ga0373947_0000833 | |||
| 1139 | Ga0373947_0001304 | |||
| 1140 | Ga0373947_0004241 | |||
| 1141 | Ga0373937_0001461 | |||
| 1142 | Ga0373937_0016157 | |||
| 1143 | Ga0373937_0751835 | |||
| 1144 | Ga0373925_0003428 | |||
| 1145 | Ga0373925_0015724 | |||
| 1146 | Ga0395899_0024329 | |||
| 1147 | Ga0395900_0017016 | |||
| 1148 | Ga0395900_0017733 | |||
| 1149 | Ga0395900_0077576 | |||
| 1150 | Ga0395900_0579189 | |||
| 1151 | Ga0395900_0585131 | |||
| 1152 | Ga0395898_0027463 | |||
| 1153 | Ga0395898_0034193 | |||
| 1154 | Ga0395898_0066172 | |||
| 1155 | Ga0395898_0073578 | |||
| 1156 | Ga0395898_0086574 | |||
| 1157 | Ga0395898_0225352 | |||
| 1158 | Ga0395898_0474683 | |||
| 1159 | Ga0395905_0050603 | |||
| 1160 | Ga0436364_1212053 | |||
| 1161 | Ga0395901_0042245 | |||
| 1162 | Ga0395901_0055019 | |||
| 1163 | Ga0395901_0078826 | |||
| 1164 | Ga0395901_0104986 | |||
| 1165 | Ga0436365_1019739 | |||
| 1166 | Ga0436360_0815520 | |||
| 1167 | Ga0436363_0106831 | |||
| 1168 | Ga0439436_0012362 | |||
| 1169 | Ga0439439_0016008 | |||
| 1170 | Ga0439431_0002269 | |||
| 1171 | Ga0439448_0134255 | |||
| 1172 | Ga0439457_042944 | |||
| 1173 | Ga0439446_0002256 | |||
| 1174 | Ga0439434_0007674 | |||
| 1175 | Ga0466969_0000408 | |||
| 1176 | Ga0466969_0070411 | |||
| 1177 | Ga0466972_0013763 | |||
| 1178 | Ga0466965_0004049 | |||
| 1179 | Ga0466966_0004115 | |||
| 1180 | Ga0466966_0056747 | |||
| 1181 | Ga0466966_0107675 | |||
| 1182 | Ga0466966_0260045 | |||
| 1183 | Ga0466966_0292199 | |||
| 1184 | Ga0466961_0003343 | |||
| 1185 | Ga0466961_0018160 | |||
| 1186 | Ga0466961_0024084 | |||
| 1187 | Ga0466961_0040880 | |||
| 1188 | Ga0466961_0065232 | |||
| 1189 | Ga0466961_0144466 | |||
| 1190 | Ga0466963_0000752 | |||
| 1191 | Ga0466963_0000760 | |||
| 1192 | Ga0466963_0001436 | |||
| 1193 | Ga0466963_0003818 | |||
| 1194 | Ga0466963_0011658 | |||
| 1195 | Ga0466963_0024964 | |||
| 1196 | Ga0466963_0026442 | |||
| 1197 | Ga0466963_0026995 | |||
| 1198 | Ga0466963_0028399 | |||
| 1199 | Ga0466963_0029963 | |||
| 1200 | Ga0466963_0045069 | |||
| 1201 | Ga0466963_0069877 | |||
| 1202 | Ga0466963_0070413 | |||
| 1203 | Ga0466963_0089111 | |||
| 1204 | Ga0466963_0091966 | |||
| 1205 | Ga0466963_0102932 | |||
| 1206 | Ga0466963_0171660 | |||
| 1207 | Ga0466963_0231732 | |||
| 1208 | Ga0466963_0260560 | |||
| 1209 | Ga0466963_0290401 | |||
| 1210 | Ga0466963_0300212 | |||
| 1211 | Ga0466963_0395449 | |||
| 1212 | Ga0466963_0518671 | |||
| 1213 | Ga0466964_0000980 | |||
| 1214 | Ga0466964_0001835 | |||
| 1215 | Ga0466964_0004614 | |||
| 1216 | Ga0466964_0019307 | |||
| 1217 | Ga0466964_0021445 | |||
| 1218 | Ga0466964_0055934 | |||
| 1219 | Ga0466964_0068277 | |||
| 1220 | Ga0466964_0144131 | |||
| 1221 | Ga0466971_0000854 | |||
| 1222 | Ga0466971_0006026 | |||
| 1223 | Ga0466971_0010425 | |||
| 1224 | Ga0466971_0053859 | |||
| 1225 | Ga0466971_0100146 | |||
| 1226 | Ga0466971_0100160 | |||
| 1227 | Ga0466971_0120057 | |||
| 1228 | Ga0466968_0013251 | |||
| 1229 | Ga0466968_0033709 | |||
| 1230 | Ga0466968_0078103 | |||
| 1231 | Ga0466968_0185760 | |||
| 1232 | Ga0466970_0019344 | |||
| 1233 | Ga0466970_0081194 | |||
| 1234 | Ga0466970_0240313 | |||
| 1235 | Ga0466957_0000320 | |||
| 1236 | Ga0466957_0002697 | |||
| 1237 | Ga0466957_0008188 | |||
| 1238 | Ga0466957_0009467 | |||
| 1239 | Ga0466957_0012058 | |||
| 1240 | Ga0466957_0022846 | |||
| 1241 | Ga0466957_0024673 | |||
| 1242 | Ga0466957_0038706 | |||
| 1243 | Ga0466957_0044447 | |||
| 1244 | Ga0466957_0061912 | |||
| 1245 | Ga0466957_0078882 | |||
| 1246 | Ga0466957_0092865 | |||
| 1247 | Ga0466957_0120781 | |||
| 1248 | Ga0466957_0138165 | |||
| 1249 | Ga0466957_0292194 | |||
| 1250 | Ga0466957_0579880 | |||
| 1251 | Ga0466960_0021185 | |||
| 1252 | Ga0466960_0083647 | |||
| 1253 | Ga0466960_0117558 | |||
| 1254 | Ga0466960_0365764 | |||
| 1255 | Ga0466959_0008653 | |||
| 1256 | Ga0466959_0010156 | |||
| 1257 | Ga0466959_0072562 | |||
| 1258 | Ga0466959_0097887 | |||
| 1259 | Ga0466959_0103272 | |||
| 1260 | Ga0466959_0124651 | |||
| 1261 | Ga0466959_0167630 | |||
| 1262 | Ga0466959_0234981 | |||
| 1263 | Ga0466959_0238662 | |||
| 1264 | Ga0466959_0280720 | |||
| 1265 | Ga0466958_0005130 | |||
| 1266 | Ga0466958_0007009 | |||
| 1267 | Ga0466958_0007207 | |||
| 1268 | Ga0466958_0007488 | |||
| 1269 | Ga0466958_0008663 | |||
| 1270 | Ga0466958_0019258 | |||
| 1271 | Ga0466958_0020596 | |||
| 1272 | Ga0466958_0021364 | |||
| 1273 | Ga0466958_0057855 | |||
| 1274 | Ga0466958_0110090 | |||
| 1275 | Ga0466958_0117160 | |||
| 1276 | Ga0466958_0206714 | |||
| 1277 | Ga0466958_0225658 | |||
| 1278 | Ga0466958_0503048 | |||
| 1279 | Ga0466967_0001867 | |||
| 1280 | Ga0466967_0006510 | |||
| 1281 | Ga0466967_0008137 | |||
| 1282 | Ga0466967_0012033 | |||
| 1283 | Ga0466967_0014542 | |||
| 1284 | Ga0466967_0016832 | |||
| 1285 | Ga0466967_0019357 | |||
| 1286 | Ga0466967_0020228 | |||
| 1287 | Ga0466967_0031882 | |||
| 1288 | Ga0466967_0039559 | |||
| 1289 | Ga0466967_0043872 | |||
| 1290 | Ga0466967_0058802 | |||
| 1291 | Ga0466967_0059022 | |||
| 1292 | Ga0466967_0062419 | |||
| 1293 | Ga0466967_0063715 | |||
| 1294 | Ga0466967_0089713 | |||
| 1295 | Ga0466967_0105945 | |||
| 1296 | Ga0466967_0123476 | |||
| 1297 | Ga0466967_0132051 | |||
| 1298 | Ga0466967_0158329 | |||
| 1299 | Ga0466967_0160985 | |||
| 1300 | Ga0466967_0187938 | |||
| 1301 | Ga0466967_0194028 | |||
| 1302 | Ga0466967_0304742 | |||
| 1303 | Ga0466967_0435173 | |||
| 1304 | Ga0466967_0439866 | |||
| 1305 | Ga0466967_0483624 | |||
| 1306 | Ga0466967_0488663 | |||
| 1307 | Ga0466967_0508286 | |||
| 1308 | Ga0466967_0709555 | |||
| 1309 | Ga0466967_0787632 | |||
| 1310 | Ga0466967_0995956 | |||
| 1311 | Ga0495592_0000048 | |||
| 1312 | Ga0495592_0051776 | |||
| 1313 | Ga0495592_0095414 | |||
| 1314 | Ga0495592_0204954 | |||
| 1315 | Ga0495592_0356833 | |||
| 1316 | Ga0495629_0000983 | |||
| 1317 | Ga0495629_0015602 | |||
| 1318 | Ga0495629_0068901 | |||
| 1319 | Ga0495629_0083905 | |||
| 1320 | Ga0495629_0115477 | |||
| 1321 | Ga0495629_0237436 | |||
| 1322 | Ga0495641_0000513 | |||
| 1323 | Ga0495641_0001416 | |||
| 1324 | Ga0495641_0003996 | |||
| 1325 | Ga0495641_0037441 | |||
| 1326 | Ga0495641_0081260 | |||
| 1327 | Ga0495641_0213863 | |||
| 1328 | Ga0495651_0000049 | |||
| 1329 | Ga0495651_0032397 | |||
| 1330 | Ga0495651_0072171 | |||
| 1331 | Ga0495651_0085130 | |||
| 1332 | Ga0495651_0092323 | |||
| 1333 | Ga0495651_0252547 | |||
| 1334 | Ga0495651_0454664 | |||
| 1335 | Ga0495653_0000489 | |||
| 1336 | Ga0495653_0037793 | |||
| 1337 | Ga0495653_0039324 | |||
| 1338 | Ga0495653_0063593 | |||
| 1339 | Ga0495653_0074201 | |||
| 1340 | Ga0495653_0081218 | |||
| 1341 | Ga0495653_0097382 | |||
| 1342 | Ga0495653_0098842 | |||
| 1343 | Ga0495653_0115516 | |||
| 1344 | Ga0495580_0130815 | |||
| 1345 | Ga0495582_0000553 | |||
| 1346 | Ga0495582_0047087 | |||
| 1347 | Ga0495605_0038854 | |||
| 1348 | Ga0495639_0000180 | |||
| 1349 | Ga0495639_0009403 | |||
| 1350 | Ga0495639_0074972 | |||
| 1351 | Ga0495662_0003722 | |||
| 1352 | Ga0495662_0007890 | |||
| 1353 | Ga0495662_0138274 | |||
| 1354 | Ga0495664_0016483 | |||
| 1355 | Ga0495664_0081742 | |||
| 1356 | Ga0495664_0087336 | |||
| 1357 | Ga0495664_0102766 | |||
| 1358 | Ga0495664_0106459 | |||
| 1359 | Ga0495664_0161528 | |||
| 1360 | Ga0495585_0033720 | |||
| 1361 | Ga0495594_0020401 | |||
| 1362 | Ga0495607_0010453 | |||
| 1363 | Ga0495608_0003026 | |||
| 1364 | Ga0495608_0005307 | |||
| 1365 | Ga0495608_0019694 | |||
| 1366 | Ga0495608_0023644 | |||
| 1367 | Ga0495608_0118017 | |||
| 1368 | Ga0495608_0132207 | |||
| 1369 | Ga0495608_0190255 | |||
| 1370 | Ga0495618_0006054 | |||
| 1371 | Ga0495618_0024890 | |||
| 1372 | Ga0495618_0160286 | |||
| 1373 | Ga0495618_0161319 | |||
| 1374 | Ga0495628_0000026 | |||
| 1375 | Ga0495628_0004120 | |||
| 1376 | Ga0495628_0109524 | |||
| 1377 | Ga0495630_0012886 | |||
| 1378 | Ga0495630_0014969 | |||
| 1379 | Ga0495630_0017466 | |||
| 1380 | Ga0495630_0018842 | |||
| 1381 | Ga0495630_0041071 | |||
| 1382 | Ga0495631_0079527 | |||
| 1383 | Ga0495644_0001562 | |||
| 1384 | Ga0495644_0078043 | |||
| 1385 | Ga0495663_0007171 | |||
| 1386 | Ga0495666_0003590 | |||
| 1387 | Ga0495652_0000172 | |||
| 1388 | Ga0495652_0103308 | |||
| 1389 | Ga0495652_0112881 | |||
| 1390 | Ga0495652_0149532 | |||
| 1391 | Ga0495652_0290800 | |||
| 1392 | Ga0495665_0005465 | |||
| 1393 | Ga0495665_0037122 | |||
| 1394 | Ga0495640_0004584 | |||
| 1395 | Ga0495640_0074153 | |||
| 1396 | Ga0495640_0074625 | |||
| 1397 | Ga0495640_0077028 | |||
| 1398 | Ga0495640_0089388 | |||
| 1399 | Ga0495640_0099037 | |||
| 1400 | Ga0495640_0131827 | |||
| 1401 | Ga0495640_0153882 | |||
| 1402 | Ga0495586_0042294 | |||
| 1403 | Ga0495586_0162558 | |||
| 1404 | Ga0495587_0000362 | |||
| 1405 | Ga0495587_0011402 | |||
| 1406 | Ga0495587_0016541 | |||
| 1407 | Ga0495587_0029918 | |||
| 1408 | Ga0495587_0153553 | |||
| 1409 | Ga0495645_0000016 | |||
| 1410 | Ga0495645_0037319 | |||
| 1411 | Ga0495645_0040045 | |||
| 1412 | Ga0495645_0077748 | |||
| 1413 | Ga0495645_0228406 | |||
| 1414 | Ga0495633_0117738 | |||
| 1415 | Ga0495667_0001379 | |||
| 1416 | Ga0495667_0028440 | |||
| 1417 | Ga0495667_0035465 | |||
| 1418 | Ga0495667_0043945 | |||
| 1419 | Ga0495667_0059847 | |||
| 1420 | Ga0495656_0013463 | |||
| 1421 | Ga0495634_0015592 | |||
| 1422 | Ga0495634_0043668 | |||
| 1423 | Ga0495634_0084951 | |||
| 1424 | Ga0495634_0109796 | |||
| 1425 | Ga0495634_0217356 | |||
| 1426 | Ga0495611_0043473 | |||
| 1427 | Ga0495635_0043056 | |||
| 1428 | Ga0495635_0050451 | |||
| 1429 | Ga0495635_0050772 | |||
| 1430 | Ga0495635_0072500 | |||
| 1431 | Ga0495635_0128518 | |||
| 1432 | Ga0495657_0002580 | |||
| 1433 | Ga0495657_0019102 | |||
| 1434 | Ga0495657_0020642 | |||
| 1435 | Ga0495657_0022694 | |||
| 1436 | Ga0495657_0118320 | |||
| 1437 | Ga0495657_0127897 | |||
| 1438 | Ga0495657_0179976 | |||
| 1439 | Ga0495657_0208544 | |||
| 1440 | Ga0495599_0000016 | |||
| 1441 | Ga0495599_0054948 | |||
| 1442 | Ga0495599_0109699 | |||
| 1443 | Ga0495599_0242133 | |||
| 1444 | Ga0495623_0000046 | |||
| 1445 | Ga0495623_0015074 | |||
| 1446 | Ga0495623_0056966 | |||
| 1447 | Ga0495623_0208768 | |||
| 1448 | Ga0495646_0003505 | |||
| 1449 | Ga0495646_0035631 | |||
| 1450 | Ga0495646_0079924 | |||
| 1451 | Ga0495646_0112795 | |||
| 1452 | Ga0495647_0001779 | |||
| 1453 | Ga0495647_0007902 | |||
| 1454 | Ga0495647_0010520 | |||
| 1455 | Ga0495658_0001696 | |||
| 1456 | Ga0495658_0002075 | |||
| 1457 | Ga0495658_0116693 | |||
| 1458 | Ga0495658_0199545 | |||
| 1459 | Ga0495613_0010668 | |||
| 1460 | Ga0495613_0020063 | |||
| 1461 | Ga0495613_0026728 | |||
| 1462 | Ga0495613_0028638 | |||
| 1463 | Ga0495613_0285032 | |||
| 1464 | Ga0495613_0350131 | |||
| 1465 | Ga0495624_0002088 | |||
| 1466 | Ga0495624_0003996 | |||
| 1467 | Ga0495624_0007147 | |||
| 1468 | Ga0495624_0038068 | |||
| 1469 | Ga0495670_0075765 | |||
| 1470 | Ga0495589_0124947 | |||
| 1471 | Ga0495600_0011642 | |||
| 1472 | Ga0495600_0020552 | |||
| 1473 | Ga0495600_0061348 | |||
| 1474 | Ga0495600_0065733 | |||
| 1475 | Ga0495600_0072025 | |||
| 1476 | Ga0495600_0112341 | |||
| 1477 | Ga0495581_0001833 | |||
| 1478 | Ga0495581_0011060 | |||
| 1479 | Ga0495604_0000004 | |||
| 1480 | Ga0495604_0064863 | |||
| 1481 | Ga0495604_0066552 | |||
| 1482 | Ga0495604_0085022 | |||
| 1483 | Ga0495604_0151265 | |||
| 1484 | Ga0495604_0460514 | |||
| 1485 | Ga0495674_0003155 | |||
| 1486 | Ga0495674_0030477 | |||
| 1487 | Ga0495674_0049237 | |||
| 1488 | Ga0495674_0073031 | |||
| 1489 | Ga0495674_0118262 | |||
| 1490 | Ga0495674_0377983 | |||
| 1491 | Ga0495674_0410920 | |||
| 1492 | Ga0495676_0000766 | |||
| 1493 | Ga0495676_0002145 | |||
| 1494 | Ga0495676_0042185 | |||
| 1495 | Ga0495676_0079435 | |||
| 1496 | Ga0495676_0238259 | |||
| 1497 | Ga0495680_0004330 | |||
| 1498 | Ga0495680_0007287 | |||
| 1499 | Ga0495680_0009072 | |||
| 1500 | Ga0495680_0019817 | |||
| 1501 | Ga0495680_0049855 | |||
| 1502 | Ga0495680_0057886 | |||
| 1503 | Ga0495680_0494077 | |||
| 1504 | Ga0495675_0000079 | |||
| 1505 | Ga0495675_0186381 | |||
| 1506 | Ga0495677_0034607 | |||
| 1507 | Ga0495679_065949 | |||
| 1508 | Ga0495684_0008848 | |||
| 1509 | Ga0495684_0021761 | |||
| 1510 | Ga0495684_0029722 | |||
| 1511 | Ga0495684_0050341 | |||
| 1512 | Ga0495684_0060358 | |||
| 1513 | Ga0495684_0069180 | |||
| 1514 | Ga0495684_0122612 | |||
| 1515 | Ga0495684_0151204 | |||
| 1516 | Ga0495684_0221950 | |||
| 1517 | Ga0495593_0000866 | |||
| 1518 | Ga0495593_0009203 | |||
| 1519 | Ga0495593_0210671 | |||
| 1520 | Ga0495602_0000351 | |||
| 1521 | Ga0495602_0087729 | |||
| 1522 | Ga0495602_0130295 | |||
| 1523 | Ga0495614_0000786 | |||
| 1524 | Ga0495614_0057148 | |||
| 1525 | Ga0496100_0005276 | |||
| 1526 | Ga0496100_0011540 | |||
| 1527 | Ga0496100_0038534 | |||
| 1528 | Ga0496100_0087188 | |||
| 1529 | Ga0496100_0096497 | |||
| 1530 | Ga0496100_0126495 | |||
| 1531 | Ga0496101_0001389 | |||
| 1532 | Ga0496101_0007270 | |||
| 1533 | Ga0496101_0012442 | |||
| 1534 | Ga0496101_0016057 | |||
| 1535 | Ga0496101_0017035 | |||
| 1536 | Ga0496101_0017364 | |||
| 1537 | Ga0496101_0082091 | |||
| 1538 | Ga0496101_0352107 | |||
| 1539 | Ga0496102_0006447 | |||
| 1540 | Ga0496102_0056517 | |||
| 1541 | Ga0496102_0152218 | |||
| 1542 | Ga0496102_0232278 | |||
| 1543 | Ga0496103_0048062 | |||
| 1544 | Ga0496103_0062247 | |||
| 1545 | Ga0496104_0008448 | |||
| 1546 | Ga0496104_0024421 | |||
| 1547 | Ga0496104_0189543 | |||
| 1548 | Ga0496104_0274881 | |||
| 1549 | Ga0496104_0617315 | |||
| 1550 | Ga0496105_0050926 | |||
| 1551 | Ga0496105_0094856 | |||
| 1552 | Ga0496106_0014533 | |||
| 1553 | Ga0496106_0111042 | |||
| 1554 | Ga0496106_0230326 | |||
| 1555 | Ga0496107_0001958 | |||
| 1556 | Ga0496107_0084235 | |||
| 1557 | Ga0496107_0142804 | |||
| 1558 | Ga0496108_0004497 | |||
| 1559 | Ga0496108_0128035 | |||
| 1560 | Ga0496108_0158050 | |||
| 1561 | Ga0496109_0030256 | |||
| 1562 | Ga0496109_0033699 | |||
| 1563 | Ga0496109_0108207 | |||
| 1564 | Ga0496109_0170395 | |||
| 1565 | Ga0496109_0222574 | |||
| 1566 | Ga0496109_0240833 | |||
| 1567 | Ga0496109_0294785 | |||
| 1568 | Ga0496109_0386951 | |||
| 1569 | Ga0496110_0021361 | |||
| 1570 | Ga0496110_0476628 | |||
| 1571 | Ga0496111_0404952 | |||
| 1572 | Ga0496111_0428045 | |||
| 1573 | Ga0496112_0020392 | |||
| 1574 | Ga0496112_0028531 | |||
| 1575 | Ga0496112_0032281 | |||
| 1576 | Ga0496112_0121171 | |||
| 1577 | Ga0496112_0126419 | |||
| 1578 | Ga0496112_0155078 | |||
| 1579 | Ga0496112_0309171 | |||
| 1580 | Ga0496112_0601598 | |||
| 1581 | Ga0496113_0108856 | |||
| 1582 | Ga0496114_0004690 | |||
| 1583 | Ga0496114_0004918 | |||
| 1584 | Ga0496114_0010417 | |||
| 1585 | Ga0496114_0011796 | |||
| 1586 | Ga0496114_0013266 | |||
| 1587 | Ga0496114_0043657 | |||
| 1588 | Ga0496114_0058192 | |||
| 1589 | Ga0496114_0093644 | |||
| 1590 | Ga0496114_0104845 | |||
| 1591 | Ga0496115_0004959 | |||
| 1592 | Ga0496115_0046844 | |||
| 1593 | Ga0496115_0101763 | |||
| 1594 | Ga0496115_0172135 | |||
| 1595 | Ga0496115_0230547 | |||
| 1596 | Ga0496115_0381820 | |||
| 1597 | Ga0496115_0485199 | |||
| 1598 | Ga0501034_0005913 | |||
| 1599 | Ga0501043_0344566 | |||
| 1600 | Ga0501043_0390358 | |||
| 1601 | Ga0501047_0349098 | |||
| 1602 | Ga0501067_0007804 | |||
| 1603 | Ga0501067_0016686 | |||
| 1604 | Ga0501067_0081102 | |||
| 1605 | Ga0501067_0092265 | |||
| 1606 | Ga0501067_0221090 | |||
| 1607 | Ga0501068_0023828 | |||
| 1608 | Ga0501068_0042839 | |||
| 1609 | Ga0501069_0025485 | |||
| 1610 | Ga0501069_0026029 | |||
| 1611 | Ga0501069_0030717 | |||
| 1612 | Ga0501069_0037271 | |||
| 1613 | Ga0501069_0071001 | |||
| 1614 | Ga0501070_0000932 | |||
| 1615 | Ga0501070_0002071 | |||
| 1616 | Ga0501070_0006123 | |||
| 1617 | Ga0501070_0030930 | |||
| 1618 | Ga0501070_0240218 | |||
| 1619 | Ga0501072_0035119 | |||
| 1620 | Ga0501072_0149971 | |||
| 1621 | Ga0501073_0010184 | |||
| 1622 | Ga0501074_0008573 | |||
| 1623 | Ga0501080_0025463 | |||
| 1624 | Ga0501080_0122183 | |||
| 1625 | Ga0501080_0129241 | |||
| 1626 | Ga0501080_0198548 | |||
| 1627 | Ga0501080_0311115 | |||
| 1628 | Ga0501083_0198588 | |||
| 1629 | Ga0501035_0209986 | |||
| 1630 | Ga0501044_0246295 | |||
| 1631 | Ga0501044_0337246 | |||
| 1632 | nmdc:mga05p37_55864_c1 | |||
| 1633 | nmdc:mga08y16_309851_c1 | |||
| 1634 | nmdc:mga0n895_19278_c1 | |||
| 1635 | nmdc:mga0n895_3110_c1 | |||
| 1636 | nmdc:mga0n895_88907_c1 | |||
| 1637 | nmdc:mga08x19_246610_c1 | |||
| 1638 | nmdc:mga08x19_450061_c1 | |||
| 1639 | nmdc:mga0a205_61564_c1 | |||
| 1640 | Ga0495601_0000896 | |||
| 1641 | Ga0495601_0041360 | |||
| 1642 | Ga0495601_0070231 | |||
| 1643 | Ga0495601_0076899 | |||
| 1644 | Ga0495601_0105556 | |||
| 1645 | Ga0495601_0130433 | |||
| 1646 | Ga0495601_0169850 | |||
| 1647 | Ga0495612_0002591 | |||
| 1648 | Ga0495612_0003142 | |||
| 1649 | Ga0495612_0151572 | |||
| 1650 | Ga0495595_0010349 | |||
| 1651 | Ga0495595_0013489 | |||
| 1652 | Ga0495595_0022850 | |||
| 1653 | Ga0495595_0260290 | |||
| 1654 | Ga0495619_0006645 | |||
| 1655 | Ga0495619_0010604 | |||
| 1656 | Ga0495619_0011265 | |||
| 1657 | Ga0495619_0018172 | |||
| 1658 | Ga0495619_0055610 | |||
| 1659 | Ga0495619_0163991 | |||
| 1660 | Ga0466962_0000230 | |||
| 1661 | Ga0466962_0000378 | |||
| 1662 | Ga0466962_0005450 | |||
| 1663 | Ga0466962_0017794 | |||
| 1664 | Ga0466962_0043693 | |||
| 1665 | Ga0466962_0064658 | |||
| 1666 | Ga0466962_0082666 | |||
| 1667 | Ga0530510_0102195 | |||
| 1668 | Ga0530510_0570723 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6aqu-assembly1.cif.gz_B | crystal structure of plasmodium falciparum purine nucleoside phosphorylase: the m183l mutant | 0.9152 | 4 | 240 |
| 3tl6-assembly1.cif.gz_D | crystal structure of purine nucleoside phosphorylase from entamoeba histolytica | 0.9097 | 3 | 239 |
| 1odk-assembly1.cif.gz_E | purine nucleoside phosphorylase from thermus thermophilus | 0.9083 | 1 | 239 |
| 3tl6-assembly1.cif.gz_B | crystal structure of purine nucleoside phosphorylase from entamoeba histolytica | 0.9069 | 4 | 239 |
| 4d9h-assembly1.cif.gz_B | crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenosine | 0.906 | 3 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tl6D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9097 | 3 | 239 | 3.40.50.1580 |
| 1odkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8969 | 1 | 239 | 3.40.50.1580 |
| 1odkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8816 | 1 | 239 | 3.40.50.1580 |
| 4tymA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.877 | 3 | 242 | 3.40.50.1580 |
| 4ldnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8756 | 1 | 243 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257ATK0-F1-model_v4 | 5'-methylthioadenosine phosphorylase | 0.9746 | 4 | 101 |
GO:0003824
GO:0005829 GO:0009116 |
| AF-G5LXY5-F1-model_v4 | Purine nucleoside phosphorylase | 0.9671 | 10 | 153 |
GO:0004731
GO:0005829 GO:0006152 |
| AF-A0A2S5EJU0-F1-model_v4 | Uridine phosphorylase (EC 2.4.2.3) | 0.9615 | 4 | 154 |
GO:0005829
GO:0009164 GO:0016763 |
| AF-R7A9H6-F1-model_v4 | deleted | 0.961 | 3 | 99 |
|
| AF-A0A7J6LA44-F1-model_v4 | Nucleoside phosphorylase domain-containing protein | 0.9601 | 4 | 91 |
GO:0004850
GO:0005829 GO:0006218 |