F482709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 383 | 689 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000314|JGI25162J39368_100031423 |
| Length | 70 |
| Sequence | MRRVRSIAGDSVNLLLYRELNRCDDAAEEALWRLNPTLAEQGPVLPAGVWVVLPELDSKPAAIAAVSAWD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 4 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 5 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 6 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 7 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 8 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 9 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 10 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 11 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 12 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 13 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 14 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 15 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 16 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 17 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 18 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 19 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 20 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 21 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 22 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 23 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 24 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 25 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 26 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 27 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 28 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 29 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 30 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 31 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 32 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 33 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 34 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 35 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 36 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 37 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 38 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 39 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 40 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 41 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 42 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 43 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 44 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 45 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 46 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 47 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 48 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 49 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 50 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 51 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 52 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 53 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 54 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 55 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 56 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 57 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 58 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 59 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 60 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 61 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 62 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 63 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 64 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 65 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 66 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 67 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 68 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 69 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 70 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 71 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 72 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 73 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 74 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 75 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 76 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 77 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 78 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 79 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 80 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 81 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 82 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 83 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 84 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 85 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 86 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 87 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 88 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 89 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 90 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 91 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 92 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 93 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 94 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 95 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 96 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 97 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 98 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 99 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 100 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 101 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 102 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 103 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 104 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 105 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 106 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 107 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 108 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 109 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 110 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 111 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 112 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 113 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 114 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 115 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 116 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 117 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 118 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 119 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 120 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 121 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 122 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 123 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 124 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 125 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 126 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 127 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 128 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 129 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 130 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 131 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 132 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 133 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 134 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 135 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 136 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 137 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 138 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 139 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 140 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 141 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 142 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 143 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 144 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 145 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 146 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 147 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 148 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 149 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 150 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 152 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 161 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 164 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 165 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 166 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 167 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 168 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 169 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 170 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 171 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 180 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 181 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 189 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 191 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 192 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 204 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 206 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 232 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 233 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 234 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 235 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 251 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 252 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 253 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 254 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 255 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 260 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 261 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 262 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 263 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 264 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 265 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 266 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 267 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 268 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 269 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 270 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 271 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 272 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 273 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 274 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 275 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 276 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 372 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 373 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 374 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 375 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 376 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 377 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 378 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 379 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 380 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 381 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 382 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 383 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.81 |
| Metatranscriptomes | 0 |
| Isolates | 17.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.09 |
| Nodule | 1.68 |
| Rhizoplane | 5.65 |
| Rhizosphere | 70.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_10507 | 2124908027 | Bacteria | 1030 |
| 2 | JGI25162J39368_1000314 | 3300002737 | Bacteria | 42959 |
| 3 | JGI25154J39366_1008106 | 3300002738 | Bacteria | 1381 |
| 4 | JGI25163J39215_1000669 | 3300002771 | Bacteria | 9200 |
| 5 | JGI25164J39214_1000233 | 3300002772 | Bacteria | 42959 |
| 6 | JGI25165J46597_1000429 | 3300003214 | Bacteria | 42959 |
| 7 | Ga0055538_1000073 | 3300003751 | Bacteria | 90843 |
| 8 | Ga0055539_1000109 | 3300003752 | Bacteria | 90843 |
| 9 | Ga0055533_1000117 | 3300003756 | Bacteria | 90843 |
| 10 | Ga0055532_1000120 | 3300003758 | Bacteria | 81088 |
| 11 | Ga0055525_1000156 | 3300003759 | Bacteria | 90843 |
| 12 | Ga0055535_1012414 | 3300003761 | Bacteria | 1300 |
| 13 | Ga0055536_1000217 | 3300003781 | Bacteria | 47045 |
| 14 | Ga0055536_1080317 | 3300003781 | Bacteria | 620 |
| 15 | Ga0055530_10000454 | 3300003791 | Bacteria | 36466 |
| 16 | Ga0055530_10000608 | 3300003791 | Bacteria | 31086 |
| 17 | Ga0055540_1000782 | 3300003792 | Bacteria | 21518 |
| 18 | Ga0055540_1000856 | 3300003792 | Bacteria | 20321 |
| 19 | Ga0055540_1000983 | 3300003792 | Bacteria | 18381 |
| 20 | Ga0055531_10000458 | 3300003794 | Bacteria | 37744 |
| 21 | Ga0055531_10081760 | 3300003794 | Bacteria | 709 |
| 22 | Ga0055541_1000074 | 3300003841 | Bacteria | 90843 |
| 23 | Ga0065714_10003741 | 3300005288 | Bacteria | 6419 |
| 24 | Ga0065714_10073190 | 3300005288 | Bacteria | 3224 |
| 25 | Ga0065714_10100675 | 3300005288 | Bacteria | 1659 |
| 26 | Ga0065714_10121432 | 3300005288 | Bacteria | 1327 |
| 27 | Ga0065714_10158722 | 3300005288 | Bacteria | 1056 |
| 28 | Ga0065714_10285499 | 3300005288 | Bacteria | 716 |
| 29 | Ga0065714_10400322 | 3300005288 | Bacteria | 590 |
| 30 | Ga0065714_10414697 | 3300005288 | Bacteria | 579 |
| 31 | Ga0065704_10085319 | 3300005289 | Bacteria | 3230 |
| 32 | Ga0065704_10202127 | 3300005289 | Bacteria | 1142 |
| 33 | Ga0065704_10512990 | 3300005289 | Bacteria | 659 |
| 34 | Ga0065715_10183624 | 3300005293 | Bacteria | 1459 |
| 35 | Ga0070676_11084806 | 3300005328 | Bacteria | 604 |
| 36 | Ga0070670_100001560 | 3300005331 | Bacteria | 18469 |
| 37 | Ga0070661_100000219 | 3300005344 | Bacteria | 47253 |
| 38 | Ga0070669_100005257 | 3300005353 | Bacteria | 9348 |
| 39 | Ga0070669_100193851 | 3300005353 | Bacteria | 1595 |
| 40 | Ga0070675_100908006 | 3300005354 | Bacteria | 807 |
| 41 | Ga0070659_100343444 | 3300005366 | Bacteria | 1251 |
| 42 | Ga0070662_100000526 | 3300005457 | Bacteria | 23089 |
| 43 | Ga0068853_100044913 | 3300005539 | Bacteria | 3783 |
| 44 | Ga0070665_100197824 | 3300005548 | Bacteria | 2011 |
| 45 | Ga0070665_102241838 | 3300005548 | Bacteria | 550 |
| 46 | Ga0070664_100001287 | 3300005564 | Bacteria | 20065 |
| 47 | Ga0070664_100219163 | 3300005564 | Bacteria | 1702 |
| 48 | Ga0068857_101085710 | 3300005577 | Bacteria | 772 |
| 49 | Ga0068854_100088869 | 3300005578 | Bacteria | 2295 |
| 50 | Ga0068851_10000037 | 3300005834 | Bacteria | 97386 |
| 51 | Ga0075363_100794700 | 3300006048 | Bacteria | 575 |
| 52 | Ga0075364_10091225 | 3300006051 | Bacteria | 2021 |
| 53 | Ga0075364_10645866 | 3300006051 | Bacteria | 723 |
| 54 | Ga0075432_10044984 | 3300006058 | Bacteria | 1548 |
| 55 | Ga0075362_10409339 | 3300006177 | Bacteria | 685 |
| 56 | Ga0079104_1031169 | 3300006946 | Bacteria | 1324 |
| 57 | Ga0079104_1113999 | 3300006946 | Bacteria | 533 |
| 58 | Ga0105251_10012223 | 3300009011 | Bacteria | 4868 |
| 59 | Ga0105251_10012906 | 3300009011 | Bacteria | 4700 |
| 60 | Ga0105251_10016148 | 3300009011 | Bacteria | 4046 |
| 61 | Ga0105251_10025392 | 3300009011 | Bacteria | 3031 |
| 62 | Ga0105251_10048612 | 3300009011 | Bacteria | 2032 |
| 63 | Ga0105251_10095695 | 3300009011 | Bacteria | 1361 |
| 64 | Ga0105251_10237219 | 3300009011 | Bacteria | 821 |
| 65 | Ga0105244_10002831 | 3300009036 | Bacteria | 12873 |
| 66 | Ga0105244_10008193 | 3300009036 | Bacteria | 6552 |
| 67 | Ga0105244_10012245 | 3300009036 | Bacteria | 5081 |
| 68 | Ga0105244_10014588 | 3300009036 | Bacteria | 4540 |
| 69 | Ga0105244_10014962 | 3300009036 | Bacteria | 4464 |
| 70 | Ga0105244_10017866 | 3300009036 | Bacteria | 3995 |
| 71 | Ga0105244_10054715 | 3300009036 | Bacteria | 2024 |
| 72 | Ga0105244_10108772 | 3300009036 | Bacteria | 1350 |
| 73 | Ga0105244_10281955 | 3300009036 | Bacteria | 771 |
| 74 | Ga0105250_10001299 | 3300009092 | Bacteria | 13711 |
| 75 | Ga0105250_10002968 | 3300009092 | Bacteria | 8248 |
| 76 | Ga0105250_10003980 | 3300009092 | Bacteria | 6895 |
| 77 | Ga0105250_10006308 | 3300009092 | Bacteria | 5196 |
| 78 | Ga0105250_10006540 | 3300009092 | Bacteria | 5086 |
| 79 | Ga0105250_10010198 | 3300009092 | Bacteria | 3920 |
| 80 | Ga0105250_10049892 | 3300009092 | Bacteria | 1679 |
| 81 | Ga0105250_10268924 | 3300009092 | Bacteria | 731 |
| 82 | Ga0105250_10314310 | 3300009092 | Bacteria | 680 |
| 83 | Ga0105243_10001686 | 3300009148 | Bacteria | 19035 |
| 84 | Ga0105242_10001117 | 3300009176 | Bacteria | 21160 |
| 85 | Ga0105242_10479699 | 3300009176 | Bacteria | 1178 |
| 86 | Ga0105248_10360193 | 3300009177 | Bacteria | 1637 |
| 87 | Ga0105237_10000196 | 3300009545 | Bacteria | 85826 |
| 88 | Ga0105237_11306265 | 3300009545 | Bacteria | 732 |
| 89 | Ga0105246_10000347 | 3300011119 | Bacteria | 24747 |
| 90 | Ga0105246_10184366 | 3300011119 | Bacteria | 1610 |
| 91 | Ga0157345_1000275 | 3300012498 | Bacteria | 7154 |
| 92 | Ga0157347_1023079 | 3300012502 | Bacteria | 740 |
| 93 | Ga0157373_10002861 | 3300013100 | Bacteria | 13064 |
| 94 | Ga0157373_10010905 | 3300013100 | Bacteria | 6690 |
| 95 | Ga0157373_10014633 | 3300013100 | Bacteria | 5752 |
| 96 | Ga0157373_10015166 | 3300013100 | Bacteria | 5636 |
| 97 | Ga0157373_10027040 | 3300013100 | Bacteria | 4140 |
| 98 | Ga0157373_10035028 | 3300013100 | Bacteria | 3605 |
| 99 | Ga0157373_10042598 | 3300013100 | Bacteria | 3244 |
| 100 | Ga0157373_10049466 | 3300013100 | Bacteria | 2996 |
| 101 | Ga0157373_10062807 | 3300013100 | Bacteria | 2630 |
| 102 | Ga0157373_10408416 | 3300013100 | Bacteria | 974 |
| 103 | Ga0157373_11478315 | 3300013100 | Bacteria | 518 |
| 104 | Ga0157371_10005463 | 3300013102 | Bacteria | 10713 |
| 105 | Ga0157371_10011393 | 3300013102 | Bacteria | 6857 |
| 106 | Ga0157371_10017484 | 3300013102 | Bacteria | 5326 |
| 107 | Ga0157371_10036018 | 3300013102 | Bacteria | 3544 |
| 108 | Ga0157371_11129102 | 3300013102 | Bacteria | 602 |
| 109 | Ga0157371_11262203 | 3300013102 | Bacteria | 571 |
| 110 | Ga0157370_10033664 | 3300013104 | Bacteria | 4995 |
| 111 | Ga0157370_10039583 | 3300013104 | Bacteria | 4556 |
| 112 | Ga0157370_10040981 | 3300013104 | Bacteria | 4470 |
| 113 | Ga0157370_10091076 | 3300013104 | Bacteria | 2863 |
| 114 | Ga0157370_10113572 | 3300013104 | Bacteria | 2531 |
| 115 | Ga0157370_10125900 | 3300013104 | Bacteria | 2391 |
| 116 | Ga0157370_10229640 | 3300013104 | Bacteria | 1718 |
| 117 | Ga0157370_10569065 | 3300013104 | Bacteria | 1038 |
| 118 | Ga0157369_10029322 | 3300013105 | Bacteria | 6081 |
| 119 | Ga0157369_10032822 | 3300013105 | Bacteria | 5705 |
| 120 | Ga0157369_10057162 | 3300013105 | Bacteria | 4209 |
| 121 | Ga0157369_10062767 | 3300013105 | Bacteria | 4003 |
| 122 | Ga0157369_10403856 | 3300013105 | Bacteria | 1417 |
| 123 | Ga0157369_10968652 | 3300013105 | Bacteria | 871 |
| 124 | Ga0157369_10969952 | 3300013105 | Bacteria | 871 |
| 125 | Ga0163162_10013275 | 3300013306 | Bacteria | 8046 |
| 126 | Ga0163162_10070183 | 3300013306 | Bacteria | 3555 |
| 127 | Ga0163162_10070757 | 3300013306 | Bacteria | 3540 |
| 128 | Ga0163162_10116012 | 3300013306 | Bacteria | 2778 |
| 129 | Ga0163162_10145310 | 3300013306 | Bacteria | 2487 |
| 130 | Ga0163162_11051021 | 3300013306 | Bacteria | 922 |
| 131 | Ga0157372_10060956 | 3300013307 | Bacteria | 4222 |
| 132 | Ga0157375_10017263 | 3300013308 | Bacteria | 6508 |
| 133 | Ga0157375_10040228 | 3300013308 | Bacteria | 4505 |
| 134 | Ga0157375_10348925 | 3300013308 | Bacteria | 1646 |
| 135 | Ga0182008_10006874 | 3300014497 | Bacteria | 6324 |
| 136 | Ga0182008_10006946 | 3300014497 | Bacteria | 6283 |
| 137 | Ga0182008_10007839 | 3300014497 | Bacteria | 5870 |
| 138 | Ga0182008_10009184 | 3300014497 | Bacteria | 5345 |
| 139 | Ga0182008_10009723 | 3300014497 | Bacteria | 5179 |
| 140 | Ga0182008_10023747 | 3300014497 | Bacteria | 3127 |
| 141 | Ga0182008_10038097 | 3300014497 | Bacteria | 2405 |
| 142 | Ga0182008_10091972 | 3300014497 | Bacteria | 1496 |
| 143 | Ga0182006_1004889 | 3300015261 | Bacteria | 6494 |
| 144 | Ga0182006_1005668 | 3300015261 | Bacteria | 5916 |
| 145 | Ga0182006_1015770 | 3300015261 | Bacteria | 3233 |
| 146 | Ga0182006_1027577 | 3300015261 | Bacteria | 2316 |
| 147 | Ga0182006_1030332 | 3300015261 | Bacteria | 2185 |
| 148 | Ga0182006_1084722 | 3300015261 | Bacteria | 1150 |
| 149 | Ga0182006_1196957 | 3300015261 | Bacteria | 668 |
| 150 | Ga0182007_10001094 | 3300015262 | Bacteria | 14746 |
| 151 | Ga0182007_10002411 | 3300015262 | Bacteria | 9336 |
| 152 | Ga0182007_10005509 | 3300015262 | Bacteria | 5550 |
| 153 | Ga0182007_10006179 | 3300015262 | Bacteria | 5168 |
| 154 | Ga0182005_1001507 | 3300015265 | Bacteria | 9285 |
| 155 | Ga0163161_10002369 | 3300017792 | Bacteria | 13501 |
| 156 | Ga0163161_10019070 | 3300017792 | Bacteria | 4807 |
| 157 | Ga0163161_10020602 | 3300017792 | Bacteria | 4629 |
| 158 | Ga0163161_10020764 | 3300017792 | Bacteria | 4610 |
| 159 | Ga0163161_10082956 | 3300017792 | Bacteria | 2362 |
| 160 | Ga0163161_10094157 | 3300017792 | Bacteria | 2220 |
| 161 | Ga0163161_10094905 | 3300017792 | Bacteria | 2212 |
| 162 | Ga0163161_10101375 | 3300017792 | Bacteria | 2143 |
| 163 | Ga0163161_10172702 | 3300017792 | Bacteria | 1653 |
| 164 | Ga0163161_10188602 | 3300017792 | Bacteria | 1584 |
| 165 | Ga0163161_10434744 | 3300017792 | Bacteria | 1058 |
| 166 | Ga0163161_10434745 | 3300017792 | Bacteria | 1058 |
| 167 | Ga0163161_11283940 | 3300017792 | Bacteria | 636 |
| 168 | Ga0163161_11918908 | 3300017792 | Bacteria | 527 |
| 169 | Ga0209435_100620 | 3300025206 | Bacteria | 6478 |
| 170 | Ga0209760_100046 | 3300025207 | Bacteria | 107840 |
| 171 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 172 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 173 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 174 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 175 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 176 | Ga0209563_100578 | 3300025230 | Bacteria | 12184 |
| 177 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 178 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 179 | Ga0209437_103326 | 3300025233 | Bacteria | 2926 |
| 180 | Ga0209258_100296 | 3300025242 | Bacteria | 81403 |
| 181 | Ga0209646_1000213 | 3300025246 | Bacteria | 64543 |
| 182 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 183 | Ga0209759_1022755 | 3300025256 | Bacteria | 1395 |
| 184 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 185 | Ga0209675_1002947 | 3300025291 | Bacteria | 8397 |
| 186 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 187 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 188 | Ga0209676_1000397 | 3300025292 | Bacteria | 79463 |
| 189 | Ga0209676_1003696 | 3300025292 | Bacteria | 9144 |
| 190 | Ga0209676_1007897 | 3300025292 | Bacteria | 4880 |
| 191 | Ga0209050_1000208 | 3300025298 | Bacteria | 131310 |
| 192 | Ga0209050_1000588 | 3300025298 | Bacteria | 58223 |
| 193 | Ga0209050_1000978 | 3300025298 | Bacteria | 36519 |
| 194 | Ga0209050_1001235 | 3300025298 | Bacteria | 29568 |
| 195 | Ga0209051_1000219 | 3300025303 | Bacteria | 96484 |
| 196 | Ga0209051_1000422 | 3300025303 | Bacteria | 58223 |
| 197 | Ga0209051_1000498 | 3300025303 | Bacteria | 50496 |
| 198 | Ga0209051_1008755 | 3300025303 | Bacteria | 5314 |
| 199 | Ga0209051_1086793 | 3300025303 | Bacteria | 884 |
| 200 | Ga0209257_1000342 | 3300025304 | Bacteria | 97045 |
| 201 | Ga0209257_1005479 | 3300025304 | Bacteria | 8888 |
| 202 | Ga0207656_10000014 | 3300025321 | Bacteria | 146941 |
| 203 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 204 | Ga0207696_1000221 | 3300025711 | Bacteria | 82620 |
| 205 | Ga0207696_1004504 | 3300025711 | Bacteria | 5995 |
| 206 | Ga0207696_1011909 | 3300025711 | Bacteria | 3104 |
| 207 | Ga0207696_1014700 | 3300025711 | Bacteria | 2676 |
| 208 | Ga0207696_1019928 | 3300025711 | Bacteria | 2171 |
| 209 | Ga0207696_1206397 | 3300025711 | Bacteria | 515 |
| 210 | Ga0207655_1000563 | 3300025728 | Bacteria | 46042 |
| 211 | Ga0207655_1001730 | 3300025728 | Bacteria | 19165 |
| 212 | Ga0207655_1001921 | 3300025728 | Bacteria | 17795 |
| 213 | Ga0207655_1002210 | 3300025728 | Bacteria | 16145 |
| 214 | Ga0207655_1008923 | 3300025728 | Bacteria | 6294 |
| 215 | Ga0207655_1009718 | 3300025728 | Bacteria | 5936 |
| 216 | Ga0207655_1013256 | 3300025728 | Bacteria | 4744 |
| 217 | Ga0207655_1072946 | 3300025728 | Bacteria | 1267 |
| 218 | Ga0207713_1000751 | 3300025735 | Bacteria | 30209 |
| 219 | Ga0207713_1001304 | 3300025735 | Bacteria | 20486 |
| 220 | Ga0207713_1004618 | 3300025735 | Bacteria | 8897 |
| 221 | Ga0207713_1005033 | 3300025735 | Bacteria | 8402 |
| 222 | Ga0207713_1060590 | 3300025735 | Bacteria | 1445 |
| 223 | Ga0207713_1094647 | 3300025735 | Bacteria | 1042 |
| 224 | Ga0207713_1101584 | 3300025735 | Bacteria | 991 |
| 225 | Ga0207713_1133211 | 3300025735 | Bacteria | 820 |
| 226 | Ga0207645_10323487 | 3300025907 | Bacteria | 1029 |
| 227 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 228 | Ga0207671_10756619 | 3300025914 | Bacteria | 772 |
| 229 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 230 | Ga0207681_10000584 | 3300025923 | Bacteria | 24838 |
| 231 | Ga0207681_10351496 | 3300025923 | Bacteria | 1180 |
| 232 | Ga0207650_10000198 | 3300025925 | Bacteria | 69296 |
| 233 | Ga0207706_10006246 | 3300025933 | Bacteria | 11074 |
| 234 | Ga0207706_11118717 | 3300025933 | Bacteria | 657 |
| 235 | Ga0207686_10004351 | 3300025934 | Bacteria | 7590 |
| 236 | Ga0207709_10000228 | 3300025935 | Bacteria | 70988 |
| 237 | Ga0207709_10218401 | 3300025935 | Bacteria | 1373 |
| 238 | Ga0207711_10337733 | 3300025941 | Bacteria | 1394 |
| 239 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 240 | Ga0207679_10168660 | 3300025945 | Bacteria | 1800 |
| 241 | Ga0207640_10111564 | 3300025981 | Bacteria | 1940 |
| 242 | Ga0207639_10036231 | 3300026041 | Bacteria | 3655 |
| 243 | Ga0207674_10477926 | 3300026116 | Bacteria | 1204 |
| 244 | Ga0209281_1005084 | 3300027111 | Bacteria | 3737 |
| 245 | Ga0209281_1009764 | 3300027111 | Bacteria | 2233 |
| 246 | Ga0268266_10486158 | 3300028379 | Bacteria | 1177 |
| 247 | Ga0268266_11515706 | 3300028379 | Bacteria | 646 |
| 248 | Ga0307517_10077807 | 3300028786 | Bacteria | 2877 |
| 249 | Ga0307511_10097542 | 3300030521 | Bacteria | 1951 |
| 250 | Ga0314311_1008105 | 3300030733 | Bacteria | 2445 |
| 251 | Ga0316179_1104439 | 3300030734 | Bacteria | 722 |
| 252 | Ga0316181_1138181 | 3300030744 | Bacteria | 797 |
| 253 | Ga0265316_10640564 | 3300031344 | Bacteria | 752 |
| 254 | Ga0307509_10075412 | 3300031507 | Bacteria | 3503 |
| 255 | Ga0307408_100001454 | 3300031548 | Bacteria | 17613 |
| 256 | Ga0307408_100014079 | 3300031548 | Bacteria | 5313 |
| 257 | Ga0307408_100044212 | 3300031548 | Bacteria | 3172 |
| 258 | Ga0307408_100117588 | 3300031548 | Bacteria | 2053 |
| 259 | Ga0307408_100277440 | 3300031548 | Bacteria | 1394 |
| 260 | Ga0307516_10448767 | 3300031730 | Bacteria | 946 |
| 261 | Ga0307405_10000211 | 3300031731 | Bacteria | 21038 |
| 262 | Ga0307405_10006627 | 3300031731 | Bacteria | 5713 |
| 263 | Ga0307405_10015096 | 3300031731 | Bacteria | 4172 |
| 264 | Ga0307405_10068258 | 3300031731 | Bacteria | 2274 |
| 265 | Ga0307405_10764482 | 3300031731 | Bacteria | 806 |
| 266 | Ga0307413_10161084 | 3300031824 | Bacteria | 1576 |
| 267 | Ga0307413_10201067 | 3300031824 | Bacteria | 1439 |
| 268 | Ga0307413_10354414 | 3300031824 | Bacteria | 1133 |
| 269 | Ga0307413_11085657 | 3300031824 | Bacteria | 690 |
| 270 | Ga0307406_10005906 | 3300031901 | Bacteria | 6716 |
| 271 | Ga0307406_10114886 | 3300031901 | Bacteria | 1860 |
| 272 | Ga0307406_12141292 | 3300031901 | Bacteria | 501 |
| 273 | Ga0307407_10010259 | 3300031903 | Bacteria | 4410 |
| 274 | Ga0307407_10511291 | 3300031903 | Bacteria | 882 |
| 275 | Ga0307412_10010299 | 3300031911 | Bacteria | 5384 |
| 276 | Ga0307412_10011063 | 3300031911 | Bacteria | 5214 |
| 277 | Ga0307412_10031694 | 3300031911 | Bacteria | 3341 |
| 278 | Ga0307412_10359686 | 3300031911 | Bacteria | 1171 |
| 279 | Ga0307409_100049132 | 3300031995 | Bacteria | 3214 |
| 280 | Ga0307416_100094947 | 3300032002 | Bacteria | 2573 |
| 281 | Ga0307416_101579234 | 3300032002 | Bacteria | 761 |
| 282 | Ga0307416_103348128 | 3300032002 | Bacteria | 536 |
| 283 | Ga0307414_10018788 | 3300032004 | Bacteria | 4266 |
| 284 | Ga0307414_10045625 | 3300032004 | Bacteria | 3002 |
| 285 | Ga0307414_10359384 | 3300032004 | Bacteria | 1252 |
| 286 | Ga0307414_10399394 | 3300032004 | Bacteria | 1193 |
| 287 | Ga0307411_10181079 | 3300032005 | Bacteria | 1599 |
| 288 | Ga0307411_10582136 | 3300032005 | Bacteria | 959 |
| 289 | Ga0307411_12224294 | 3300032005 | Bacteria | 514 |
| 290 | Ga0307510_10045373 | 3300033180 | Bacteria | 4745 |
| 291 | Ga0237819_01118 | 3300038705 | Bacteria | 7806 |
| 292 | Ga0439438_001775 | 3300041405 | Bacteria | 9461 |
| 293 | Ga0439438_005677 | 3300041405 | Bacteria | 4545 |
| 294 | Ga0439438_035191 | 3300041405 | Bacteria | 1316 |
| 295 | Ga0439447_005066 | 3300041407 | Bacteria | 4429 |
| 296 | Ga0439447_015790 | 3300041407 | Bacteria | 2088 |
| 297 | Ga0439447_047242 | 3300041407 | Bacteria | 1034 |
| 298 | Ga0439466_0002005 | 3300041411 | Bacteria | 7987 |
| 299 | Ga0439466_0002810 | 3300041411 | Bacteria | 6819 |
| 300 | Ga0439466_0023603 | 3300041411 | Bacteria | 2161 |
| 301 | Ga0451833_0896841 | 3300041491 | Bacteria | 572 |
| 302 | Ga0451841_1119567 | 3300041498 | Bacteria | 705 |
| 303 | Ga0439432_000218 | 3300042006 | Bacteria | 20648 |
| 304 | Ga0439432_004736 | 3300042006 | Bacteria | 4951 |
| 305 | Ga0439451_001422 | 3300042009 | Bacteria | 4737 |
| 306 | Ga0439451_001463 | 3300042009 | Bacteria | 4666 |
| 307 | Ga0439451_001543 | 3300042009 | Bacteria | 4561 |
| 308 | Ga0439452_002186 | 3300042010 | Bacteria | 7378 |
| 309 | Ga0439452_010650 | 3300042010 | Bacteria | 2664 |
| 310 | Ga0439456_000904 | 3300042013 | Bacteria | 5941 |
| 311 | Ga0439456_009554 | 3300042013 | Bacteria | 2004 |
| 312 | Ga0439456_015497 | 3300042013 | Bacteria | 1591 |
| 313 | Ga0439456_088308 | 3300042013 | Bacteria | 695 |
| 314 | Ga0439456_124524 | 3300042013 | Bacteria | 592 |
| 315 | Ga0439463_001133 | 3300042016 | Bacteria | 7151 |
| 316 | Ga0439463_009946 | 3300042016 | Bacteria | 2336 |
| 317 | Ga0439463_025238 | 3300042016 | Bacteria | 1490 |
| 318 | Ga0450911_001005 | 3300042115 | Bacteria | 7254 |
| 319 | Ga0450911_002792 | 3300042115 | Bacteria | 3292 |
| 320 | Ga0450894_002158 | 3300042131 | Bacteria | 2677 |
| 321 | Ga0450896_051657 | 3300042133 | Bacteria | 656 |
| 322 | Ga0450898_000324 | 3300042134 | Bacteria | 5421 |
| 323 | Ga0450900_078226 | 3300042136 | Bacteria | 529 |
| 324 | Ga0450903_011045 | 3300042138 | Bacteria | 1457 |
| 325 | Ga0450903_020283 | 3300042138 | Bacteria | 1028 |
| 326 | Ga0450903_042307 | 3300042138 | Bacteria | 673 |
| 327 | Ga0450904_001481 | 3300042139 | Bacteria | 3262 |
| 328 | Ga0450904_003275 | 3300042139 | Bacteria | 1775 |
| 329 | Ga0450904_022331 | 3300042139 | Bacteria | 645 |
| 330 | Ga0450905_001492 | 3300042142 | Bacteria | 2981 |
| 331 | Ga0450905_006037 | 3300042142 | Bacteria | 1632 |
| 332 | Ga0450905_021768 | 3300042142 | Bacteria | 950 |
| 333 | Ga0450889_006958 | 3300042144 | Bacteria | 1138 |
| 334 | Ga0450906_000914 | 3300042145 | Bacteria | 6442 |
| 335 | Ga0450906_076923 | 3300042145 | Bacteria | 600 |
| 336 | Ga0450907_100567 | 3300042146 | Bacteria | 503 |
| 337 | Ga0450918_043507 | 3300042531 | Bacteria | 809 |
| 338 | Ga0450893_0003145 | 3300042532 | Bacteria | 2594 |
| 339 | Ga0450901_000311 | 3300042533 | Bacteria | 5951 |
| 340 | Ga0439440_0001087 | 3300042993 | Bacteria | 4848 |
| 341 | Ga0495617_004684 | 3300046452 | Bacteria | 4944 |
| 342 | Ga0495617_010329 | 3300046452 | Bacteria | 3197 |
| 343 | Ga0495617_033259 | 3300046452 | Bacteria | 1730 |
| 344 | Ga0495627_000810 | 3300046453 | Bacteria | 22858 |
| 345 | Ga0495627_001143 | 3300046453 | Bacteria | 17139 |
| 346 | Ga0495627_004239 | 3300046453 | Bacteria | 6055 |
| 347 | Ga0495627_006494 | 3300046453 | Bacteria | 4582 |
| 348 | Ga0495627_022672 | 3300046453 | Bacteria | 2063 |
| 349 | Ga0495627_024034 | 3300046453 | Bacteria | 1990 |
| 350 | Ga0495592_0030778 | 3300046454 | Bacteria | 4059 |
| 351 | Ga0495603_0011876 | 3300046455 | Bacteria | 5270 |
| 352 | Ga0495590_0007727 | 3300046457 | Bacteria | 4131 |
| 353 | Ga0495590_0011922 | 3300046457 | Bacteria | 3239 |
| 354 | Ga0495590_0013501 | 3300046457 | Bacteria | 3000 |
| 355 | Ga0495591_001155 | 3300046458 | Bacteria | 17315 |
| 356 | Ga0495591_006386 | 3300046458 | Bacteria | 5219 |
| 357 | Ga0495591_007252 | 3300046458 | Bacteria | 4742 |
| 358 | Ga0495591_007370 | 3300046458 | Bacteria | 4686 |
| 359 | Ga0495591_007644 | 3300046458 | Bacteria | 4558 |
| 360 | Ga0495591_007669 | 3300046458 | Bacteria | 4548 |
| 361 | Ga0495591_011483 | 3300046458 | Bacteria | 3352 |
| 362 | Ga0495591_036181 | 3300046458 | Bacteria | 1439 |
| 363 | Ga0495629_0755737 | 3300046459 | Bacteria | 643 |
| 364 | Ga0495638_0011165 | 3300046460 | Bacteria | 6202 |
| 365 | Ga0495638_0022088 | 3300046460 | Bacteria | 4179 |
| 366 | Ga0495653_0023583 | 3300046463 | Bacteria | 4968 |
| 367 | Ga0495653_0076256 | 3300046463 | Bacteria | 2492 |
| 368 | Ga0495653_0090896 | 3300046463 | Bacteria | 2232 |
| 369 | Ga0495653_0152125 | 3300046463 | Bacteria | 1615 |
| 370 | Ga0495650_0049782 | 3300046471 | Bacteria | 1737 |
| 371 | Ga0495650_0057233 | 3300046471 | Bacteria | 1578 |
| 372 | Ga0495580_0200955 | 3300046472 | Bacteria | 1373 |
| 373 | Ga0495605_0026001 | 3300046474 | Bacteria | 3045 |
| 374 | Ga0495605_0049188 | 3300046474 | Bacteria | 2060 |
| 375 | Ga0495605_0123030 | 3300046474 | Bacteria | 1175 |
| 376 | Ga0495639_0002507 | 3300046475 | Bacteria | 8008 |
| 377 | Ga0495639_0053748 | 3300046475 | Bacteria | 1835 |
| 378 | Ga0495639_0601398 | 3300046475 | Bacteria | 565 |
| 379 | Ga0495584_0010855 | 3300046491 | Bacteria | 4674 |
| 380 | Ga0495584_0135646 | 3300046491 | Bacteria | 1249 |
| 381 | Ga0495584_0416303 | 3300046491 | Bacteria | 683 |
| 382 | Ga0495585_0006492 | 3300046492 | Bacteria | 7247 |
| 383 | Ga0495585_0015212 | 3300046492 | Bacteria | 4471 |
| 384 | Ga0495585_0018275 | 3300046492 | Bacteria | 4046 |
| 385 | Ga0495594_0017438 | 3300046499 | Bacteria | 3795 |
| 386 | Ga0495596_0009030 | 3300046500 | Bacteria | 4406 |
| 387 | Ga0495596_0052679 | 3300046500 | Bacteria | 1593 |
| 388 | Ga0495607_0006191 | 3300046501 | Bacteria | 8454 |
| 389 | Ga0495607_0010371 | 3300046501 | Bacteria | 6267 |
| 390 | Ga0495607_0023358 | 3300046501 | Bacteria | 3871 |
| 391 | Ga0495607_0027948 | 3300046501 | Bacteria | 3483 |
| 392 | Ga0495607_0043926 | 3300046501 | Bacteria | 2638 |
| 393 | Ga0495607_0055803 | 3300046501 | Bacteria | 2270 |
| 394 | Ga0495607_0139900 | 3300046501 | Bacteria | 1249 |
| 395 | Ga0495607_0267865 | 3300046501 | Bacteria | 815 |
| 396 | Ga0495583_0009218 | 3300046506 | Bacteria | 5918 |
| 397 | Ga0495583_0012785 | 3300046506 | Bacteria | 4726 |
| 398 | Ga0495583_0135363 | 3300046506 | Bacteria | 1029 |
| 399 | Ga0495606_0003047 | 3300046507 | Bacteria | 18265 |
| 400 | Ga0495606_0015732 | 3300046507 | Bacteria | 5809 |
| 401 | Ga0495606_0016386 | 3300046507 | Bacteria | 5653 |
| 402 | Ga0495606_0022242 | 3300046507 | Bacteria | 4624 |
| 403 | Ga0495606_0053975 | 3300046507 | Bacteria | 2604 |
| 404 | Ga0495606_0231021 | 3300046507 | Bacteria | 1036 |
| 405 | Ga0495610_0013527 | 3300046512 | Bacteria | 4847 |
| 406 | Ga0495610_0013908 | 3300046512 | Bacteria | 4754 |
| 407 | Ga0495610_0013963 | 3300046512 | Bacteria | 4746 |
| 408 | Ga0495610_0020334 | 3300046512 | Bacteria | 3687 |
| 409 | Ga0495610_0020848 | 3300046512 | Bacteria | 3623 |
| 410 | Ga0495610_0024945 | 3300046512 | Bacteria | 3219 |
| 411 | Ga0495610_0151567 | 3300046512 | Bacteria | 988 |
| 412 | Ga0495616_0012861 | 3300046513 | Bacteria | 4735 |
| 413 | Ga0495616_0013844 | 3300046513 | Bacteria | 4535 |
| 414 | Ga0495616_0022830 | 3300046513 | Bacteria | 3373 |
| 415 | Ga0495616_0345568 | 3300046513 | Unclassified | 620 |
| 416 | Ga0495620_0000541 | 3300046515 | Bacteria | 24054 |
| 417 | Ga0495620_0001018 | 3300046515 | Bacteria | 17248 |
| 418 | Ga0495620_0013871 | 3300046515 | Bacteria | 4112 |
| 419 | Ga0495620_0016550 | 3300046515 | Bacteria | 3695 |
| 420 | Ga0495620_0079755 | 3300046515 | Bacteria | 1325 |
| 421 | Ga0495620_0087104 | 3300046515 | Bacteria | 1256 |
| 422 | Ga0495620_0410529 | 3300046515 | Bacteria | 513 |
| 423 | Ga0495628_0016960 | 3300046516 | Bacteria | 6069 |
| 424 | Ga0495630_0299202 | 3300046517 | Bacteria | 1229 |
| 425 | Ga0495631_0006632 | 3300046518 | Bacteria | 5952 |
| 426 | Ga0495631_0011766 | 3300046518 | Bacteria | 4292 |
| 427 | Ga0495631_0082780 | 3300046518 | Bacteria | 1383 |
| 428 | Ga0495631_0287733 | 3300046518 | Bacteria | 699 |
| 429 | Ga0495632_0006763 | 3300046519 | Bacteria | 7327 |
| 430 | Ga0495632_0012829 | 3300046519 | Bacteria | 4809 |
| 431 | Ga0495632_0014412 | 3300046519 | Bacteria | 4473 |
| 432 | Ga0495632_0019451 | 3300046519 | Bacteria | 3698 |
| 433 | Ga0495632_0019635 | 3300046519 | Bacteria | 3676 |
| 434 | Ga0495632_0020449 | 3300046519 | Bacteria | 3583 |
| 435 | Ga0495632_0032082 | 3300046519 | Bacteria | 2709 |
| 436 | Ga0495632_0144123 | 3300046519 | Bacteria | 1104 |
| 437 | Ga0495632_0226960 | 3300046519 | Bacteria | 843 |
| 438 | Ga0495637_0006188 | 3300046520 | Bacteria | 6022 |
| 439 | Ga0495637_0010276 | 3300046520 | Bacteria | 4534 |
| 440 | Ga0495637_0039629 | 3300046520 | Bacteria | 2032 |
| 441 | Ga0495637_0111858 | 3300046520 | Bacteria | 1057 |
| 442 | Ga0495637_0365829 | 3300046520 | Bacteria | 504 |
| 443 | Ga0495643_0014153 | 3300046522 | Bacteria | 4754 |
| 444 | Ga0495643_0322346 | 3300046522 | Bacteria | 698 |
| 445 | Ga0495644_0005943 | 3300046523 | Bacteria | 4758 |
| 446 | Ga0495644_0036428 | 3300046523 | Bacteria | 1856 |
| 447 | Ga0495648_0022907 | 3300046524 | Bacteria | 4288 |
| 448 | Ga0495648_0033869 | 3300046524 | Bacteria | 3331 |
| 449 | Ga0495648_0064488 | 3300046524 | Bacteria | 2157 |
| 450 | Ga0495648_0069849 | 3300046524 | Bacteria | 2043 |
| 451 | Ga0495648_0159098 | 3300046524 | Bacteria | 1169 |
| 452 | Ga0495648_0483429 | 3300046524 | Bacteria | 534 |
| 453 | Ga0495666_0022371 | 3300046526 | Bacteria | 3130 |
| 454 | Ga0495666_0136323 | 3300046526 | Bacteria | 1145 |
| 455 | Ga0495666_0299437 | 3300046526 | Bacteria | 727 |
| 456 | Ga0495652_0100729 | 3300046529 | Bacteria | 2343 |
| 457 | Ga0495654_0007901 | 3300046530 | Bacteria | 5914 |
| 458 | Ga0495654_0011506 | 3300046530 | Bacteria | 4784 |
| 459 | Ga0495654_0012204 | 3300046530 | Bacteria | 4622 |
| 460 | Ga0495654_0012426 | 3300046530 | Bacteria | 4573 |
| 461 | Ga0495654_0016147 | 3300046530 | Bacteria | 3952 |
| 462 | Ga0495654_0020443 | 3300046530 | Bacteria | 3449 |
| 463 | Ga0495654_0036912 | 3300046530 | Bacteria | 2454 |
| 464 | Ga0495654_0061131 | 3300046530 | Bacteria | 1809 |
| 465 | Ga0495654_0063005 | 3300046530 | Bacteria | 1776 |
| 466 | Ga0495654_0087461 | 3300046530 | Bacteria | 1450 |
| 467 | Ga0495654_0114126 | 3300046530 | Bacteria | 1229 |
| 468 | Ga0495665_0530551 | 3300046531 | Bacteria | 592 |
| 469 | Ga0495587_0007914 | 3300046536 | Bacteria | 6864 |
| 470 | Ga0495587_0078080 | 3300046536 | Bacteria | 1921 |
| 471 | Ga0495609_0006215 | 3300046538 | Bacteria | 6134 |
| 472 | Ga0495609_0007044 | 3300046538 | Bacteria | 5661 |
| 473 | Ga0495609_0009365 | 3300046538 | Bacteria | 4742 |
| 474 | Ga0495609_0009379 | 3300046538 | Bacteria | 4736 |
| 475 | Ga0495609_0372002 | 3300046538 | Bacteria | 574 |
| 476 | Ga0495597_0005919 | 3300046542 | Bacteria | 6385 |
| 477 | Ga0495597_0010124 | 3300046542 | Bacteria | 4620 |
| 478 | Ga0495622_0003103 | 3300046557 | Bacteria | 7875 |
| 479 | Ga0495622_0008899 | 3300046557 | Bacteria | 4652 |
| 480 | Ga0495622_0051517 | 3300046557 | Bacteria | 1909 |
| 481 | Ga0495633_0011913 | 3300046558 | Bacteria | 4654 |
| 482 | Ga0495633_0032628 | 3300046558 | Bacteria | 2515 |
| 483 | Ga0495668_0009771 | 3300046616 | Bacteria | 5856 |
| 484 | Ga0495668_0063413 | 3300046616 | Bacteria | 2035 |
| 485 | Ga0495668_0552460 | 3300046616 | Bacteria | 635 |
| 486 | Ga0495634_0010409 | 3300046642 | Bacteria | 6814 |
| 487 | Ga0495634_0021710 | 3300046642 | Bacteria | 4532 |
| 488 | Ga0495611_0000533 | 3300046648 | Bacteria | 22444 |
| 489 | Ga0495611_0028320 | 3300046648 | Bacteria | 2452 |
| 490 | Ga0495625_0014932 | 3300046660 | Bacteria | 6174 |
| 491 | Ga0495625_0022059 | 3300046660 | Bacteria | 4888 |
| 492 | Ga0495625_0033324 | 3300046660 | Bacteria | 3810 |
| 493 | Ga0495625_0049401 | 3300046660 | Bacteria | 3024 |
| 494 | Ga0495625_0089576 | 3300046660 | Bacteria | 2129 |
| 495 | Ga0495635_0009500 | 3300046663 | Bacteria | 6797 |
| 496 | Ga0495659_0001182 | 3300046664 | Bacteria | 9064 |
| 497 | Ga0495659_0003189 | 3300046664 | Bacteria | 5253 |
| 498 | Ga0495661_0001773 | 3300046665 | Bacteria | 17355 |
| 499 | Ga0495661_0011567 | 3300046665 | Bacteria | 5983 |
| 500 | Ga0495661_0017508 | 3300046665 | Bacteria | 4730 |
| 501 | Ga0495661_0025390 | 3300046665 | Bacteria | 3827 |
| 502 | Ga0495661_0051810 | 3300046665 | Bacteria | 2476 |
| 503 | Ga0495661_0114022 | 3300046665 | Bacteria | 1502 |
| 504 | Ga0495588_0038419 | 3300046674 | Bacteria | 2435 |
| 505 | Ga0495588_0284052 | 3300046674 | Bacteria | 872 |
| 506 | Ga0495623_0008751 | 3300046679 | Bacteria | 6572 |
| 507 | Ga0495623_0272578 | 3300046679 | Bacteria | 944 |
| 508 | Ga0495646_0015656 | 3300046680 | Bacteria | 4812 |
| 509 | Ga0495646_0030269 | 3300046680 | Bacteria | 3380 |
| 510 | Ga0495613_0019131 | 3300046689 | Bacteria | 5104 |
| 511 | Ga0495613_0042719 | 3300046689 | Bacteria | 3354 |
| 512 | Ga0495624_0006645 | 3300046690 | Bacteria | 8175 |
| 513 | Ga0495670_0004726 | 3300046691 | Bacteria | 6688 |
| 514 | Ga0495670_0005868 | 3300046691 | Bacteria | 6019 |
| 515 | Ga0495670_0009600 | 3300046691 | Bacteria | 4753 |
| 516 | Ga0495670_0117443 | 3300046691 | Bacteria | 1380 |
| 517 | Ga0495671_0010571 | 3300046692 | Bacteria | 5102 |
| 518 | Ga0495671_0026540 | 3300046692 | Bacteria | 3002 |
| 519 | Ga0495671_0031948 | 3300046692 | Bacteria | 2689 |
| 520 | Ga0495671_0046125 | 3300046692 | Bacteria | 2179 |
| 521 | Ga0495671_0105579 | 3300046692 | Bacteria | 1375 |
| 522 | Ga0495671_0467173 | 3300046692 | Bacteria | 603 |
| 523 | Ga0495649_0006725 | 3300046694 | Bacteria | 7124 |
| 524 | Ga0495649_0009344 | 3300046694 | Bacteria | 5833 |
| 525 | Ga0495649_0023250 | 3300046694 | Bacteria | 3463 |
| 526 | Ga0495649_0046448 | 3300046694 | Bacteria | 2364 |
| 527 | Ga0495649_0058758 | 3300046694 | Bacteria | 2072 |
| 528 | Ga0495649_0088999 | 3300046694 | Bacteria | 1646 |
| 529 | Ga0495589_0006201 | 3300046794 | Bacteria | 6313 |
| 530 | Ga0495589_0006708 | 3300046794 | Bacteria | 6063 |
| 531 | Ga0495589_0010389 | 3300046794 | Bacteria | 4836 |
| 532 | Ga0495589_0106710 | 3300046794 | Bacteria | 1353 |
| 533 | Ga0495589_0243403 | 3300046794 | Bacteria | 841 |
| 534 | Ga0495589_0272186 | 3300046794 | Bacteria | 788 |
| 535 | Ga0495600_0128351 | 3300046809 | Bacteria | 1648 |
| 536 | Ga0495660_0007512 | 3300046810 | Bacteria | 6398 |
| 537 | Ga0495660_0014390 | 3300046810 | Bacteria | 4578 |
| 538 | Ga0495660_0018471 | 3300046810 | Bacteria | 4009 |
| 539 | Ga0495660_0023146 | 3300046810 | Bacteria | 3545 |
| 540 | Ga0495660_0115765 | 3300046810 | Bacteria | 1362 |
| 541 | Ga0495660_0259240 | 3300046810 | Bacteria | 803 |
| 542 | Ga0495604_0027772 | 3300047317 | Bacteria | 4500 |
| 543 | Ga0495604_0028414 | 3300047317 | Bacteria | 4449 |
| 544 | Ga0495674_0062006 | 3300047319 | Bacteria | 3256 |
| 545 | Ga0495672_0009200 | 3300047320 | Bacteria | 7191 |
| 546 | Ga0495672_0012168 | 3300047320 | Bacteria | 6021 |
| 547 | Ga0495672_0018399 | 3300047320 | Bacteria | 4639 |
| 548 | Ga0495672_0084394 | 3300047320 | Bacteria | 1761 |
| 549 | Ga0495676_0027690 | 3300047321 | Bacteria | 4856 |
| 550 | Ga0495676_0033107 | 3300047321 | Bacteria | 4357 |
| 551 | Ga0495680_0022793 | 3300047322 | Bacteria | 5214 |
| 552 | Ga0495680_0033131 | 3300047322 | Bacteria | 4186 |
| 553 | Ga0495680_0816177 | 3300047322 | Bacteria | 608 |
| 554 | Ga0495683_0013590 | 3300047323 | Bacteria | 4254 |
| 555 | Ga0495683_0014986 | 3300047323 | Bacteria | 4038 |
| 556 | Ga0495683_0016497 | 3300047323 | Bacteria | 3835 |
| 557 | Ga0495683_0053431 | 3300047323 | Bacteria | 2015 |
| 558 | Ga0495687_012671 | 3300047443 | Bacteria | 4444 |
| 559 | Ga0495675_0033110 | 3300047444 | Bacteria | 3298 |
| 560 | Ga0495675_0411293 | 3300047444 | Bacteria | 787 |
| 561 | Ga0495679_004782 | 3300047446 | Bacteria | 6131 |
| 562 | Ga0495679_005067 | 3300047446 | Bacteria | 5913 |
| 563 | Ga0495679_006284 | 3300047446 | Bacteria | 5141 |
| 564 | Ga0495679_007342 | 3300047446 | Bacteria | 4606 |
| 565 | Ga0495679_007598 | 3300047446 | Bacteria | 4506 |
| 566 | Ga0495679_009005 | 3300047446 | Bacteria | 4022 |
| 567 | Ga0495679_024829 | 3300047446 | Bacteria | 2013 |
| 568 | Ga0495679_084736 | 3300047446 | Bacteria | 895 |
| 569 | Ga0495673_0012280 | 3300047469 | Bacteria | 4553 |
| 570 | Ga0495673_0034645 | 3300047469 | Bacteria | 2332 |
| 571 | Ga0495673_0039839 | 3300047469 | Bacteria | 2129 |
| 572 | Ga0495673_0067706 | 3300047469 | Bacteria | 1510 |
| 573 | Ga0495681_0007998 | 3300047470 | Bacteria | 6677 |
| 574 | Ga0495681_0013088 | 3300047470 | Bacteria | 4837 |
| 575 | Ga0495681_0014365 | 3300047470 | Bacteria | 4543 |
| 576 | Ga0495681_0015913 | 3300047470 | Bacteria | 4243 |
| 577 | Ga0495681_0017538 | 3300047470 | Bacteria | 3971 |
| 578 | Ga0495681_0021478 | 3300047470 | Bacteria | 3477 |
| 579 | Ga0495681_0031763 | 3300047470 | Bacteria | 2667 |
| 580 | Ga0495684_0027859 | 3300047471 | Bacteria | 4339 |
| 581 | Ga0495686_0017198 | 3300047472 | Bacteria | 4879 |
| 582 | Ga0495686_0028324 | 3300047472 | Bacteria | 3648 |
| 583 | Ga0495686_0391820 | 3300047472 | Bacteria | 747 |
| 584 | Ga0495593_0012674 | 3300047673 | Bacteria | 4814 |
| 585 | Ga0495593_0571116 | 3300047673 | Bacteria | 567 |
| 586 | Ga0495602_0024682 | 3300048088 | Bacteria | 5830 |
| 587 | Ga0495602_0168373 | 3300048088 | Bacteria | 1703 |
| 588 | Ga0495626_0003926 | 3300048091 | Bacteria | 9305 |
| 589 | Ga0495626_0012962 | 3300048091 | Bacteria | 4347 |
| 590 | Ga0495626_0014781 | 3300048091 | Bacteria | 4012 |
| 591 | Ga0495626_0017972 | 3300048091 | Bacteria | 3563 |
| 592 | Ga0495626_0040772 | 3300048091 | Bacteria | 2191 |
| 593 | Ga0495626_0325299 | 3300048091 | Bacteria | 603 |
| 594 | Ga0496102_0015028 | 3300048905 | Bacteria | 6737 |
| 595 | Ga0496103_0007043 | 3300048906 | Bacteria | 6712 |
| 596 | Ga0496112_0868947 | 3300048915 | Bacteria | 825 |
| 597 | Ga0496116_0010235 | 3300048919 | Bacteria | 7887 |
| 598 | Ga0496116_0011881 | 3300048919 | Bacteria | 7163 |
| 599 | Ga0496116_0014498 | 3300048919 | Bacteria | 6289 |
| 600 | Ga0496116_0045697 | 3300048919 | Bacteria | 2961 |
| 601 | Ga0496116_0064715 | 3300048919 | Bacteria | 2349 |
| 602 | Ga0496116_0290925 | 3300048919 | Bacteria | 784 |
| 603 | Ga0496117_0003788 | 3300048920 | Bacteria | 17261 |
| 604 | Ga0496117_0015710 | 3300048920 | Bacteria | 6429 |
| 605 | Ga0496117_0017174 | 3300048920 | Bacteria | 6056 |
| 606 | Ga0496117_0017394 | 3300048920 | Bacteria | 6002 |
| 607 | Ga0496117_0024137 | 3300048920 | Bacteria | 4820 |
| 608 | Ga0496117_0024269 | 3300048920 | Bacteria | 4801 |
| 609 | Ga0496117_0038709 | 3300048920 | Bacteria | 3531 |
| 610 | Ga0496117_0040078 | 3300048920 | Bacteria | 3450 |
| 611 | Ga0496117_0047714 | 3300048920 | Bacteria | 3068 |
| 612 | Ga0496118_0021090 | 3300048921 | Bacteria | 5749 |
| 613 | Ga0496118_0021928 | 3300048921 | Bacteria | 5602 |
| 614 | Ga0496118_0026565 | 3300048921 | Bacteria | 4927 |
| 615 | Ga0496118_0026643 | 3300048921 | Bacteria | 4917 |
| 616 | Ga0496118_0044946 | 3300048921 | Bacteria | 3452 |
| 617 | Ga0496118_0072353 | 3300048921 | Bacteria | 2476 |
| 618 | Ga0496118_0151486 | 3300048921 | Bacteria | 1451 |
| 619 | Ga0496118_0490780 | 3300048921 | Bacteria | 613 |
| 620 | Ga0496118_0635397 | 3300048921 | Bacteria | 504 |
| 621 | Ga0496119_0003234 | 3300048922 | Bacteria | 17056 |
| 622 | Ga0496119_0014700 | 3300048922 | Bacteria | 6098 |
| 623 | Ga0496119_0034340 | 3300048922 | Bacteria | 3343 |
| 624 | Ga0496119_0050935 | 3300048922 | Bacteria | 2548 |
| 625 | Ga0496119_0320503 | 3300048922 | Bacteria | 759 |
| 626 | Ga0496120_0002734 | 3300048923 | Bacteria | 17217 |
| 627 | Ga0496120_0011264 | 3300048923 | Bacteria | 6164 |
| 628 | Ga0496120_0027552 | 3300048923 | Bacteria | 3492 |
| 629 | Ga0496120_0040869 | 3300048923 | Bacteria | 2721 |
| 630 | Ga0496121_0027608 | 3300048924 | Bacteria | 5308 |
| 631 | Ga0496121_0037018 | 3300048924 | Bacteria | 4339 |
| 632 | Ga0496121_0102499 | 3300048924 | Bacteria | 2204 |
| 633 | Ga0496121_0108652 | 3300048924 | Bacteria | 2121 |
| 634 | Ga0496121_0159886 | 3300048924 | Bacteria | 1649 |
| 635 | Ga0496121_0549821 | 3300048924 | Bacteria | 722 |
| 636 | Ga0496122_0009759 | 3300048925 | Bacteria | 10028 |
| 637 | Ga0496122_0025352 | 3300048925 | Bacteria | 5152 |
| 638 | Ga0496122_0038137 | 3300048925 | Bacteria | 3855 |
| 639 | Ga0496122_0052514 | 3300048925 | Bacteria | 3084 |
| 640 | Ga0496122_0053026 | 3300048925 | Bacteria | 3061 |
| 641 | Ga0496122_0055181 | 3300048925 | Bacteria | 2976 |
| 642 | Ga0496122_0473332 | 3300048925 | Bacteria | 615 |
| 643 | Ga0496122_0615068 | 3300048925 | Bacteria | 506 |
| 644 | Ga0496123_0017780 | 3300048926 | Bacteria | 5697 |
| 645 | Ga0496123_0019673 | 3300048926 | Bacteria | 5316 |
| 646 | Ga0496123_0036289 | 3300048926 | Bacteria | 3498 |
| 647 | Ga0496123_0041895 | 3300048926 | Bacteria | 3168 |
| 648 | Ga0496123_0140762 | 3300048926 | Bacteria | 1319 |
| 649 | Ga0496124_0001360 | 3300048927 | Bacteria | 36640 |
| 650 | Ga0496124_0004110 | 3300048927 | Bacteria | 17199 |
| 651 | Ga0496124_0020023 | 3300048927 | Bacteria | 6198 |
| 652 | Ga0496124_0032675 | 3300048927 | Bacteria | 4589 |
| 653 | Ga0496124_0038867 | 3300048927 | Bacteria | 4128 |
| 654 | Ga0496124_0047130 | 3300048927 | Bacteria | 3688 |
| 655 | Ga0496124_0049803 | 3300048927 | Bacteria | 3571 |
| 656 | Ga0496124_0063583 | 3300048927 | Bacteria | 3082 |
| 657 | Ga0496124_0461017 | 3300048927 | Bacteria | 863 |
| 658 | Ga0496125_0001314 | 3300048928 | Bacteria | 36791 |
| 659 | Ga0496125_0004031 | 3300048928 | Bacteria | 17234 |
| 660 | Ga0496125_0026261 | 3300048928 | Bacteria | 5311 |
| 661 | Ga0496125_0026595 | 3300048928 | Bacteria | 5267 |
| 662 | Ga0496125_0032567 | 3300048928 | Bacteria | 4629 |
| 663 | Ga0496125_0037057 | 3300048928 | Bacteria | 4245 |
| 664 | Ga0496125_0040000 | 3300048928 | Bacteria | 4028 |
| 665 | Ga0496125_0090000 | 3300048928 | Bacteria | 2305 |
| 666 | Ga0496125_0095654 | 3300048928 | Bacteria | 2208 |
| 667 | Ga0496126_0001465 | 3300048929 | Bacteria | 36787 |
| 668 | Ga0496126_0036152 | 3300048929 | Bacteria | 4620 |
| 669 | Ga0496126_0042232 | 3300048929 | Bacteria | 4212 |
| 670 | Ga0496126_0067566 | 3300048929 | Bacteria | 3193 |
| 671 | Ga0496126_0080917 | 3300048929 | Bacteria | 2873 |
| 672 | Ga0496126_0489283 | 3300048929 | Bacteria | 985 |
| 673 | Ga0495678_006294 | 3300049459 | Bacteria | 6332 |
| 674 | Ga0495678_010004 | 3300049459 | Bacteria | 4639 |
| 675 | Ga0495678_010014 | 3300049459 | Bacteria | 4635 |
| 676 | Ga0495678_026192 | 3300049459 | Bacteria | 2493 |
| 677 | Ga0495678_031863 | 3300049459 | Bacteria | 2193 |
| 678 | Ga0495678_033723 | 3300049459 | Bacteria | 2111 |
| 679 | Ga0495678_042164 | 3300049459 | Bacteria | 1820 |
| 680 | Ga0495678_050096 | 3300049459 | Bacteria | 1620 |
| 681 | Ga0495682_0004569 | 3300049460 | Bacteria | 5894 |
| 682 | Ga0495682_0144744 | 3300049460 | Bacteria | 848 |
| 683 | Ga0501235_004019 | 3300049669 | Bacteria | 3184 |
| 684 | Ga0501241_001529 | 3300049758 | Bacteria | 4668 |
| 685 | nmdc:mga00v17_32366_c1 | 3300050491 | Bacteria | 3090 |
| 686 | Ga0500644_0120422 | 3300053088 | Bacteria | 1022 |
| 687 | Ga0500572_002223 | 3300053111 | Bacteria | 4737 |
| 688 | Ga0500621_040931 | 3300053126 | Bacteria | 1869 |
| 689 | Ga0500634_0005727 | 3300053161 | Bacteria | 5937 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042138 | Ga0450903_042307 | Ga0450903_042307_460_639 | 59 |
| 2 | 3300042145 | Ga0450906_076923 | Ga0450906_076923_342_521 | 59 |
| 3 | 3300046491 | Ga0495584_0135646 | Ga0495584_0135646_88_267 | 59 |
| 4 | 3300046501 | Ga0495607_0055803 | Ga0495607_0055803_28_207 | 59 |
| 5 | 3300046519 | Ga0495632_0014412 | Ga0495632_0014412_391_570 | 59 |
| 6 | 3300046530 | Ga0495654_0114126 | Ga0495654_0114126_11_190 | 59 |
| 7 | 3300046538 | Ga0495609_0007044 | Ga0495609_0007044_1553_1732 | 59 |
| 8 | 3300046694 | Ga0495649_0006725 | Ga0495649_0006725_3930_4109 | 59 |
| 9 | 3300047443 | Ga0495687_012671 | Ga0495687_012671_3703_3882 | 59 |
| 10 | 3300048091 | Ga0495626_0003926 | Ga0495626_0003926_5205_5384 | 59 |
| 11 | 3300009011 | Ga0105251_10016148 | Ga0105251_100161484 | 64 |
| 12 | 3300009011 | Ga0105251_10048612 | Ga0105251_100486123 | 64 |
| 13 | 3300009036 | Ga0105244_10012245 | Ga0105244_100122455 | 64 |
| 14 | 3300013100 | Ga0157373_10027040 | Ga0157373_100270402 | 64 |
| 15 | 3300013100 | Ga0157373_10062807 | Ga0157373_100628073 | 64 |
| 16 | 3300013102 | Ga0157371_10036018 | Ga0157371_100360182 | 64 |
| 17 | 3300013104 | Ga0157370_10039583 | Ga0157370_100395833 | 64 |
| 18 | 3300013105 | Ga0157369_10062767 | Ga0157369_100627672 | 64 |
| 19 | 3300013307 | Ga0157372_10060956 | Ga0157372_100609562 | 64 |
| 20 | 3300014497 | Ga0182008_10007839 | Ga0182008_100078395 | 64 |
| 21 | 3300015261 | Ga0182006_1015770 | Ga0182006_10157703 | 64 |
| 22 | 3300015261 | Ga0182006_1084722 | Ga0182006_10847222 | 64 |
| 23 | 3300042013 | Ga0439456_009554 | Ga0439456_009554_1215_1409 | 64 |
| 24 | 3300042139 | Ga0450904_022331 | Ga0450904_022331_120_314 | 64 |
| 25 | 3300042533 | Ga0450901_000311 | Ga0450901_000311_3130_3324 | 64 |
| 26 | 3300046453 | Ga0495627_004239 | Ga0495627_004239_2735_2929 | 64 |
| 27 | 3300046454 | Ga0495592_0030778 | Ga0495592_0030778_1145_1339 | 64 |
| 28 | 3300046458 | Ga0495591_007252 | Ga0495591_007252_1539_1733 | 64 |
| 29 | 3300046460 | Ga0495638_0011165 | Ga0495638_0011165_2728_2922 | 64 |
| 30 | 3300046463 | Ga0495653_0076256 | Ga0495653_0076256_131_325 | 64 |
| 31 | 3300046472 | Ga0495580_0200955 | Ga0495580_0200955_990_1184 | 64 |
| 32 | 3300046474 | Ga0495605_0123030 | Ga0495605_0123030_335_529 | 64 |
| 33 | 3300046491 | Ga0495584_0010855 | Ga0495584_0010855_2900_3094 | 64 |
| 34 | 3300046500 | Ga0495596_0052679 | Ga0495596_0052679_12_206 | 64 |
| 35 | 3300046512 | Ga0495610_0013527 | Ga0495610_0013527_2404_2598 | 64 |
| 36 | 3300046519 | Ga0495632_0020449 | Ga0495632_0020449_1612_1806 | 64 |
| 37 | 3300046519 | Ga0495632_0226960 | Ga0495632_0226960_270_464 | 64 |
| 38 | 3300046520 | Ga0495637_0365829 | Ga0495637_0365829_210_404 | 64 |
| 39 | 3300046524 | Ga0495648_0033869 | Ga0495648_0033869_1598_1792 | 64 |
| 40 | 3300046526 | Ga0495666_0022371 | Ga0495666_0022371_357_551 | 64 |
| 41 | 3300046536 | Ga0495587_0078080 | Ga0495587_0078080_608_802 | 64 |
| 42 | 3300046542 | Ga0495597_0005919 | Ga0495597_0005919_3415_3609 | 64 |
| 43 | 3300046642 | Ga0495634_0021710 | Ga0495634_0021710_1648_1842 | 64 |
| 44 | 3300046660 | Ga0495625_0022059 | Ga0495625_0022059_2476_2670 | 64 |
| 45 | 3300046674 | Ga0495588_0038419 | Ga0495588_0038419_223_417 | 64 |
| 46 | 3300046679 | Ga0495623_0272578 | Ga0495623_0272578_28_222 | 64 |
| 47 | 3300046680 | Ga0495646_0030269 | Ga0495646_0030269_801_995 | 64 |
| 48 | 3300046689 | Ga0495613_0019131 | Ga0495613_0019131_1683_1877 | 64 |
| 49 | 3300046690 | Ga0495624_0006645 | Ga0495624_0006645_3120_3314 | 64 |
| 50 | 3300046692 | Ga0495671_0010571 | Ga0495671_0010571_2241_2435 | 64 |
| 51 | 3300046809 | Ga0495600_0128351 | Ga0495600_0128351_308_502 | 64 |
| 52 | 3300047317 | Ga0495604_0027772 | Ga0495604_0027772_422_616 | 64 |
| 53 | 3300047320 | Ga0495672_0012168 | Ga0495672_0012168_4079_4273 | 64 |
| 54 | 3300047321 | Ga0495676_0027690 | Ga0495676_0027690_1724_1918 | 64 |
| 55 | 3300047322 | Ga0495680_0033131 | Ga0495680_0033131_2960_3154 | 64 |
| 56 | 3300047444 | Ga0495675_0411293 | Ga0495675_0411293_407_601 | 64 |
| 57 | 3300047470 | Ga0495681_0007998 | Ga0495681_0007998_3185_3379 | 64 |
| 58 | 3300047471 | Ga0495684_0027859 | Ga0495684_0027859_1379_1573 | 64 |
| 59 | 3300047673 | Ga0495593_0012674 | Ga0495593_0012674_2952_3146 | 64 |
| 60 | 3300048088 | Ga0495602_0024682 | Ga0495602_0024682_1721_1915 | 64 |
| 61 | 3300048091 | Ga0495626_0017972 | Ga0495626_0017972_11_205 | 64 |
| 62 | 3300048919 | Ga0496116_0064715 | Ga0496116_0064715_456_650 | 64 |
| 63 | 3300048920 | Ga0496117_0040078 | Ga0496117_0040078_1543_1737 | 64 |
| 64 | 3300048921 | Ga0496118_0044946 | Ga0496118_0044946_1714_1908 | 64 |
| 65 | 3300048922 | Ga0496119_0050935 | Ga0496119_0050935_1332_1526 | 64 |
| 66 | 3300048923 | Ga0496120_0027552 | Ga0496120_0027552_1677_1871 | 64 |
| 67 | 3300048924 | Ga0496121_0108652 | Ga0496121_0108652_390_584 | 64 |
| 68 | 3300048927 | Ga0496124_0049803 | Ga0496124_0049803_1665_1859 | 64 |
| 69 | 3300049460 | Ga0495682_0144744 | Ga0495682_0144744_16_210 | 64 |
| 70 | iso_pu_bacteria | 2511231006 | 2511264533 | 66 |
| 71 | iso_pu_bacteria | 2511231010 | 2511290117 | 66 |
| 72 | iso_pu_bacteria | 2511231011 | 2511295643 | 66 |
| 73 | iso_pu_bacteria | 2511231012 | 2511299761 | 66 |
| 74 | iso_pu_bacteria | 2511231016 | 2511326657 | 66 |
| 75 | iso_pu_bacteria | 2511231018 | 2511338857 | 66 |
| 76 | iso_pu_bacteria | 2511231019 | 2511343942 | 66 |
| 77 | iso_pu_bacteria | 2511231023 | 2511366579 | 66 |
| 78 | iso_pu_bacteria | 2511231031 | 2511410958 | 66 |
| 79 | iso_pu_bacteria | 2511231156 | 2511823175 | 66 |
| 80 | iso_pu_bacteria | 2512047018 | 2512326278 | 66 |
| 81 | iso_pu_bacteria | 2582580891 | 2583790832 | 66 |
| 82 | iso_pu_bacteria | 2597489887 | 2597856405 | 66 |
| 83 | iso_pu_bacteria | 2597489888 | 2597862443 | 66 |
| 84 | iso_pu_bacteria | 2597489889 | 2597868202 | 66 |
| 85 | iso_pu_bacteria | 2599185179 | 2599448941 | 66 |
| 86 | iso_pu_bacteria | 2599185185 | 2599483342 | 66 |
| 87 | iso_pu_bacteria | 2599185188 | 2599501278 | 66 |
| 88 | iso_pu_bacteria | 2599185189 | 2599508928 | 66 |
| 89 | iso_pu_bacteria | 2599185191 | 2599517760 | 66 |
| 90 | iso_pu_bacteria | 2599185212 | 2599616356 | 66 |
| 91 | iso_pu_bacteria | 2599185248 | 2599770639 | 66 |
| 92 | iso_pu_bacteria | 2599185257 | 2599805245 | 66 |
| 93 | iso_pu_bacteria | 2599185288 | 2599879756 | 66 |
| 94 | iso_pu_bacteria | 2599185289 | 2599886521 | 66 |
| 95 | iso_pu_bacteria | 2599185291 | 2599896886 | 66 |
| 96 | iso_pu_bacteria | 2599185300 | 2599934003 | 66 |
| 97 | iso_pu_bacteria | 2599185302 | 2599945583 | 66 |
| 98 | iso_pu_bacteria | 2599185303 | 2599948266 | 66 |
| 99 | iso_pu_bacteria | 2599185304 | 2599957519 | 66 |
| 100 | iso_pu_bacteria | 2599185305 | 2599959579 | 66 |
| 101 | iso_pu_bacteria | 2599185306 | 2599966174 | 66 |
| 102 | iso_pu_bacteria | 2599185308 | 2599978212 | 66 |
| 103 | iso_pu_bacteria | 2599185309 | 2599986032 | 66 |
| 104 | iso_pu_bacteria | 2599185310 | 2599987124 | 66 |
| 105 | iso_pu_bacteria | 2599185311 | 2599996981 | 66 |
| 106 | iso_pu_bacteria | 2599185312 | 2600002583 | 66 |
| 107 | iso_pu_bacteria | 2599185313 | 2600006425 | 66 |
| 108 | iso_pu_bacteria | 2599185314 | 2600012318 | 66 |
| 109 | iso_pu_bacteria | 2599185315 | 2600016774 | 66 |
| 110 | iso_pu_bacteria | 2599185316 | 2600024812 | 66 |
| 111 | iso_pu_bacteria | 2599185317 | 2600032856 | 66 |
| 112 | iso_pu_bacteria | 2599185318 | 2600035374 | 66 |
| 113 | iso_pu_bacteria | 2599185319 | 2600041222 | 66 |
| 114 | iso_pu_bacteria | 2599185320 | 2600045447 | 66 |
| 115 | iso_pu_bacteria | 2599185321 | 2600054840 | 66 |
| 116 | iso_pu_bacteria | 2599185322 | 2600058344 | 66 |
| 117 | iso_pu_bacteria | 2599185323 | 2600063980 | 66 |
| 118 | iso_pu_bacteria | 2599185324 | 2600073104 | 66 |
| 119 | iso_pu_bacteria | 2599185325 | 2600079396 | 66 |
| 120 | iso_pu_bacteria | 2600254930 | 2600360093 | 66 |
| 121 | iso_pu_bacteria | 2600254931 | 2600363954 | 66 |
| 122 | iso_pu_bacteria | 2600255296 | 2601691024 | 66 |
| 123 | iso_pu_bacteria | 2600255318 | 2601800223 | 66 |
| 124 | iso_pu_bacteria | 2603880185 | 2606074510 | 66 |
| 125 | iso_pu_bacteria | 2603880199 | 2606127373 | 66 |
| 126 | iso_pu_bacteria | 2619619299 | 2621301430 | 66 |
| 127 | iso_pu_bacteria | 2623620443 | 2624478975 | 66 |
| 128 | iso_pu_bacteria | 2643221571 | 2643868738 | 66 |
| 129 | iso_pu_bacteria | 2643221713 | 2644624125 | 66 |
| 130 | iso_pu_bacteria | 2667528170 | 2671092242 | 66 |
| 131 | iso_pu_bacteria | 2667528176 | 2671127516 | 66 |
| 132 | iso_pu_bacteria | 2671180172 | 2671768020 | 66 |
| 133 | iso_pu_bacteria | 2675903420 | 2677897605 | 66 |
| 134 | iso_pu_bacteria | 2675903515 | 2678261714 | 66 |
| 135 | iso_pu_bacteria | 2713897148 | 2715752888 | 66 |
| 136 | iso_pu_bacteria | 2713897149 | 2715758696 | 66 |
| 137 | iso_pu_bacteria | 2718217725 | 2718632862 | 66 |
| 138 | iso_pu_bacteria | 2721755607 | 2723247335 | 66 |
| 139 | iso_pu_bacteria | 2738541265 | 2738673651 | 66 |
| 140 | iso_pu_bacteria | 2738541282 | 2738752044 | 66 |
| 141 | iso_pu_bacteria | 2738541294 | 2738809218 | 66 |
| 142 | iso_pu_bacteria | 2738541303 | 2738861085 | 66 |
| 143 | iso_pu_bacteria | 2738541309 | 2738896578 | 66 |
| 144 | iso_pu_bacteria | 2738543025 | 2739312931 | 66 |
| 145 | iso_pu_bacteria | 2740892503 | 2743735817 | 66 |
| 146 | iso_pu_bacteria | 2744054620 | 2745008063 | 66 |
| 147 | iso_pu_bacteria | 2773857673 | 2774136232 | 66 |
| 148 | iso_pu_bacteria | 2784132063 | 2784260301 | 66 |
| 149 | iso_pu_bacteria | 2791355520 | 2794594501 | 66 |
| 150 | iso_pu_bacteria | 2808606361 | 2808858968 | 66 |
| 151 | iso_pu_bacteria | 2808606376 | 2808927239 | 66 |
| 152 | iso_pu_bacteria | 2808606378 | 2808939054 | 66 |
| 153 | iso_pu_bacteria | 2808606380 | 2808949358 | 66 |
| 154 | iso_pu_bacteria | 2808606382 | 2808960373 | 66 |
| 155 | iso_pu_bacteria | 2808606383 | 2808967470 | 66 |
| 156 | iso_pu_bacteria | 2808606385 | 2808975364 | 66 |
| 157 | iso_pu_bacteria | 2808606388 | 2808990997 | 66 |
| 158 | iso_pu_bacteria | 2808606389 | 2809002300 | 66 |
| 159 | iso_pu_bacteria | 2808606445 | 2809215970 | 66 |
| 160 | iso_pu_bacteria | 2816332298 | 2817489216 | 66 |
| 161 | iso_pu_bacteria | 2834028612 | 2834029121 | 66 |
| 162 | iso_pu_bacteria | 2842826826 | 2842828831 | 66 |
| 163 | iso_pu_bacteria | 2842832357 | 2842835557 | 66 |
| 164 | iso_pu_bacteria | 2842837860 | 2842842565 | 66 |
| 165 | iso_pu_bacteria | 2842843487 | 2842847299 | 66 |
| 166 | iso_pu_bacteria | 2842854478 | 2842857122 | 66 |
| 167 | iso_pu_bacteria | 2852612431 | 2852615398 | 66 |
| 168 | iso_pu_bacteria | 2852657418 | 2852658474 | 66 |
| 169 | iso_pu_bacteria | 2852667396 | 2852670366 | 66 |
| 170 | iso_pu_bacteria | 2860339153 | 2860340494 | 66 |
| 171 | iso_pu_bacteria | 2860867994 | 2860869143 | 66 |
| 172 | iso_pu_bacteria | 2878029506 | 2878030934 | 66 |
| 173 | iso_pu_bacteria | 2880230671 | 2880231853 | 66 |
| 174 | iso_pu_bacteria | 2904518522 | 2904520888 | 66 |
| 175 | iso_pu_bacteria | 2908446538 | 2908448038 | 66 |
| 176 | iso_pu_bacteria | 2913036834 | 2913038049 | 66 |
| 177 | iso_pu_bacteria | 2919063839 | 2919064552 | 66 |
| 178 | iso_pu_bacteria | 2919385768 | 2919385979 | 66 |
| 179 | iso_pu_bacteria | 2919481497 | 2919482960 | 66 |
| 180 | iso_pu_bacteria | 2919487758 | 2919490768 | 66 |
| 181 | iso_pu_bacteria | 2919697872 | 2919700076 | 66 |
| 182 | iso_pu_bacteria | 2923153595 | 2923154826 | 66 |
| 183 | iso_pu_bacteria | 2923586266 | 2923590827 | 66 |
| 184 | iso_pu_bacteria | 2929189879 | 2929191142 | 66 |
| 185 | iso_pu_bacteria | 2931369376 | 2931371159 | 66 |
| 186 | iso_pu_bacteria | 2931396565 | 2931399603 | 66 |
| 187 | iso_pu_bacteria | 2945928738 | 2945929440 | 66 |
| 188 | iso_pu_bacteria | 2945961074 | 2945965719 | 66 |
| 189 | iso_pu_bacteria | 2946006987 | 2946011703 | 66 |
| 190 | iso_pu_bacteria | 2946027586 | 2946029382 | 66 |
| 191 | iso_pu_bacteria | 2947233263 | 2947235954 | 66 |
| 192 | iso_pu_bacteria | 2969304461 | 2969305759 | 66 |
| 193 | iso_pu_bacteria | 2974289157 | 2974292617 | 66 |
| 194 | iso_pu_bacteria | 2984286254 | 2984291205 | 66 |
| 195 | iso_pu_bacteria | 2988728565 | 2988733041 | 66 |
| 196 | iso_pu_bacteria | 3007395558 | 3007400350 | 66 |
| 197 | iso_pu_bacteria | 3007511990 | 3007512572 | 66 |
| 198 | iso_pu_bacteria | 3007614139 | 3007618236 | 66 |
| 199 | iso_pu_bacteria | 3007718800 | 3007720924 | 66 |
| 200 | iso_pu_bacteria | 3007861166 | 3007863581 | 66 |
| 201 | iso_pu_bacteria | 3007866637 | 3007871398 | 66 |
| 202 | iso_pu_bacteria | 8015687852 | 8015689055 | 66 |
| 203 | iso_pu_bacteria | 8019775933 | 8019776743 | 66 |
| 204 | iso_pu_bacteria | 8029995093 | 8029999566 | 66 |
| 205 | iso_pu_bacteria | 8054285046 | 8054286757 | 66 |
| 206 | iso_pu_bacteria | 8054347763 | 8054348427 | 66 |
| 207 | iso_pu_bacteria | 8055770955 | 8055772174 | 66 |
| 208 | iso_pu_bacteria | 8056143049 | 8056147776 | 66 |
| 209 | iso_pu_bacteria | 8056148874 | 8056149262 | 66 |
| 210 | iso_pu_bacteria | 8056161164 | 8056166758 | 66 |
| 211 | iso_pu_bacteria | 8056172158 | 8056175980 | 66 |
| 212 | iso_pu_bacteria | 8056569372 | 8056569848 | 66 |
| 213 | 3300013100 | Ga0157373_10408416 | Ga0157373_104084162 | 67 |
| 214 | 3300041407 | Ga0439447_047242 | Ga0439447_047242_570_773 | 67 |
| 215 | 3300042006 | Ga0439432_000218 | Ga0439432_000218_2835_3038 | 67 |
| 216 | 3300042131 | Ga0450894_002158 | Ga0450894_002158_1572_1775 | 67 |
| 217 | 3300042133 | Ga0450896_051657 | Ga0450896_051657_89_292 | 67 |
| 218 | 3300042134 | Ga0450898_000324 | Ga0450898_000324_2529_2732 | 67 |
| 219 | 3300046453 | Ga0495627_024034 | Ga0495627_024034_725_928 | 67 |
| 220 | 3300046458 | Ga0495591_036181 | Ga0495591_036181_192_395 | 67 |
| 221 | 3300046507 | Ga0495606_0015732 | Ga0495606_0015732_2211_2414 | 67 |
| 222 | 3300046515 | Ga0495620_0016550 | Ga0495620_0016550_1538_1741 | 67 |
| 223 | 3300046520 | Ga0495637_0010276 | Ga0495637_0010276_1935_2138 | 67 |
| 224 | 3300046524 | Ga0495648_0022907 | Ga0495648_0022907_1639_1842 | 67 |
| 225 | 3300046530 | Ga0495654_0007901 | Ga0495654_0007901_2717_2920 | 67 |
| 226 | 3300046530 | Ga0495654_0012426 | Ga0495654_0012426_2527_2730 | 67 |
| 227 | 3300046794 | Ga0495589_0006708 | Ga0495589_0006708_3016_3219 | 67 |
| 228 | 3300047446 | Ga0495679_005067 | Ga0495679_005067_3043_3246 | 67 |
| 229 | 3300047446 | Ga0495679_007598 | Ga0495679_007598_2281_2484 | 67 |
| 230 | 3300047470 | Ga0495681_0021478 | Ga0495681_0021478_880_1083 | 67 |
| 231 | 3300048920 | Ga0496117_0024137 | Ga0496117_0024137_2692_2895 | 67 |
| 232 | 3300048921 | Ga0496118_0072353 | Ga0496118_0072353_348_551 | 67 |
| 233 | 3300048922 | Ga0496119_0003234 | Ga0496119_0003234_3160_3363 | 67 |
| 234 | 3300048922 | Ga0496119_0034340 | Ga0496119_0034340_1272_1475 | 67 |
| 235 | 3300048923 | Ga0496120_0002734 | Ga0496120_0002734_3144_3347 | 67 |
| 236 | 3300048923 | Ga0496120_0040869 | Ga0496120_0040869_2246_2449 | 67 |
| 237 | 3300048925 | Ga0496122_0038137 | Ga0496122_0038137_3113_3316 | 67 |
| 238 | 3300048925 | Ga0496122_0053026 | Ga0496122_0053026_2845_3048 | 67 |
| 239 | 3300048925 | Ga0496122_0055181 | Ga0496122_0055181_308_511 | 67 |
| 240 | 3300048926 | Ga0496123_0036289 | Ga0496123_0036289_3060_3263 | 67 |
| 241 | 3300048927 | Ga0496124_0047130 | Ga0496124_0047130_2736_2939 | 67 |
| 242 | 3300048928 | Ga0496125_0026595 | Ga0496125_0026595_2373_2576 | 67 |
| 243 | 3300048928 | Ga0496125_0040000 | Ga0496125_0040000_1968_2171 | 67 |
| 244 | 3300048928 | Ga0496125_0090000 | Ga0496125_0090000_1230_1433 | 67 |
| 245 | 3300048928 | Ga0496125_0095654 | Ga0496125_0095654_785_988 | 67 |
| 246 | 3300048929 | Ga0496126_0036152 | Ga0496126_0036152_1870_2073 | 67 |
| 247 | 3300048929 | Ga0496126_0067566 | Ga0496126_0067566_1971_2174 | 67 |
| 248 | 3300009176 | Ga0105242_10001117 | Ga0105242_100011172 | 68 |
| 249 | 2124908027 | MRS2a_Contig_10507 | MRS2a_00390020 | 70 |
| 250 | 3300002737 | JGI25162J39368_1000314 | JGI25162J39368_100031423 | 70 |
| 251 | 3300002738 | JGI25154J39366_1008106 | JGI25154J39366_10081063 | 70 |
| 252 | 3300002771 | JGI25163J39215_1000669 | JGI25163J39215_10006698 | 70 |
| 253 | 3300002772 | JGI25164J39214_1000233 | JGI25164J39214_100023323 | 70 |
| 254 | 3300003214 | JGI25165J46597_1000429 | JGI25165J46597_100042928 | 70 |
| 255 | 3300003751 | Ga0055538_1000073 | Ga0055538_100007350 | 70 |
| 256 | 3300003752 | Ga0055539_1000109 | Ga0055539_100010950 | 70 |
| 257 | 3300003756 | Ga0055533_1000117 | Ga0055533_100011750 | 70 |
| 258 | 3300003758 | Ga0055532_1000120 | Ga0055532_100012073 | 70 |
| 259 | 3300003759 | Ga0055525_1000156 | Ga0055525_100015650 | 70 |
| 260 | 3300003761 | Ga0055535_1012414 | Ga0055535_10124142 | 70 |
| 261 | 3300003781 | Ga0055536_1000217 | Ga0055536_100021734 | 70 |
| 262 | 3300003781 | Ga0055536_1080317 | Ga0055536_10803172 | 70 |
| 263 | 3300003791 | Ga0055530_10000454 | Ga0055530_1000045424 | 70 |
| 264 | 3300003791 | Ga0055530_10000608 | Ga0055530_1000060823 | 70 |
| 265 | 3300003792 | Ga0055540_1000782 | Ga0055540_100078223 | 70 |
| 266 | 3300003792 | Ga0055540_1000856 | Ga0055540_100085624 | 70 |
| 267 | 3300003792 | Ga0055540_1000983 | Ga0055540_100098318 | 70 |
| 268 | 3300003794 | Ga0055531_10000458 | Ga0055531_1000045842 | 70 |
| 269 | 3300003794 | Ga0055531_10081760 | Ga0055531_100817602 | 70 |
| 270 | 3300003841 | Ga0055541_1000074 | Ga0055541_100007450 | 70 |
| 271 | 3300005288 | Ga0065714_10003741 | Ga0065714_100037417 | 70 |
| 272 | 3300005288 | Ga0065714_10073190 | Ga0065714_100731903 | 70 |
| 273 | 3300005288 | Ga0065714_10100675 | Ga0065714_101006752 | 70 |
| 274 | 3300005288 | Ga0065714_10121432 | Ga0065714_101214321 | 70 |
| 275 | 3300005288 | Ga0065714_10158722 | Ga0065714_101587222 | 70 |
| 276 | 3300005288 | Ga0065714_10285499 | Ga0065714_102854992 | 70 |
| 277 | 3300005288 | Ga0065714_10400322 | Ga0065714_104003221 | 70 |
| 278 | 3300005288 | Ga0065714_10414697 | Ga0065714_104146971 | 70 |
| 279 | 3300005289 | Ga0065704_10085319 | Ga0065704_100853192 | 70 |
| 280 | 3300005289 | Ga0065704_10202127 | Ga0065704_102021273 | 70 |
| 281 | 3300005289 | Ga0065704_10512990 | Ga0065704_105129902 | 70 |
| 282 | 3300005293 | Ga0065715_10183624 | Ga0065715_101836242 | 70 |
| 283 | 3300005328 | Ga0070676_11084806 | Ga0070676_110848062 | 70 |
| 284 | 3300005331 | Ga0070670_100001560 | Ga0070670_10000156021 | 70 |
| 285 | 3300005344 | Ga0070661_100000219 | Ga0070661_10000021938 | 70 |
| 286 | 3300005353 | Ga0070669_100005257 | Ga0070669_1000052576 | 70 |
| 287 | 3300005353 | Ga0070669_100193851 | Ga0070669_1001938512 | 70 |
| 288 | 3300005354 | Ga0070675_100908006 | Ga0070675_1009080062 | 70 |
| 289 | 3300005366 | Ga0070659_100343444 | Ga0070659_1003434442 | 70 |
| 290 | 3300005457 | Ga0070662_100000526 | Ga0070662_1000005265 | 70 |
| 291 | 3300005539 | Ga0068853_100044913 | Ga0068853_1000449134 | 70 |
| 292 | 3300005548 | Ga0070665_100197824 | Ga0070665_1001978243 | 70 |
| 293 | 3300005548 | Ga0070665_102241838 | Ga0070665_1022418382 | 70 |
| 294 | 3300005564 | Ga0070664_100001287 | Ga0070664_10000128719 | 70 |
| 295 | 3300005564 | Ga0070664_100219163 | Ga0070664_1002191631 | 70 |
| 296 | 3300005577 | Ga0068857_101085710 | Ga0068857_1010857102 | 70 |
| 297 | 3300005578 | Ga0068854_100088869 | Ga0068854_1000888693 | 70 |
| 298 | 3300005834 | Ga0068851_10000037 | Ga0068851_1000003724 | 70 |
| 299 | 3300006048 | Ga0075363_100794700 | Ga0075363_1007947002 | 70 |
| 300 | 3300006051 | Ga0075364_10091225 | Ga0075364_100912252 | 70 |
| 301 | 3300006051 | Ga0075364_10645866 | Ga0075364_106458662 | 70 |
| 302 | 3300006058 | Ga0075432_10044984 | Ga0075432_100449843 | 70 |
| 303 | 3300006177 | Ga0075362_10409339 | Ga0075362_104093392 | 70 |
| 304 | 3300006946 | Ga0079104_1031169 | Ga0079104_10311692 | 70 |
| 305 | 3300006946 | Ga0079104_1113999 | Ga0079104_11139992 | 70 |
| 306 | 3300009011 | Ga0105251_10012223 | Ga0105251_100122238 | 70 |
| 307 | 3300009011 | Ga0105251_10012906 | Ga0105251_100129064 | 70 |
| 308 | 3300009011 | Ga0105251_10025392 | Ga0105251_100253923 | 70 |
| 309 | 3300009011 | Ga0105251_10095695 | Ga0105251_100956952 | 70 |
| 310 | 3300009011 | Ga0105251_10237219 | Ga0105251_102372192 | 70 |
| 311 | 3300009036 | Ga0105244_10002831 | Ga0105244_100028316 | 70 |
| 312 | 3300009036 | Ga0105244_10008193 | Ga0105244_100081936 | 70 |
| 313 | 3300009036 | Ga0105244_10014588 | Ga0105244_100145884 | 70 |
| 314 | 3300009036 | Ga0105244_10014962 | Ga0105244_100149624 | 70 |
| 315 | 3300009036 | Ga0105244_10017866 | Ga0105244_100178662 | 70 |
| 316 | 3300009036 | Ga0105244_10054715 | Ga0105244_100547153 | 70 |
| 317 | 3300009036 | Ga0105244_10108772 | Ga0105244_101087722 | 70 |
| 318 | 3300009036 | Ga0105244_10281955 | Ga0105244_102819551 | 70 |
| 319 | 3300009092 | Ga0105250_10001299 | Ga0105250_1000129919 | 70 |
| 320 | 3300009092 | Ga0105250_10002968 | Ga0105250_100029687 | 70 |
| 321 | 3300009092 | Ga0105250_10003980 | Ga0105250_100039806 | 70 |
| 322 | 3300009092 | Ga0105250_10006308 | Ga0105250_100063083 | 70 |
| 323 | 3300009092 | Ga0105250_10006540 | Ga0105250_100065405 | 70 |
| 324 | 3300009092 | Ga0105250_10010198 | Ga0105250_100101984 | 70 |
| 325 | 3300009092 | Ga0105250_10049892 | Ga0105250_100498923 | 70 |
| 326 | 3300009092 | Ga0105250_10268924 | Ga0105250_102689242 | 70 |
| 327 | 3300009092 | Ga0105250_10314310 | Ga0105250_103143102 | 70 |
| 328 | 3300009148 | Ga0105243_10001686 | Ga0105243_1000168621 | 70 |
| 329 | 3300009176 | Ga0105242_10479699 | Ga0105242_104796992 | 70 |
| 330 | 3300009177 | Ga0105248_10360193 | Ga0105248_103601932 | 70 |
| 331 | 3300009545 | Ga0105237_10000196 | Ga0105237_1000019665 | 70 |
| 332 | 3300009545 | Ga0105237_11306265 | Ga0105237_113062652 | 70 |
| 333 | 3300011119 | Ga0105246_10000347 | Ga0105246_1000034730 | 70 |
| 334 | 3300011119 | Ga0105246_10184366 | Ga0105246_101843662 | 70 |
| 335 | 3300012498 | Ga0157345_1000275 | Ga0157345_10002756 | 70 |
| 336 | 3300012502 | Ga0157347_1023079 | Ga0157347_10230792 | 70 |
| 337 | 3300013100 | Ga0157373_10002861 | Ga0157373_1000286115 | 70 |
| 338 | 3300013100 | Ga0157373_10010905 | Ga0157373_100109057 | 70 |
| 339 | 3300013100 | Ga0157373_10014633 | Ga0157373_100146336 | 70 |
| 340 | 3300013100 | Ga0157373_10015166 | Ga0157373_100151665 | 70 |
| 341 | 3300013100 | Ga0157373_10035028 | Ga0157373_100350284 | 70 |
| 342 | 3300013100 | Ga0157373_10042598 | Ga0157373_100425984 | 70 |
| 343 | 3300013100 | Ga0157373_10049466 | Ga0157373_100494661 | 70 |
| 344 | 3300013100 | Ga0157373_11478315 | Ga0157373_114783152 | 70 |
| 345 | 3300013102 | Ga0157371_10005463 | Ga0157371_1000546315 | 70 |
| 346 | 3300013102 | Ga0157371_10011393 | Ga0157371_100113935 | 70 |
| 347 | 3300013102 | Ga0157371_10017484 | Ga0157371_100174845 | 70 |
| 348 | 3300013102 | Ga0157371_11129102 | Ga0157371_111291022 | 70 |
| 349 | 3300013102 | Ga0157371_11262203 | Ga0157371_112622032 | 70 |
| 350 | 3300013104 | Ga0157370_10033664 | Ga0157370_100336643 | 70 |
| 351 | 3300013104 | Ga0157370_10040981 | Ga0157370_100409814 | 70 |
| 352 | 3300013104 | Ga0157370_10091076 | Ga0157370_100910763 | 70 |
| 353 | 3300013104 | Ga0157370_10113572 | Ga0157370_101135723 | 70 |
| 354 | 3300013104 | Ga0157370_10125900 | Ga0157370_101259002 | 70 |
| 355 | 3300013104 | Ga0157370_10229640 | Ga0157370_102296403 | 70 |
| 356 | 3300013104 | Ga0157370_10569065 | Ga0157370_105690651 | 70 |
| 357 | 3300013105 | Ga0157369_10029322 | Ga0157369_100293225 | 70 |
| 358 | 3300013105 | Ga0157369_10032822 | Ga0157369_100328225 | 70 |
| 359 | 3300013105 | Ga0157369_10057162 | Ga0157369_100571624 | 70 |
| 360 | 3300013105 | Ga0157369_10403856 | Ga0157369_104038562 | 70 |
| 361 | 3300013105 | Ga0157369_10968652 | Ga0157369_109686522 | 70 |
| 362 | 3300013105 | Ga0157369_10969952 | Ga0157369_109699522 | 70 |
| 363 | 3300013306 | Ga0163162_10013275 | Ga0163162_100132755 | 70 |
| 364 | 3300013306 | Ga0163162_10070183 | Ga0163162_100701833 | 70 |
| 365 | 3300013306 | Ga0163162_10070757 | Ga0163162_100707572 | 70 |
| 366 | 3300013306 | Ga0163162_10116012 | Ga0163162_101160122 | 70 |
| 367 | 3300013306 | Ga0163162_10145310 | Ga0163162_101453102 | 70 |
| 368 | 3300013306 | Ga0163162_11051021 | Ga0163162_110510212 | 70 |
| 369 | 3300013308 | Ga0157375_10017263 | Ga0157375_100172637 | 70 |
| 370 | 3300013308 | Ga0157375_10040228 | Ga0157375_100402284 | 70 |
| 371 | 3300013308 | Ga0157375_10348925 | Ga0157375_103489252 | 70 |
| 372 | 3300014497 | Ga0182008_10006874 | Ga0182008_100068745 | 70 |
| 373 | 3300014497 | Ga0182008_10006946 | Ga0182008_100069466 | 70 |
| 374 | 3300014497 | Ga0182008_10009184 | Ga0182008_100091843 | 70 |
| 375 | 3300014497 | Ga0182008_10009723 | Ga0182008_100097232 | 70 |
| 376 | 3300014497 | Ga0182008_10023747 | Ga0182008_100237475 | 70 |
| 377 | 3300014497 | Ga0182008_10038097 | Ga0182008_100380971 | 70 |
| 378 | 3300014497 | Ga0182008_10091972 | Ga0182008_100919723 | 70 |
| 379 | 3300015261 | Ga0182006_1004889 | Ga0182006_10048898 | 70 |
| 380 | 3300015261 | Ga0182006_1005668 | Ga0182006_10056686 | 70 |
| 381 | 3300015261 | Ga0182006_1027577 | Ga0182006_10275772 | 70 |
| 382 | 3300015261 | Ga0182006_1030332 | Ga0182006_10303322 | 70 |
| 383 | 3300015261 | Ga0182006_1196957 | Ga0182006_11969572 | 70 |
| 384 | 3300015262 | Ga0182007_10001094 | Ga0182007_1000109417 | 70 |
| 385 | 3300015262 | Ga0182007_10002411 | Ga0182007_100024116 | 70 |
| 386 | 3300015262 | Ga0182007_10005509 | Ga0182007_100055095 | 70 |
| 387 | 3300015262 | Ga0182007_10006179 | Ga0182007_100061795 | 70 |
| 388 | 3300015265 | Ga0182005_1001507 | Ga0182005_10015076 | 70 |
| 389 | 3300017792 | Ga0163161_10002369 | Ga0163161_1000236916 | 70 |
| 390 | 3300017792 | Ga0163161_10019070 | Ga0163161_100190704 | 70 |
| 391 | 3300017792 | Ga0163161_10020602 | Ga0163161_100206023 | 70 |
| 392 | 3300017792 | Ga0163161_10020764 | Ga0163161_100207646 | 70 |
| 393 | 3300017792 | Ga0163161_10082956 | Ga0163161_100829564 | 70 |
| 394 | 3300017792 | Ga0163161_10094157 | Ga0163161_100941572 | 70 |
| 395 | 3300017792 | Ga0163161_10094905 | Ga0163161_100949052 | 70 |
| 396 | 3300017792 | Ga0163161_10101375 | Ga0163161_101013751 | 70 |
| 397 | 3300017792 | Ga0163161_10172702 | Ga0163161_101727023 | 70 |
| 398 | 3300017792 | Ga0163161_10188602 | Ga0163161_101886022 | 70 |
| 399 | 3300017792 | Ga0163161_10434744 | Ga0163161_104347442 | 70 |
| 400 | 3300017792 | Ga0163161_10434745 | Ga0163161_104347452 | 70 |
| 401 | 3300017792 | Ga0163161_11283940 | Ga0163161_112839402 | 70 |
| 402 | 3300017792 | Ga0163161_11918908 | Ga0163161_119189082 | 70 |
| 403 | 3300025206 | Ga0209435_100620 | Ga0209435_1006208 | 70 |
| 404 | 3300025207 | Ga0209760_100046 | Ga0209760_10004643 | 70 |
| 405 | 3300025224 | Ga0209784_100015 | Ga0209784_10001582 | 70 |
| 406 | 3300025225 | Ga0209566_100012 | Ga0209566_10001282 | 70 |
| 407 | 3300025226 | Ga0209674_100027 | Ga0209674_10002782 | 70 |
| 408 | 3300025229 | Ga0209147_100019 | Ga0209147_10001982 | 70 |
| 409 | 3300025230 | Ga0209563_100031 | Ga0209563_10003182 | 70 |
| 410 | 3300025230 | Ga0209563_100578 | Ga0209563_10057811 | 70 |
| 411 | 3300025231 | Ga0207427_100029 | Ga0207427_100029306 | 70 |
| 412 | 3300025233 | Ga0209437_100009 | Ga0209437_100009561 | 70 |
| 413 | 3300025233 | Ga0209437_103326 | Ga0209437_1033264 | 70 |
| 414 | 3300025242 | Ga0209258_100296 | Ga0209258_10029642 | 70 |
| 415 | 3300025246 | Ga0209646_1000213 | Ga0209646_100021349 | 70 |
| 416 | 3300025253 | Ga0209677_100016 | Ga0209677_10001682 | 70 |
| 417 | 3300025256 | Ga0209759_1022755 | Ga0209759_10227553 | 70 |
| 418 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032561 | 70 |
| 419 | 3300025291 | Ga0209675_1002947 | Ga0209675_10029473 | 70 |
| 420 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016105 | 70 |
| 421 | 3300025292 | Ga0209676_1000080 | Ga0209676_1000080271 | 70 |
| 422 | 3300025292 | Ga0209676_1000397 | Ga0209676_100039744 | 70 |
| 423 | 3300025292 | Ga0209676_1003696 | Ga0209676_100369610 | 70 |
| 424 | 3300025292 | Ga0209676_1007897 | Ga0209676_10078975 | 70 |
| 425 | 3300025298 | Ga0209050_1000208 | Ga0209050_100020819 | 70 |
| 426 | 3300025298 | Ga0209050_1000588 | Ga0209050_100058851 | 70 |
| 427 | 3300025298 | Ga0209050_1000978 | Ga0209050_100097824 | 70 |
| 428 | 3300025298 | Ga0209050_1001235 | Ga0209050_10012352 | 70 |
| 429 | 3300025303 | Ga0209051_1000219 | Ga0209051_100021952 | 70 |
| 430 | 3300025303 | Ga0209051_1000422 | Ga0209051_100042251 | 70 |
| 431 | 3300025303 | Ga0209051_1000498 | Ga0209051_100049836 | 70 |
| 432 | 3300025303 | Ga0209051_1008755 | Ga0209051_10087553 | 70 |
| 433 | 3300025303 | Ga0209051_1086793 | Ga0209051_10867932 | 70 |
| 434 | 3300025304 | Ga0209257_1000342 | Ga0209257_100034251 | 70 |
| 435 | 3300025304 | Ga0209257_1005479 | Ga0209257_10054793 | 70 |
| 436 | 3300025321 | Ga0207656_10000014 | Ga0207656_1000001483 | 70 |
| 437 | 3300025711 | Ga0207696_1000032 | Ga0207696_1000032314 | 70 |
| 438 | 3300025711 | Ga0207696_1000221 | Ga0207696_100022130 | 70 |
| 439 | 3300025711 | Ga0207696_1004504 | Ga0207696_10045045 | 70 |
| 440 | 3300025711 | Ga0207696_1011909 | Ga0207696_10119094 | 70 |
| 441 | 3300025711 | Ga0207696_1014700 | Ga0207696_10147002 | 70 |
| 442 | 3300025711 | Ga0207696_1019928 | Ga0207696_10199282 | 70 |
| 443 | 3300025711 | Ga0207696_1206397 | Ga0207696_12063972 | 70 |
| 444 | 3300025728 | Ga0207655_1000563 | Ga0207655_100056340 | 70 |
| 445 | 3300025728 | Ga0207655_1001730 | Ga0207655_10017308 | 70 |
| 446 | 3300025728 | Ga0207655_1001921 | Ga0207655_10019219 | 70 |
| 447 | 3300025728 | Ga0207655_1002210 | Ga0207655_100221019 | 70 |
| 448 | 3300025728 | Ga0207655_1008923 | Ga0207655_10089233 | 70 |
| 449 | 3300025728 | Ga0207655_1009718 | Ga0207655_10097183 | 70 |
| 450 | 3300025728 | Ga0207655_1013256 | Ga0207655_10132564 | 70 |
| 451 | 3300025728 | Ga0207655_1072946 | Ga0207655_10729463 | 70 |
| 452 | 3300025735 | Ga0207713_1000751 | Ga0207713_100075131 | 70 |
| 453 | 3300025735 | Ga0207713_1001304 | Ga0207713_100130421 | 70 |
| 454 | 3300025735 | Ga0207713_1004618 | Ga0207713_10046186 | 70 |
| 455 | 3300025735 | Ga0207713_1005033 | Ga0207713_10050337 | 70 |
| 456 | 3300025735 | Ga0207713_1060590 | Ga0207713_10605902 | 70 |
| 457 | 3300025735 | Ga0207713_1094647 | Ga0207713_10946472 | 70 |
| 458 | 3300025735 | Ga0207713_1101584 | Ga0207713_11015842 | 70 |
| 459 | 3300025735 | Ga0207713_1133211 | Ga0207713_11332112 | 70 |
| 460 | 3300025907 | Ga0207645_10323487 | Ga0207645_103234872 | 70 |
| 461 | 3300025914 | Ga0207671_10000019 | Ga0207671_10000019194 | 70 |
| 462 | 3300025914 | Ga0207671_10756619 | Ga0207671_107566192 | 70 |
| 463 | 3300025920 | Ga0207649_10000002 | Ga0207649_10000002472 | 70 |
| 464 | 3300025923 | Ga0207681_10000584 | Ga0207681_1000058418 | 70 |
| 465 | 3300025923 | Ga0207681_10351496 | Ga0207681_103514963 | 70 |
| 466 | 3300025925 | Ga0207650_10000198 | Ga0207650_1000019828 | 70 |
| 467 | 3300025933 | Ga0207706_10006246 | Ga0207706_1000624614 | 70 |
| 468 | 3300025933 | Ga0207706_11118717 | Ga0207706_111187171 | 70 |
| 469 | 3300025934 | Ga0207686_10004351 | Ga0207686_1000435114 | 70 |
| 470 | 3300025935 | Ga0207709_10000228 | Ga0207709_1000022835 | 70 |
| 471 | 3300025935 | Ga0207709_10218401 | Ga0207709_102184012 | 70 |
| 472 | 3300025941 | Ga0207711_10337733 | Ga0207711_103377332 | 70 |
| 473 | 3300025945 | Ga0207679_10000006 | Ga0207679_1000000618 | 70 |
| 474 | 3300025945 | Ga0207679_10168660 | Ga0207679_101686601 | 70 |
| 475 | 3300025981 | Ga0207640_10111564 | Ga0207640_101115642 | 70 |
| 476 | 3300026041 | Ga0207639_10036231 | Ga0207639_100362313 | 70 |
| 477 | 3300026116 | Ga0207674_10477926 | Ga0207674_104779262 | 70 |
| 478 | 3300027111 | Ga0209281_1005084 | Ga0209281_10050843 | 70 |
| 479 | 3300027111 | Ga0209281_1009764 | Ga0209281_10097642 | 70 |
| 480 | 3300028379 | Ga0268266_10486158 | Ga0268266_104861583 | 70 |
| 481 | 3300028379 | Ga0268266_11515706 | Ga0268266_115157062 | 70 |
| 482 | 3300028786 | Ga0307517_10077807 | Ga0307517_100778073 | 70 |
| 483 | 3300030521 | Ga0307511_10097542 | Ga0307511_100975423 | 70 |
| 484 | 3300030733 | Ga0314311_1008105 | Ga0314311_10081053 | 70 |
| 485 | 3300030734 | Ga0316179_1104439 | Ga0316179_11044392 | 70 |
| 486 | 3300030744 | Ga0316181_1138181 | Ga0316181_11381812 | 70 |
| 487 | 3300031344 | Ga0265316_10640564 | Ga0265316_106405642 | 70 |
| 488 | 3300031507 | Ga0307509_10075412 | Ga0307509_100754125 | 70 |
| 489 | 3300031548 | Ga0307408_100001454 | Ga0307408_1000014546 | 70 |
| 490 | 3300031548 | Ga0307408_100014079 | Ga0307408_1000140796 | 70 |
| 491 | 3300031548 | Ga0307408_100044212 | Ga0307408_1000442125 | 70 |
| 492 | 3300031548 | Ga0307408_100117588 | Ga0307408_1001175883 | 70 |
| 493 | 3300031548 | Ga0307408_100277440 | Ga0307408_1002774402 | 70 |
| 494 | 3300031730 | Ga0307516_10448767 | Ga0307516_104487672 | 70 |
| 495 | 3300031731 | Ga0307405_10000211 | Ga0307405_100002116 | 70 |
| 496 | 3300031731 | Ga0307405_10006627 | Ga0307405_100066275 | 70 |
| 497 | 3300031731 | Ga0307405_10015096 | Ga0307405_100150962 | 70 |
| 498 | 3300031731 | Ga0307405_10068258 | Ga0307405_100682583 | 70 |
| 499 | 3300031731 | Ga0307405_10764482 | Ga0307405_107644821 | 70 |
| 500 | 3300031824 | Ga0307413_10161084 | Ga0307413_101610842 | 70 |
| 501 | 3300031824 | Ga0307413_10201067 | Ga0307413_102010673 | 70 |
| 502 | 3300031824 | Ga0307413_10354414 | Ga0307413_103544142 | 70 |
| 503 | 3300031824 | Ga0307413_11085657 | Ga0307413_110856572 | 70 |
| 504 | 3300031901 | Ga0307406_10005906 | Ga0307406_100059066 | 70 |
| 505 | 3300031901 | Ga0307406_10114886 | Ga0307406_101148861 | 70 |
| 506 | 3300031901 | Ga0307406_12141292 | Ga0307406_121412922 | 70 |
| 507 | 3300031903 | Ga0307407_10010259 | Ga0307407_100102594 | 70 |
| 508 | 3300031903 | Ga0307407_10511291 | Ga0307407_105112912 | 70 |
| 509 | 3300031911 | Ga0307412_10010299 | Ga0307412_100102995 | 70 |
| 510 | 3300031911 | Ga0307412_10011063 | Ga0307412_100110636 | 70 |
| 511 | 3300031911 | Ga0307412_10031694 | Ga0307412_100316943 | 70 |
| 512 | 3300031911 | Ga0307412_10359686 | Ga0307412_103596862 | 70 |
| 513 | 3300031995 | Ga0307409_100049132 | Ga0307409_1000491322 | 70 |
| 514 | 3300032002 | Ga0307416_100094947 | Ga0307416_1000949473 | 70 |
| 515 | 3300032002 | Ga0307416_101579234 | Ga0307416_1015792342 | 70 |
| 516 | 3300032002 | Ga0307416_103348128 | Ga0307416_1033481282 | 70 |
| 517 | 3300032004 | Ga0307414_10018788 | Ga0307414_100187884 | 70 |
| 518 | 3300032004 | Ga0307414_10045625 | Ga0307414_100456254 | 70 |
| 519 | 3300032004 | Ga0307414_10359384 | Ga0307414_103593841 | 70 |
| 520 | 3300032004 | Ga0307414_10399394 | Ga0307414_103993943 | 70 |
| 521 | 3300032005 | Ga0307411_10181079 | Ga0307411_101810792 | 70 |
| 522 | 3300032005 | Ga0307411_10582136 | Ga0307411_105821362 | 70 |
| 523 | 3300032005 | Ga0307411_12224294 | Ga0307411_122242942 | 70 |
| 524 | 3300033180 | Ga0307510_10045373 | Ga0307510_100453733 | 70 |
| 525 | 3300038705 | Ga0237819_01118 | Ga0237819_01118_3895_4107 | 70 |
| 526 | 3300041405 | Ga0439438_001775 | Ga0439438_001775_34_246 | 70 |
| 527 | 3300041405 | Ga0439438_005677 | Ga0439438_005677_499_711 | 70 |
| 528 | 3300041405 | Ga0439438_035191 | Ga0439438_035191_216_428 | 70 |
| 529 | 3300041407 | Ga0439447_005066 | Ga0439447_005066_3856_4068 | 70 |
| 530 | 3300041407 | Ga0439447_015790 | Ga0439447_015790_199_411 | 70 |
| 531 | 3300041411 | Ga0439466_0002005 | Ga0439466_0002005_3801_4013 | 70 |
| 532 | 3300041411 | Ga0439466_0002810 | Ga0439466_0002810_3997_4209 | 70 |
| 533 | 3300041411 | Ga0439466_0023603 | Ga0439466_0023603_217_429 | 70 |
| 534 | 3300041491 | Ga0451833_0896841 | Ga0451833_0896841_68_280 | 70 |
| 535 | 3300041498 | Ga0451841_1119567 | Ga0451841_1119567_133_345 | 70 |
| 536 | 3300042006 | Ga0439432_004736 | Ga0439432_004736_3228_3440 | 70 |
| 537 | 3300042009 | Ga0439451_001422 | Ga0439451_001422_3987_4199 | 70 |
| 538 | 3300042009 | Ga0439451_001463 | Ga0439451_001463_1579_1791 | 70 |
| 539 | 3300042009 | Ga0439451_001543 | Ga0439451_001543_1721_1933 | 70 |
| 540 | 3300042010 | Ga0439452_002186 | Ga0439452_002186_4048_4260 | 70 |
| 541 | 3300042010 | Ga0439452_010650 | Ga0439452_010650_1638_1850 | 70 |
| 542 | 3300042013 | Ga0439456_000904 | Ga0439456_000904_2732_2944 | 70 |
| 543 | 3300042013 | Ga0439456_015497 | Ga0439456_015497_1239_1451 | 70 |
| 544 | 3300042013 | Ga0439456_088308 | Ga0439456_088308_436_648 | 70 |
| 545 | 3300042013 | Ga0439456_124524 | Ga0439456_124524_102_314 | 70 |
| 546 | 3300042016 | Ga0439463_001133 | Ga0439463_001133_2953_3165 | 70 |
| 547 | 3300042016 | Ga0439463_009946 | Ga0439463_009946_1872_2084 | 70 |
| 548 | 3300042016 | Ga0439463_025238 | Ga0439463_025238_1062_1274 | 70 |
| 549 | 3300042115 | Ga0450911_001005 | Ga0450911_001005_2970_3182 | 70 |
| 550 | 3300042115 | Ga0450911_002792 | Ga0450911_002792_1970_2182 | 70 |
| 551 | 3300042136 | Ga0450900_078226 | Ga0450900_078226_158_370 | 70 |
| 552 | 3300042138 | Ga0450903_011045 | Ga0450903_011045_792_1004 | 70 |
| 553 | 3300042138 | Ga0450903_020283 | Ga0450903_020283_288_500 | 70 |
| 554 | 3300042139 | Ga0450904_001481 | Ga0450904_001481_2697_2909 | 70 |
| 555 | 3300042139 | Ga0450904_003275 | Ga0450904_003275_1533_1745 | 70 |
| 556 | 3300042142 | Ga0450905_001492 | Ga0450905_001492_2693_2905 | 70 |
| 557 | 3300042142 | Ga0450905_006037 | Ga0450905_006037_808_1020 | 70 |
| 558 | 3300042142 | Ga0450905_021768 | Ga0450905_021768_646_858 | 70 |
| 559 | 3300042144 | Ga0450889_006958 | Ga0450889_006958_523_735 | 70 |
| 560 | 3300042145 | Ga0450906_000914 | Ga0450906_000914_4022_4234 | 70 |
| 561 | 3300042146 | Ga0450907_100567 | Ga0450907_100567_45_257 | 70 |
| 562 | 3300042531 | Ga0450918_043507 | Ga0450918_043507_360_572 | 70 |
| 563 | 3300042532 | Ga0450893_0003145 | Ga0450893_0003145_1534_1746 | 70 |
| 564 | 3300042993 | Ga0439440_0001087 | Ga0439440_0001087_1895_2107 | 70 |
| 565 | 3300046452 | Ga0495617_004684 | Ga0495617_004684_1040_1252 | 70 |
| 566 | 3300046452 | Ga0495617_010329 | Ga0495617_010329_215_427 | 70 |
| 567 | 3300046452 | Ga0495617_033259 | Ga0495617_033259_783_995 | 70 |
| 568 | 3300046453 | Ga0495627_000810 | Ga0495627_000810_20615_20827 | 70 |
| 569 | 3300046453 | Ga0495627_001143 | Ga0495627_001143_3095_3307 | 70 |
| 570 | 3300046453 | Ga0495627_006494 | Ga0495627_006494_1651_1863 | 70 |
| 571 | 3300046453 | Ga0495627_022672 | Ga0495627_022672_290_502 | 70 |
| 572 | 3300046455 | Ga0495603_0011876 | Ga0495603_0011876_2286_2498 | 70 |
| 573 | 3300046457 | Ga0495590_0007727 | Ga0495590_0007727_1247_1459 | 70 |
| 574 | 3300046457 | Ga0495590_0011922 | Ga0495590_0011922_586_798 | 70 |
| 575 | 3300046457 | Ga0495590_0013501 | Ga0495590_0013501_2751_2963 | 70 |
| 576 | 3300046458 | Ga0495591_001155 | Ga0495591_001155_13849_14061 | 70 |
| 577 | 3300046458 | Ga0495591_006386 | Ga0495591_006386_2244_2456 | 70 |
| 578 | 3300046458 | Ga0495591_007370 | Ga0495591_007370_2897_3109 | 70 |
| 579 | 3300046458 | Ga0495591_007644 | Ga0495591_007644_1673_1885 | 70 |
| 580 | 3300046458 | Ga0495591_007669 | Ga0495591_007669_2676_2888 | 70 |
| 581 | 3300046458 | Ga0495591_011483 | Ga0495591_011483_388_600 | 70 |
| 582 | 3300046459 | Ga0495629_0755737 | Ga0495629_0755737_49_261 | 70 |
| 583 | 3300046460 | Ga0495638_0022088 | Ga0495638_0022088_2658_2870 | 70 |
| 584 | 3300046463 | Ga0495653_0023583 | Ga0495653_0023583_3778_3990 | 70 |
| 585 | 3300046463 | Ga0495653_0090896 | Ga0495653_0090896_1472_1684 | 70 |
| 586 | 3300046463 | Ga0495653_0152125 | Ga0495653_0152125_703_915 | 70 |
| 587 | 3300046471 | Ga0495650_0049782 | Ga0495650_0049782_493_705 | 70 |
| 588 | 3300046471 | Ga0495650_0057233 | Ga0495650_0057233_883_1095 | 70 |
| 589 | 3300046474 | Ga0495605_0026001 | Ga0495605_0026001_2737_2949 | 70 |
| 590 | 3300046474 | Ga0495605_0049188 | Ga0495605_0049188_208_420 | 70 |
| 591 | 3300046475 | Ga0495639_0002507 | Ga0495639_0002507_3897_4109 | 70 |
| 592 | 3300046475 | Ga0495639_0053748 | Ga0495639_0053748_1180_1392 | 70 |
| 593 | 3300046475 | Ga0495639_0601398 | Ga0495639_0601398_307_519 | 70 |
| 594 | 3300046491 | Ga0495584_0416303 | Ga0495584_0416303_219_431 | 70 |
| 595 | 3300046492 | Ga0495585_0006492 | Ga0495585_0006492_4070_4282 | 70 |
| 596 | 3300046492 | Ga0495585_0015212 | Ga0495585_0015212_2614_2826 | 70 |
| 597 | 3300046492 | Ga0495585_0018275 | Ga0495585_0018275_2718_2930 | 70 |
| 598 | 3300046499 | Ga0495594_0017438 | Ga0495594_0017438_1690_1902 | 70 |
| 599 | 3300046500 | Ga0495596_0009030 | Ga0495596_0009030_1081_1293 | 70 |
| 600 | 3300046501 | Ga0495607_0006191 | Ga0495607_0006191_3986_4198 | 70 |
| 601 | 3300046501 | Ga0495607_0010371 | Ga0495607_0010371_2231_2443 | 70 |
| 602 | 3300046501 | Ga0495607_0023358 | Ga0495607_0023358_1658_1870 | 70 |
| 603 | 3300046501 | Ga0495607_0027948 | Ga0495607_0027948_2900_3112 | 70 |
| 604 | 3300046501 | Ga0495607_0043926 | Ga0495607_0043926_1727_1939 | 70 |
| 605 | 3300046501 | Ga0495607_0139900 | Ga0495607_0139900_971_1183 | 70 |
| 606 | 3300046501 | Ga0495607_0267865 | Ga0495607_0267865_202_414 | 70 |
| 607 | 3300046506 | Ga0495583_0009218 | Ga0495583_0009218_2719_2931 | 70 |
| 608 | 3300046506 | Ga0495583_0012785 | Ga0495583_0012785_2898_3110 | 70 |
| 609 | 3300046506 | Ga0495583_0135363 | Ga0495583_0135363_39_251 | 70 |
| 610 | 3300046507 | Ga0495606_0003047 | Ga0495606_0003047_3904_4116 | 70 |
| 611 | 3300046507 | Ga0495606_0016386 | Ga0495606_0016386_2775_2987 | 70 |
| 612 | 3300046507 | Ga0495606_0022242 | Ga0495606_0022242_1656_1868 | 70 |
| 613 | 3300046507 | Ga0495606_0053975 | Ga0495606_0053975_466_678 | 70 |
| 614 | 3300046507 | Ga0495606_0231021 | Ga0495606_0231021_303_515 | 70 |
| 615 | 3300046512 | Ga0495610_0013908 | Ga0495610_0013908_2927_3139 | 70 |
| 616 | 3300046512 | Ga0495610_0013963 | Ga0495610_0013963_2492_2704 | 70 |
| 617 | 3300046512 | Ga0495610_0020334 | Ga0495610_0020334_1036_1248 | 70 |
| 618 | 3300046512 | Ga0495610_0020848 | Ga0495610_0020848_2711_2923 | 70 |
| 619 | 3300046512 | Ga0495610_0024945 | Ga0495610_0024945_466_678 | 70 |
| 620 | 3300046512 | Ga0495610_0151567 | Ga0495610_0151567_698_910 | 70 |
| 621 | 3300046513 | Ga0495616_0012861 | Ga0495616_0012861_1584_1796 | 70 |
| 622 | 3300046513 | Ga0495616_0013844 | Ga0495616_0013844_1651_1863 | 70 |
| 623 | 3300046513 | Ga0495616_0022830 | Ga0495616_0022830_1515_1727 | 70 |
| 624 | 3300046513 | Ga0495616_0345568 | Ga0495616_0345568_113_325 | 70 |
| 625 | 3300046515 | Ga0495620_0000541 | Ga0495620_0000541_20742_20954 | 70 |
| 626 | 3300046515 | Ga0495620_0001018 | Ga0495620_0001018_13864_14076 | 70 |
| 627 | 3300046515 | Ga0495620_0013871 | Ga0495620_0013871_1149_1361 | 70 |
| 628 | 3300046515 | Ga0495620_0079755 | Ga0495620_0079755_587_799 | 70 |
| 629 | 3300046515 | Ga0495620_0087104 | Ga0495620_0087104_1019_1231 | 70 |
| 630 | 3300046515 | Ga0495620_0410529 | Ga0495620_0410529_190_402 | 70 |
| 631 | 3300046516 | Ga0495628_0016960 | Ga0495628_0016960_3363_3575 | 70 |
| 632 | 3300046517 | Ga0495630_0299202 | Ga0495630_0299202_469_681 | 70 |
| 633 | 3300046518 | Ga0495631_0006632 | Ga0495631_0006632_1750_1962 | 70 |
| 634 | 3300046518 | Ga0495631_0011766 | Ga0495631_0011766_2218_2430 | 70 |
| 635 | 3300046518 | Ga0495631_0082780 | Ga0495631_0082780_1034_1246 | 70 |
| 636 | 3300046518 | Ga0495631_0287733 | Ga0495631_0287733_286_498 | 70 |
| 637 | 3300046519 | Ga0495632_0006763 | Ga0495632_0006763_3857_4069 | 70 |
| 638 | 3300046519 | Ga0495632_0012829 | Ga0495632_0012829_2974_3186 | 70 |
| 639 | 3300046519 | Ga0495632_0019451 | Ga0495632_0019451_2774_2986 | 70 |
| 640 | 3300046519 | Ga0495632_0019635 | Ga0495632_0019635_747_959 | 70 |
| 641 | 3300046519 | Ga0495632_0032082 | Ga0495632_0032082_2380_2592 | 70 |
| 642 | 3300046519 | Ga0495632_0144123 | Ga0495632_0144123_626_838 | 70 |
| 643 | 3300046520 | Ga0495637_0006188 | Ga0495637_0006188_1619_1831 | 70 |
| 644 | 3300046520 | Ga0495637_0039629 | Ga0495637_0039629_261_473 | 70 |
| 645 | 3300046520 | Ga0495637_0111858 | Ga0495637_0111858_325_537 | 70 |
| 646 | 3300046522 | Ga0495643_0014153 | Ga0495643_0014153_2926_3138 | 70 |
| 647 | 3300046522 | Ga0495643_0322346 | Ga0495643_0322346_419_631 | 70 |
| 648 | 3300046523 | Ga0495644_0005943 | Ga0495644_0005943_1620_1832 | 70 |
| 649 | 3300046523 | Ga0495644_0036428 | Ga0495644_0036428_1149_1361 | 70 |
| 650 | 3300046524 | Ga0495648_0064488 | Ga0495648_0064488_274_486 | 70 |
| 651 | 3300046524 | Ga0495648_0069849 | Ga0495648_0069849_1209_1421 | 70 |
| 652 | 3300046524 | Ga0495648_0159098 | Ga0495648_0159098_472_684 | 70 |
| 653 | 3300046524 | Ga0495648_0483429 | Ga0495648_0483429_17_229 | 70 |
| 654 | 3300046526 | Ga0495666_0136323 | Ga0495666_0136323_275_487 | 70 |
| 655 | 3300046526 | Ga0495666_0299437 | Ga0495666_0299437_241_453 | 70 |
| 656 | 3300046529 | Ga0495652_0100729 | Ga0495652_0100729_1134_1346 | 70 |
| 657 | 3300046530 | Ga0495654_0011506 | Ga0495654_0011506_1670_1882 | 70 |
| 658 | 3300046530 | Ga0495654_0012204 | Ga0495654_0012204_2050_2262 | 70 |
| 659 | 3300046530 | Ga0495654_0016147 | Ga0495654_0016147_1040_1252 | 70 |
| 660 | 3300046530 | Ga0495654_0020443 | Ga0495654_0020443_571_783 | 70 |
| 661 | 3300046530 | Ga0495654_0036912 | Ga0495654_0036912_293_505 | 70 |
| 662 | 3300046530 | Ga0495654_0061131 | Ga0495654_0061131_1230_1442 | 70 |
| 663 | 3300046530 | Ga0495654_0063005 | Ga0495654_0063005_262_474 | 70 |
| 664 | 3300046530 | Ga0495654_0087461 | Ga0495654_0087461_701_913 | 70 |
| 665 | 3300046531 | Ga0495665_0530551 | Ga0495665_0530551_197_409 | 70 |
| 666 | 3300046536 | Ga0495587_0007914 | Ga0495587_0007914_3806_4018 | 70 |
| 667 | 3300046538 | Ga0495609_0006215 | Ga0495609_0006215_1736_1948 | 70 |
| 668 | 3300046538 | Ga0495609_0009365 | Ga0495609_0009365_2897_3109 | 70 |
| 669 | 3300046538 | Ga0495609_0009379 | Ga0495609_0009379_2877_3089 | 70 |
| 670 | 3300046538 | Ga0495609_0372002 | Ga0495609_0372002_290_502 | 70 |
| 671 | 3300046542 | Ga0495597_0010124 | Ga0495597_0010124_1635_1847 | 70 |
| 672 | 3300046557 | Ga0495622_0003103 | Ga0495622_0003103_3755_3967 | 70 |
| 673 | 3300046557 | Ga0495622_0008899 | Ga0495622_0008899_2774_2986 | 70 |
| 674 | 3300046557 | Ga0495622_0051517 | Ga0495622_0051517_943_1155 | 70 |
| 675 | 3300046558 | Ga0495633_0011913 | Ga0495633_0011913_2777_2989 | 70 |
| 676 | 3300046558 | Ga0495633_0032628 | Ga0495633_0032628_1758_1970 | 70 |
| 677 | 3300046616 | Ga0495668_0009771 | Ga0495668_0009771_1661_1873 | 70 |
| 678 | 3300046616 | Ga0495668_0063413 | Ga0495668_0063413_350_562 | 70 |
| 679 | 3300046616 | Ga0495668_0552460 | Ga0495668_0552460_262_474 | 70 |
| 680 | 3300046642 | Ga0495634_0010409 | Ga0495634_0010409_2839_3051 | 70 |
| 681 | 3300046648 | Ga0495611_0000533 | Ga0495611_0000533_20608_20820 | 70 |
| 682 | 3300046648 | Ga0495611_0028320 | Ga0495611_0028320_1483_1695 | 70 |
| 683 | 3300046660 | Ga0495625_0014932 | Ga0495625_0014932_2673_2885 | 70 |
| 684 | 3300046660 | Ga0495625_0033324 | Ga0495625_0033324_861_1073 | 70 |
| 685 | 3300046660 | Ga0495625_0049401 | Ga0495625_0049401_56_268 | 70 |
| 686 | 3300046660 | Ga0495625_0089576 | Ga0495625_0089576_1666_1878 | 70 |
| 687 | 3300046663 | Ga0495635_0009500 | Ga0495635_0009500_3791_4003 | 70 |
| 688 | 3300046664 | Ga0495659_0001182 | Ga0495659_0001182_3898_4110 | 70 |
| 689 | 3300046664 | Ga0495659_0003189 | Ga0495659_0003189_2659_2871 | 70 |
| 690 | 3300046665 | Ga0495661_0001773 | Ga0495661_0001773_3264_3476 | 70 |
| 691 | 3300046665 | Ga0495661_0011567 | Ga0495661_0011567_2678_2890 | 70 |
| 692 | 3300046665 | Ga0495661_0017508 | Ga0495661_0017508_1633_1845 | 70 |
| 693 | 3300046665 | Ga0495661_0025390 | Ga0495661_0025390_2604_2816 | 70 |
| 694 | 3300046665 | Ga0495661_0051810 | Ga0495661_0051810_19_231 | 70 |
| 695 | 3300046665 | Ga0495661_0114022 | Ga0495661_0114022_212_424 | 70 |
| 696 | 3300046674 | Ga0495588_0284052 | Ga0495588_0284052_310_522 | 70 |
| 697 | 3300046679 | Ga0495623_0008751 | Ga0495623_0008751_3790_4002 | 70 |
| 698 | 3300046680 | Ga0495646_0015656 | Ga0495646_0015656_2575_2787 | 70 |
| 699 | 3300046689 | Ga0495613_0042719 | Ga0495613_0042719_1520_1732 | 70 |
| 700 | 3300046691 | Ga0495670_0004726 | Ga0495670_0004726_2763_2975 | 70 |
| 701 | 3300046691 | Ga0495670_0005868 | Ga0495670_0005868_2234_2446 | 70 |
| 702 | 3300046691 | Ga0495670_0009600 | Ga0495670_0009600_2923_3135 | 70 |
| 703 | 3300046691 | Ga0495670_0117443 | Ga0495670_0117443_64_276 | 70 |
| 704 | 3300046692 | Ga0495671_0026540 | Ga0495671_0026540_880_1092 | 70 |
| 705 | 3300046692 | Ga0495671_0031948 | Ga0495671_0031948_1631_1843 | 70 |
| 706 | 3300046692 | Ga0495671_0046125 | Ga0495671_0046125_1639_1851 | 70 |
| 707 | 3300046692 | Ga0495671_0105579 | Ga0495671_0105579_167_379 | 70 |
| 708 | 3300046692 | Ga0495671_0467173 | Ga0495671_0467173_192_404 | 70 |
| 709 | 3300046694 | Ga0495649_0009344 | Ga0495649_0009344_3372_3584 | 70 |
| 710 | 3300046694 | Ga0495649_0023250 | Ga0495649_0023250_2110_2322 | 70 |
| 711 | 3300046694 | Ga0495649_0046448 | Ga0495649_0046448_1230_1442 | 70 |
| 712 | 3300046694 | Ga0495649_0058758 | Ga0495649_0058758_240_452 | 70 |
| 713 | 3300046694 | Ga0495649_0088999 | Ga0495649_0088999_1098_1310 | 70 |
| 714 | 3300046794 | Ga0495589_0006201 | Ga0495589_0006201_2753_2965 | 70 |
| 715 | 3300046794 | Ga0495589_0010389 | Ga0495589_0010389_2990_3202 | 70 |
| 716 | 3300046794 | Ga0495589_0106710 | Ga0495589_0106710_999_1211 | 70 |
| 717 | 3300046794 | Ga0495589_0243403 | Ga0495589_0243403_348_560 | 70 |
| 718 | 3300046794 | Ga0495589_0272186 | Ga0495589_0272186_354_566 | 70 |
| 719 | 3300046810 | Ga0495660_0007512 | Ga0495660_0007512_3384_3596 | 70 |
| 720 | 3300046810 | Ga0495660_0014390 | Ga0495660_0014390_2764_2976 | 70 |
| 721 | 3300046810 | Ga0495660_0018471 | Ga0495660_0018471_2127_2339 | 70 |
| 722 | 3300046810 | Ga0495660_0023146 | Ga0495660_0023146_2809_3021 | 70 |
| 723 | 3300046810 | Ga0495660_0115765 | Ga0495660_0115765_450_662 | 70 |
| 724 | 3300046810 | Ga0495660_0259240 | Ga0495660_0259240_294_506 | 70 |
| 725 | 3300047317 | Ga0495604_0028414 | Ga0495604_0028414_465_677 | 70 |
| 726 | 3300047319 | Ga0495674_0062006 | Ga0495674_0062006_307_519 | 70 |
| 727 | 3300047320 | Ga0495672_0009200 | Ga0495672_0009200_3138_3350 | 70 |
| 728 | 3300047320 | Ga0495672_0018399 | Ga0495672_0018399_1572_1784 | 70 |
| 729 | 3300047320 | Ga0495672_0084394 | Ga0495672_0084394_310_522 | 70 |
| 730 | 3300047321 | Ga0495676_0033107 | Ga0495676_0033107_1659_1871 | 70 |
| 731 | 3300047322 | Ga0495680_0022793 | Ga0495680_0022793_1249_1461 | 70 |
| 732 | 3300047322 | Ga0495680_0816177 | Ga0495680_0816177_66_278 | 70 |
| 733 | 3300047323 | Ga0495683_0013590 | Ga0495683_0013590_2900_3112 | 70 |
| 734 | 3300047323 | Ga0495683_0014986 | Ga0495683_0014986_2728_2940 | 70 |
| 735 | 3300047323 | Ga0495683_0016497 | Ga0495683_0016497_2051_2263 | 70 |
| 736 | 3300047323 | Ga0495683_0053431 | Ga0495683_0053431_272_484 | 70 |
| 737 | 3300047444 | Ga0495675_0033110 | Ga0495675_0033110_2715_2927 | 70 |
| 738 | 3300047446 | Ga0495679_004782 | Ga0495679_004782_2682_2894 | 70 |
| 739 | 3300047446 | Ga0495679_006284 | Ga0495679_006284_2723_2935 | 70 |
| 740 | 3300047446 | Ga0495679_007342 | Ga0495679_007342_2779_2991 | 70 |
| 741 | 3300047446 | Ga0495679_009005 | Ga0495679_009005_2683_2895 | 70 |
| 742 | 3300047446 | Ga0495679_024829 | Ga0495679_024829_1627_1839 | 70 |
| 743 | 3300047446 | Ga0495679_084736 | Ga0495679_084736_128_340 | 70 |
| 744 | 3300047469 | Ga0495673_0012280 | Ga0495673_0012280_1633_1845 | 70 |
| 745 | 3300047469 | Ga0495673_0034645 | Ga0495673_0034645_433_645 | 70 |
| 746 | 3300047469 | Ga0495673_0039839 | Ga0495673_0039839_248_460 | 70 |
| 747 | 3300047469 | Ga0495673_0067706 | Ga0495673_0067706_525_737 | 70 |
| 748 | 3300047470 | Ga0495681_0013088 | Ga0495681_0013088_2980_3192 | 70 |
| 749 | 3300047470 | Ga0495681_0014365 | Ga0495681_0014365_2802_3014 | 70 |
| 750 | 3300047470 | Ga0495681_0015913 | Ga0495681_0015913_1422_1634 | 70 |
| 751 | 3300047470 | Ga0495681_0017538 | Ga0495681_0017538_1945_2157 | 70 |
| 752 | 3300047470 | Ga0495681_0031763 | Ga0495681_0031763_470_682 | 70 |
| 753 | 3300047472 | Ga0495686_0017198 | Ga0495686_0017198_2809_3021 | 70 |
| 754 | 3300047472 | Ga0495686_0028324 | Ga0495686_0028324_1905_2117 | 70 |
| 755 | 3300047472 | Ga0495686_0391820 | Ga0495686_0391820_404_616 | 70 |
| 756 | 3300047673 | Ga0495593_0571116 | Ga0495593_0571116_81_293 | 70 |
| 757 | 3300048088 | Ga0495602_0168373 | Ga0495602_0168373_1337_1549 | 70 |
| 758 | 3300048091 | Ga0495626_0012962 | Ga0495626_0012962_3947_4159 | 70 |
| 759 | 3300048091 | Ga0495626_0014781 | Ga0495626_0014781_1118_1330 | 70 |
| 760 | 3300048091 | Ga0495626_0040772 | Ga0495626_0040772_339_551 | 70 |
| 761 | 3300048091 | Ga0495626_0325299 | Ga0495626_0325299_156_368 | 70 |
| 762 | 3300048905 | Ga0496102_0015028 | Ga0496102_0015028_3775_3987 | 70 |
| 763 | 3300048906 | Ga0496103_0007043 | Ga0496103_0007043_2812_3024 | 70 |
| 764 | 3300048915 | Ga0496112_0868947 | Ga0496112_0868947_158_370 | 70 |
| 765 | 3300048919 | Ga0496116_0010235 | Ga0496116_0010235_3863_4075 | 70 |
| 766 | 3300048919 | Ga0496116_0011881 | Ga0496116_0011881_5078_5290 | 70 |
| 767 | 3300048919 | Ga0496116_0014498 | Ga0496116_0014498_2551_2763 | 70 |
| 768 | 3300048919 | Ga0496116_0045697 | Ga0496116_0045697_2701_2913 | 70 |
| 769 | 3300048919 | Ga0496116_0290925 | Ga0496116_0290925_518_730 | 70 |
| 770 | 3300048920 | Ga0496117_0003788 | Ga0496117_0003788_3197_3409 | 70 |
| 771 | 3300048920 | Ga0496117_0015710 | Ga0496117_0015710_3568_3780 | 70 |
| 772 | 3300048920 | Ga0496117_0017174 | Ga0496117_0017174_2656_2868 | 70 |
| 773 | 3300048920 | Ga0496117_0017394 | Ga0496117_0017394_1695_1907 | 70 |
| 774 | 3300048920 | Ga0496117_0024269 | Ga0496117_0024269_2188_2400 | 70 |
| 775 | 3300048920 | Ga0496117_0038709 | Ga0496117_0038709_2501_2713 | 70 |
| 776 | 3300048920 | Ga0496117_0047714 | Ga0496117_0047714_104_316 | 70 |
| 777 | 3300048921 | Ga0496118_0021090 | Ga0496118_0021090_4618_4830 | 70 |
| 778 | 3300048921 | Ga0496118_0021928 | Ga0496118_0021928_2829_3041 | 70 |
| 779 | 3300048921 | Ga0496118_0026565 | Ga0496118_0026565_1688_1900 | 70 |
| 780 | 3300048921 | Ga0496118_0026643 | Ga0496118_0026643_2398_2610 | 70 |
| 781 | 3300048921 | Ga0496118_0151486 | Ga0496118_0151486_648_860 | 70 |
| 782 | 3300048921 | Ga0496118_0490780 | Ga0496118_0490780_118_330 | 70 |
| 783 | 3300048921 | Ga0496118_0635397 | Ga0496118_0635397_99_311 | 70 |
| 784 | 3300048922 | Ga0496119_0014700 | Ga0496119_0014700_2698_2910 | 70 |
| 785 | 3300048922 | Ga0496119_0320503 | Ga0496119_0320503_91_303 | 70 |
| 786 | 3300048923 | Ga0496120_0011264 | Ga0496120_0011264_2753_2965 | 70 |
| 787 | 3300048924 | Ga0496121_0027608 | Ga0496121_0027608_3472_3684 | 70 |
| 788 | 3300048924 | Ga0496121_0037018 | Ga0496121_0037018_1854_2066 | 70 |
| 789 | 3300048924 | Ga0496121_0102499 | Ga0496121_0102499_1645_1857 | 70 |
| 790 | 3300048924 | Ga0496121_0159886 | Ga0496121_0159886_824_1036 | 70 |
| 791 | 3300048924 | Ga0496121_0549821 | Ga0496121_0549821_212_424 | 70 |
| 792 | 3300048925 | Ga0496122_0009759 | Ga0496122_0009759_4824_5036 | 70 |
| 793 | 3300048925 | Ga0496122_0025352 | Ga0496122_0025352_2220_2432 | 70 |
| 794 | 3300048925 | Ga0496122_0052514 | Ga0496122_0052514_43_255 | 70 |
| 795 | 3300048925 | Ga0496122_0473332 | Ga0496122_0473332_118_330 | 70 |
| 796 | 3300048925 | Ga0496122_0615068 | Ga0496122_0615068_31_243 | 70 |
| 797 | 3300048926 | Ga0496123_0017780 | Ga0496123_0017780_3793_4005 | 70 |
| 798 | 3300048926 | Ga0496123_0019673 | Ga0496123_0019673_2214_2426 | 70 |
| 799 | 3300048926 | Ga0496123_0041895 | Ga0496123_0041895_1635_1847 | 70 |
| 800 | 3300048926 | Ga0496123_0140762 | Ga0496123_0140762_260_472 | 70 |
| 801 | 3300048927 | Ga0496124_0001360 | Ga0496124_0001360_5007_5219 | 70 |
| 802 | 3300048927 | Ga0496124_0004110 | Ga0496124_0004110_13847_14059 | 70 |
| 803 | 3300048927 | Ga0496124_0020023 | Ga0496124_0020023_3535_3747 | 70 |
| 804 | 3300048927 | Ga0496124_0032675 | Ga0496124_0032675_2751_2963 | 70 |
| 805 | 3300048927 | Ga0496124_0038867 | Ga0496124_0038867_1446_1658 | 70 |
| 806 | 3300048927 | Ga0496124_0063583 | Ga0496124_0063583_2725_2937 | 70 |
| 807 | 3300048927 | Ga0496124_0461017 | Ga0496124_0461017_294_506 | 70 |
| 808 | 3300048928 | Ga0496125_0001314 | Ga0496125_0001314_5127_5339 | 70 |
| 809 | 3300048928 | Ga0496125_0004031 | Ga0496125_0004031_13870_14082 | 70 |
| 810 | 3300048928 | Ga0496125_0026261 | Ga0496125_0026261_2896_3108 | 70 |
| 811 | 3300048928 | Ga0496125_0032567 | Ga0496125_0032567_3320_3532 | 70 |
| 812 | 3300048928 | Ga0496125_0037057 | Ga0496125_0037057_1090_1302 | 70 |
| 813 | 3300048929 | Ga0496126_0001465 | Ga0496126_0001465_5118_5330 | 70 |
| 814 | 3300048929 | Ga0496126_0042232 | Ga0496126_0042232_3128_3340 | 70 |
| 815 | 3300048929 | Ga0496126_0080917 | Ga0496126_0080917_907_1119 | 70 |
| 816 | 3300048929 | Ga0496126_0489283 | Ga0496126_0489283_341_553 | 70 |
| 817 | 3300049459 | Ga0495678_006294 | Ga0495678_006294_2778_2990 | 70 |
| 818 | 3300049459 | Ga0495678_010004 | Ga0495678_010004_2765_2977 | 70 |
| 819 | 3300049459 | Ga0495678_010014 | Ga0495678_010014_653_865 | 70 |
| 820 | 3300049459 | Ga0495678_026192 | Ga0495678_026192_267_479 | 70 |
| 821 | 3300049459 | Ga0495678_031863 | Ga0495678_031863_1124_1336 | 70 |
| 822 | 3300049459 | Ga0495678_033723 | Ga0495678_033723_272_484 | 70 |
| 823 | 3300049459 | Ga0495678_042164 | Ga0495678_042164_1569_1781 | 70 |
| 824 | 3300049459 | Ga0495678_050096 | Ga0495678_050096_138_350 | 70 |
| 825 | 3300049460 | Ga0495682_0004569 | Ga0495682_0004569_1645_1857 | 70 |
| 826 | 3300049669 | Ga0501235_004019 | Ga0501235_004019_1386_1598 | 70 |
| 827 | 3300049758 | Ga0501241_001529 | Ga0501241_001529_1727_1939 | 70 |
| 828 | 3300050491 | nmdc:mga00v17_32366_c1 | nmdc:mga00v17_32366_c1_1426_1638 | 70 |
| 829 | 3300053088 | Ga0500644_0120422 | Ga0500644_0120422_765_977 | 70 |
| 830 | 3300053111 | Ga0500572_002223 | Ga0500572_002223_2904_3116 | 70 |
| 831 | 3300053126 | Ga0500621_040931 | Ga0500621_040931_281_493 | 70 |
| 832 | 3300053161 | Ga0500634_0005727 | Ga0500634_0005727_2694_2906 | 70 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6u5b-assembly1.cif.gz_6 | cryoem structure of pyocin r2 - precontracted - baseplate | 0.857 | 2 | 56 |
| 6u5b-assembly1.cif.gz_6 | cryoem structure of pyocin r2 - precontracted - baseplate | 0.8308 | 2 | 56 |
| 4a1i-assembly1.cif.gz_A | ykud from b.subtilis | 0.7989 | 1 | 56 |
| 4uz3-assembly1.cif.gz_A | crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose | 0.7646 | 1 | 55 |
| 6sgb-assembly1.cif.gz_CJ | mt-ssu assemblosome of trypanosoma brucei | 0.7445 | 1 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a1iG01 | Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain | 0.8003 | 1 | 55 | 3.10.350.10 |
| 4a1iG01 | Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain | 0.7864 | 1 | 55 | 3.10.350.10 |
| 5c8qB02 | Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain | 0.7322 | 1 | 53 | 3.10.350.10 |
| 1y7mB01 | Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain | 0.7248 | 2 | 55 | 3.10.350.10 |
| af_A0A0R0GJZ6_73_142_3.10.350.10 | Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain | 0.7245 | 2 | 56 | 3.10.350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B2TUJ1-F1-model_v4 | deleted | 0.9709 | 2 | 56 |
|
| AF-A0A5F1U8F8-F1-model_v4 | deleted | 0.9296 | 2 | 55 |
|
| AF-V0XX61-F1-model_v4 | deleted | 0.9293 | 2 | 56 |
|
| AF-A0A439F0D7-F1-model_v4 | deleted | 0.9281 | 2 | 56 |
|
| AF-A0A1I1F5Z9-F1-model_v4 | P2-like prophage tail protein X | 0.9278 | 1 | 56 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar