F482709

General Info

Members Datasets Scaffolds Average Seq Length
832 383 689 69

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000314|JGI25162J39368_100031423
Length 70
Sequence MRRVRSIAGDSVNLLLYRELNRCDDAAEEALWRLNPTLAEQGPVLPAGVWVVLPELDSKPAAIAAVSAWD

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231011 Pseudomonas sp. GM30 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231018 Pseudomonas sp. GM60 Isolate Nodule
8 2511231019 Pseudomonas sp. GM67 Isolate Nodule
9 2511231023 Pseudomonas sp. GM80 Isolate Nodule
10 2511231031 Pseudomonas sp. GM16 Isolate Nodule
11 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
12 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
13 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
16 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
17 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
18 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
19 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
20 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
21 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
22 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
23 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
24 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
25 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
26 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
27 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
28 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
29 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
30 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
31 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
32 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
33 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
34 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
35 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
36 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
37 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
38 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
39 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
40 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
41 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
42 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
43 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
44 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
45 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
46 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
47 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
48 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
49 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
50 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
51 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
52 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
53 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
54 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
55 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
56 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
57 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
58 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
59 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
60 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
61 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
62 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
63 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
64 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
65 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
66 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
67 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
68 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
69 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
70 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
71 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
72 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
73 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
74 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
75 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
76 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
77 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
78 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
79 2773857673 Pseudomonas sp. 443 Isolate Unclassified
80 2784132063 Pseudomonas sp. 424 Isolate Unclassified
81 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
82 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
83 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
84 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
85 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
86 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
87 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
88 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
89 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
90 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
91 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
92 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
93 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
94 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
95 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
96 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
97 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
98 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
99 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
100 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
101 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
102 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
103 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
104 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
105 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
106 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
107 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
108 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
109 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
110 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
111 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
112 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
113 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
114 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
115 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
116 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
117 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
118 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
119 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
120 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
121 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
122 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
123 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
124 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
125 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
126 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
127 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
128 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
129 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
130 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
131 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
132 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
133 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
134 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
135 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
136 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
137 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
138 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
139 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
140 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
141 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
142 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
143 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
144 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
145 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
146 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
147 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
148 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
149 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
150 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
151 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
152 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
153 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
154 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
155 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
156 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
157 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
160 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
161 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
162 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
163 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
167 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
168 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
169 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
170 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
171 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
172 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
173 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
174 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
175 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
176 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
177 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
180 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
181 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
182 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
189 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
190 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
191 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
194 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
202 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
204 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
206 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
207 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
232 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
235 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
251 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
252 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
255 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
260 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
261 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
262 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
263 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
264 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
265 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
266 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
267 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
268 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
269 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
270 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
273 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
274 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
275 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
332 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
366 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
367 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
370 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
371 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
372 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
373 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
374 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
375 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
376 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
377 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
378 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
379 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
380 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
381 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
382 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
383 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0
Isolates 17.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 1.68
Rhizoplane 5.65
Rhizosphere 70.91
Stem 0
Stem Tuber 0
Unclassified 14.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_10507 2124908027 Bacteria 1030
2 JGI25162J39368_1000314 3300002737 Bacteria 42959
3 JGI25154J39366_1008106 3300002738 Bacteria 1381
4 JGI25163J39215_1000669 3300002771 Bacteria 9200
5 JGI25164J39214_1000233 3300002772 Bacteria 42959
6 JGI25165J46597_1000429 3300003214 Bacteria 42959
7 Ga0055538_1000073 3300003751 Bacteria 90843
8 Ga0055539_1000109 3300003752 Bacteria 90843
9 Ga0055533_1000117 3300003756 Bacteria 90843
10 Ga0055532_1000120 3300003758 Bacteria 81088
11 Ga0055525_1000156 3300003759 Bacteria 90843
12 Ga0055535_1012414 3300003761 Bacteria 1300
13 Ga0055536_1000217 3300003781 Bacteria 47045
14 Ga0055536_1080317 3300003781 Bacteria 620
15 Ga0055530_10000454 3300003791 Bacteria 36466
16 Ga0055530_10000608 3300003791 Bacteria 31086
17 Ga0055540_1000782 3300003792 Bacteria 21518
18 Ga0055540_1000856 3300003792 Bacteria 20321
19 Ga0055540_1000983 3300003792 Bacteria 18381
20 Ga0055531_10000458 3300003794 Bacteria 37744
21 Ga0055531_10081760 3300003794 Bacteria 709
22 Ga0055541_1000074 3300003841 Bacteria 90843
23 Ga0065714_10003741 3300005288 Bacteria 6419
24 Ga0065714_10073190 3300005288 Bacteria 3224
25 Ga0065714_10100675 3300005288 Bacteria 1659
26 Ga0065714_10121432 3300005288 Bacteria 1327
27 Ga0065714_10158722 3300005288 Bacteria 1056
28 Ga0065714_10285499 3300005288 Bacteria 716
29 Ga0065714_10400322 3300005288 Bacteria 590
30 Ga0065714_10414697 3300005288 Bacteria 579
31 Ga0065704_10085319 3300005289 Bacteria 3230
32 Ga0065704_10202127 3300005289 Bacteria 1142
33 Ga0065704_10512990 3300005289 Bacteria 659
34 Ga0065715_10183624 3300005293 Bacteria 1459
35 Ga0070676_11084806 3300005328 Bacteria 604
36 Ga0070670_100001560 3300005331 Bacteria 18469
37 Ga0070661_100000219 3300005344 Bacteria 47253
38 Ga0070669_100005257 3300005353 Bacteria 9348
39 Ga0070669_100193851 3300005353 Bacteria 1595
40 Ga0070675_100908006 3300005354 Bacteria 807
41 Ga0070659_100343444 3300005366 Bacteria 1251
42 Ga0070662_100000526 3300005457 Bacteria 23089
43 Ga0068853_100044913 3300005539 Bacteria 3783
44 Ga0070665_100197824 3300005548 Bacteria 2011
45 Ga0070665_102241838 3300005548 Bacteria 550
46 Ga0070664_100001287 3300005564 Bacteria 20065
47 Ga0070664_100219163 3300005564 Bacteria 1702
48 Ga0068857_101085710 3300005577 Bacteria 772
49 Ga0068854_100088869 3300005578 Bacteria 2295
50 Ga0068851_10000037 3300005834 Bacteria 97386
51 Ga0075363_100794700 3300006048 Bacteria 575
52 Ga0075364_10091225 3300006051 Bacteria 2021
53 Ga0075364_10645866 3300006051 Bacteria 723
54 Ga0075432_10044984 3300006058 Bacteria 1548
55 Ga0075362_10409339 3300006177 Bacteria 685
56 Ga0079104_1031169 3300006946 Bacteria 1324
57 Ga0079104_1113999 3300006946 Bacteria 533
58 Ga0105251_10012223 3300009011 Bacteria 4868
59 Ga0105251_10012906 3300009011 Bacteria 4700
60 Ga0105251_10016148 3300009011 Bacteria 4046
61 Ga0105251_10025392 3300009011 Bacteria 3031
62 Ga0105251_10048612 3300009011 Bacteria 2032
63 Ga0105251_10095695 3300009011 Bacteria 1361
64 Ga0105251_10237219 3300009011 Bacteria 821
65 Ga0105244_10002831 3300009036 Bacteria 12873
66 Ga0105244_10008193 3300009036 Bacteria 6552
67 Ga0105244_10012245 3300009036 Bacteria 5081
68 Ga0105244_10014588 3300009036 Bacteria 4540
69 Ga0105244_10014962 3300009036 Bacteria 4464
70 Ga0105244_10017866 3300009036 Bacteria 3995
71 Ga0105244_10054715 3300009036 Bacteria 2024
72 Ga0105244_10108772 3300009036 Bacteria 1350
73 Ga0105244_10281955 3300009036 Bacteria 771
74 Ga0105250_10001299 3300009092 Bacteria 13711
75 Ga0105250_10002968 3300009092 Bacteria 8248
76 Ga0105250_10003980 3300009092 Bacteria 6895
77 Ga0105250_10006308 3300009092 Bacteria 5196
78 Ga0105250_10006540 3300009092 Bacteria 5086
79 Ga0105250_10010198 3300009092 Bacteria 3920
80 Ga0105250_10049892 3300009092 Bacteria 1679
81 Ga0105250_10268924 3300009092 Bacteria 731
82 Ga0105250_10314310 3300009092 Bacteria 680
83 Ga0105243_10001686 3300009148 Bacteria 19035
84 Ga0105242_10001117 3300009176 Bacteria 21160
85 Ga0105242_10479699 3300009176 Bacteria 1178
86 Ga0105248_10360193 3300009177 Bacteria 1637
87 Ga0105237_10000196 3300009545 Bacteria 85826
88 Ga0105237_11306265 3300009545 Bacteria 732
89 Ga0105246_10000347 3300011119 Bacteria 24747
90 Ga0105246_10184366 3300011119 Bacteria 1610
91 Ga0157345_1000275 3300012498 Bacteria 7154
92 Ga0157347_1023079 3300012502 Bacteria 740
93 Ga0157373_10002861 3300013100 Bacteria 13064
94 Ga0157373_10010905 3300013100 Bacteria 6690
95 Ga0157373_10014633 3300013100 Bacteria 5752
96 Ga0157373_10015166 3300013100 Bacteria 5636
97 Ga0157373_10027040 3300013100 Bacteria 4140
98 Ga0157373_10035028 3300013100 Bacteria 3605
99 Ga0157373_10042598 3300013100 Bacteria 3244
100 Ga0157373_10049466 3300013100 Bacteria 2996
101 Ga0157373_10062807 3300013100 Bacteria 2630
102 Ga0157373_10408416 3300013100 Bacteria 974
103 Ga0157373_11478315 3300013100 Bacteria 518
104 Ga0157371_10005463 3300013102 Bacteria 10713
105 Ga0157371_10011393 3300013102 Bacteria 6857
106 Ga0157371_10017484 3300013102 Bacteria 5326
107 Ga0157371_10036018 3300013102 Bacteria 3544
108 Ga0157371_11129102 3300013102 Bacteria 602
109 Ga0157371_11262203 3300013102 Bacteria 571
110 Ga0157370_10033664 3300013104 Bacteria 4995
111 Ga0157370_10039583 3300013104 Bacteria 4556
112 Ga0157370_10040981 3300013104 Bacteria 4470
113 Ga0157370_10091076 3300013104 Bacteria 2863
114 Ga0157370_10113572 3300013104 Bacteria 2531
115 Ga0157370_10125900 3300013104 Bacteria 2391
116 Ga0157370_10229640 3300013104 Bacteria 1718
117 Ga0157370_10569065 3300013104 Bacteria 1038
118 Ga0157369_10029322 3300013105 Bacteria 6081
119 Ga0157369_10032822 3300013105 Bacteria 5705
120 Ga0157369_10057162 3300013105 Bacteria 4209
121 Ga0157369_10062767 3300013105 Bacteria 4003
122 Ga0157369_10403856 3300013105 Bacteria 1417
123 Ga0157369_10968652 3300013105 Bacteria 871
124 Ga0157369_10969952 3300013105 Bacteria 871
125 Ga0163162_10013275 3300013306 Bacteria 8046
126 Ga0163162_10070183 3300013306 Bacteria 3555
127 Ga0163162_10070757 3300013306 Bacteria 3540
128 Ga0163162_10116012 3300013306 Bacteria 2778
129 Ga0163162_10145310 3300013306 Bacteria 2487
130 Ga0163162_11051021 3300013306 Bacteria 922
131 Ga0157372_10060956 3300013307 Bacteria 4222
132 Ga0157375_10017263 3300013308 Bacteria 6508
133 Ga0157375_10040228 3300013308 Bacteria 4505
134 Ga0157375_10348925 3300013308 Bacteria 1646
135 Ga0182008_10006874 3300014497 Bacteria 6324
136 Ga0182008_10006946 3300014497 Bacteria 6283
137 Ga0182008_10007839 3300014497 Bacteria 5870
138 Ga0182008_10009184 3300014497 Bacteria 5345
139 Ga0182008_10009723 3300014497 Bacteria 5179
140 Ga0182008_10023747 3300014497 Bacteria 3127
141 Ga0182008_10038097 3300014497 Bacteria 2405
142 Ga0182008_10091972 3300014497 Bacteria 1496
143 Ga0182006_1004889 3300015261 Bacteria 6494
144 Ga0182006_1005668 3300015261 Bacteria 5916
145 Ga0182006_1015770 3300015261 Bacteria 3233
146 Ga0182006_1027577 3300015261 Bacteria 2316
147 Ga0182006_1030332 3300015261 Bacteria 2185
148 Ga0182006_1084722 3300015261 Bacteria 1150
149 Ga0182006_1196957 3300015261 Bacteria 668
150 Ga0182007_10001094 3300015262 Bacteria 14746
151 Ga0182007_10002411 3300015262 Bacteria 9336
152 Ga0182007_10005509 3300015262 Bacteria 5550
153 Ga0182007_10006179 3300015262 Bacteria 5168
154 Ga0182005_1001507 3300015265 Bacteria 9285
155 Ga0163161_10002369 3300017792 Bacteria 13501
156 Ga0163161_10019070 3300017792 Bacteria 4807
157 Ga0163161_10020602 3300017792 Bacteria 4629
158 Ga0163161_10020764 3300017792 Bacteria 4610
159 Ga0163161_10082956 3300017792 Bacteria 2362
160 Ga0163161_10094157 3300017792 Bacteria 2220
161 Ga0163161_10094905 3300017792 Bacteria 2212
162 Ga0163161_10101375 3300017792 Bacteria 2143
163 Ga0163161_10172702 3300017792 Bacteria 1653
164 Ga0163161_10188602 3300017792 Bacteria 1584
165 Ga0163161_10434744 3300017792 Bacteria 1058
166 Ga0163161_10434745 3300017792 Bacteria 1058
167 Ga0163161_11283940 3300017792 Bacteria 636
168 Ga0163161_11918908 3300017792 Bacteria 527
169 Ga0209435_100620 3300025206 Bacteria 6478
170 Ga0209760_100046 3300025207 Bacteria 107840
171 Ga0209784_100015 3300025224 Bacteria 482117
172 Ga0209566_100012 3300025225 Bacteria 482281
173 Ga0209674_100027 3300025226 Bacteria 482281
174 Ga0209147_100019 3300025229 Bacteria 482139
175 Ga0209563_100031 3300025230 Bacteria 482281
176 Ga0209563_100578 3300025230 Bacteria 12184
177 Ga0207427_100029 3300025231 Bacteria 376678
178 Ga0209437_100009 3300025233 Bacteria 915954
179 Ga0209437_103326 3300025233 Bacteria 2926
180 Ga0209258_100296 3300025242 Bacteria 81403
181 Ga0209646_1000213 3300025246 Bacteria 64543
182 Ga0209677_100016 3300025253 Bacteria 482117
183 Ga0209759_1022755 3300025256 Bacteria 1395
184 Ga0209233_1000032 3300025261 Bacteria 623596
185 Ga0209675_1002947 3300025291 Bacteria 8397
186 Ga0209676_1000016 3300025292 Bacteria 655561
187 Ga0209676_1000080 3300025292 Bacteria 287400
188 Ga0209676_1000397 3300025292 Bacteria 79463
189 Ga0209676_1003696 3300025292 Bacteria 9144
190 Ga0209676_1007897 3300025292 Bacteria 4880
191 Ga0209050_1000208 3300025298 Bacteria 131310
192 Ga0209050_1000588 3300025298 Bacteria 58223
193 Ga0209050_1000978 3300025298 Bacteria 36519
194 Ga0209050_1001235 3300025298 Bacteria 29568
195 Ga0209051_1000219 3300025303 Bacteria 96484
196 Ga0209051_1000422 3300025303 Bacteria 58223
197 Ga0209051_1000498 3300025303 Bacteria 50496
198 Ga0209051_1008755 3300025303 Bacteria 5314
199 Ga0209051_1086793 3300025303 Bacteria 884
200 Ga0209257_1000342 3300025304 Bacteria 97045
201 Ga0209257_1005479 3300025304 Bacteria 8888
202 Ga0207656_10000014 3300025321 Bacteria 146941
203 Ga0207696_1000032 3300025711 Bacteria 380071
204 Ga0207696_1000221 3300025711 Bacteria 82620
205 Ga0207696_1004504 3300025711 Bacteria 5995
206 Ga0207696_1011909 3300025711 Bacteria 3104
207 Ga0207696_1014700 3300025711 Bacteria 2676
208 Ga0207696_1019928 3300025711 Bacteria 2171
209 Ga0207696_1206397 3300025711 Bacteria 515
210 Ga0207655_1000563 3300025728 Bacteria 46042
211 Ga0207655_1001730 3300025728 Bacteria 19165
212 Ga0207655_1001921 3300025728 Bacteria 17795
213 Ga0207655_1002210 3300025728 Bacteria 16145
214 Ga0207655_1008923 3300025728 Bacteria 6294
215 Ga0207655_1009718 3300025728 Bacteria 5936
216 Ga0207655_1013256 3300025728 Bacteria 4744
217 Ga0207655_1072946 3300025728 Bacteria 1267
218 Ga0207713_1000751 3300025735 Bacteria 30209
219 Ga0207713_1001304 3300025735 Bacteria 20486
220 Ga0207713_1004618 3300025735 Bacteria 8897
221 Ga0207713_1005033 3300025735 Bacteria 8402
222 Ga0207713_1060590 3300025735 Bacteria 1445
223 Ga0207713_1094647 3300025735 Bacteria 1042
224 Ga0207713_1101584 3300025735 Bacteria 991
225 Ga0207713_1133211 3300025735 Bacteria 820
226 Ga0207645_10323487 3300025907 Bacteria 1029
227 Ga0207671_10000019 3300025914 Bacteria 317781
228 Ga0207671_10756619 3300025914 Bacteria 772
229 Ga0207649_10000002 3300025920 Bacteria 498633
230 Ga0207681_10000584 3300025923 Bacteria 24838
231 Ga0207681_10351496 3300025923 Bacteria 1180
232 Ga0207650_10000198 3300025925 Bacteria 69296
233 Ga0207706_10006246 3300025933 Bacteria 11074
234 Ga0207706_11118717 3300025933 Bacteria 657
235 Ga0207686_10004351 3300025934 Bacteria 7590
236 Ga0207709_10000228 3300025935 Bacteria 70988
237 Ga0207709_10218401 3300025935 Bacteria 1373
238 Ga0207711_10337733 3300025941 Bacteria 1394
239 Ga0207679_10000006 3300025945 Bacteria 498868
240 Ga0207679_10168660 3300025945 Bacteria 1800
241 Ga0207640_10111564 3300025981 Bacteria 1940
242 Ga0207639_10036231 3300026041 Bacteria 3655
243 Ga0207674_10477926 3300026116 Bacteria 1204
244 Ga0209281_1005084 3300027111 Bacteria 3737
245 Ga0209281_1009764 3300027111 Bacteria 2233
246 Ga0268266_10486158 3300028379 Bacteria 1177
247 Ga0268266_11515706 3300028379 Bacteria 646
248 Ga0307517_10077807 3300028786 Bacteria 2877
249 Ga0307511_10097542 3300030521 Bacteria 1951
250 Ga0314311_1008105 3300030733 Bacteria 2445
251 Ga0316179_1104439 3300030734 Bacteria 722
252 Ga0316181_1138181 3300030744 Bacteria 797
253 Ga0265316_10640564 3300031344 Bacteria 752
254 Ga0307509_10075412 3300031507 Bacteria 3503
255 Ga0307408_100001454 3300031548 Bacteria 17613
256 Ga0307408_100014079 3300031548 Bacteria 5313
257 Ga0307408_100044212 3300031548 Bacteria 3172
258 Ga0307408_100117588 3300031548 Bacteria 2053
259 Ga0307408_100277440 3300031548 Bacteria 1394
260 Ga0307516_10448767 3300031730 Bacteria 946
261 Ga0307405_10000211 3300031731 Bacteria 21038
262 Ga0307405_10006627 3300031731 Bacteria 5713
263 Ga0307405_10015096 3300031731 Bacteria 4172
264 Ga0307405_10068258 3300031731 Bacteria 2274
265 Ga0307405_10764482 3300031731 Bacteria 806
266 Ga0307413_10161084 3300031824 Bacteria 1576
267 Ga0307413_10201067 3300031824 Bacteria 1439
268 Ga0307413_10354414 3300031824 Bacteria 1133
269 Ga0307413_11085657 3300031824 Bacteria 690
270 Ga0307406_10005906 3300031901 Bacteria 6716
271 Ga0307406_10114886 3300031901 Bacteria 1860
272 Ga0307406_12141292 3300031901 Bacteria 501
273 Ga0307407_10010259 3300031903 Bacteria 4410
274 Ga0307407_10511291 3300031903 Bacteria 882
275 Ga0307412_10010299 3300031911 Bacteria 5384
276 Ga0307412_10011063 3300031911 Bacteria 5214
277 Ga0307412_10031694 3300031911 Bacteria 3341
278 Ga0307412_10359686 3300031911 Bacteria 1171
279 Ga0307409_100049132 3300031995 Bacteria 3214
280 Ga0307416_100094947 3300032002 Bacteria 2573
281 Ga0307416_101579234 3300032002 Bacteria 761
282 Ga0307416_103348128 3300032002 Bacteria 536
283 Ga0307414_10018788 3300032004 Bacteria 4266
284 Ga0307414_10045625 3300032004 Bacteria 3002
285 Ga0307414_10359384 3300032004 Bacteria 1252
286 Ga0307414_10399394 3300032004 Bacteria 1193
287 Ga0307411_10181079 3300032005 Bacteria 1599
288 Ga0307411_10582136 3300032005 Bacteria 959
289 Ga0307411_12224294 3300032005 Bacteria 514
290 Ga0307510_10045373 3300033180 Bacteria 4745
291 Ga0237819_01118 3300038705 Bacteria 7806
292 Ga0439438_001775 3300041405 Bacteria 9461
293 Ga0439438_005677 3300041405 Bacteria 4545
294 Ga0439438_035191 3300041405 Bacteria 1316
295 Ga0439447_005066 3300041407 Bacteria 4429
296 Ga0439447_015790 3300041407 Bacteria 2088
297 Ga0439447_047242 3300041407 Bacteria 1034
298 Ga0439466_0002005 3300041411 Bacteria 7987
299 Ga0439466_0002810 3300041411 Bacteria 6819
300 Ga0439466_0023603 3300041411 Bacteria 2161
301 Ga0451833_0896841 3300041491 Bacteria 572
302 Ga0451841_1119567 3300041498 Bacteria 705
303 Ga0439432_000218 3300042006 Bacteria 20648
304 Ga0439432_004736 3300042006 Bacteria 4951
305 Ga0439451_001422 3300042009 Bacteria 4737
306 Ga0439451_001463 3300042009 Bacteria 4666
307 Ga0439451_001543 3300042009 Bacteria 4561
308 Ga0439452_002186 3300042010 Bacteria 7378
309 Ga0439452_010650 3300042010 Bacteria 2664
310 Ga0439456_000904 3300042013 Bacteria 5941
311 Ga0439456_009554 3300042013 Bacteria 2004
312 Ga0439456_015497 3300042013 Bacteria 1591
313 Ga0439456_088308 3300042013 Bacteria 695
314 Ga0439456_124524 3300042013 Bacteria 592
315 Ga0439463_001133 3300042016 Bacteria 7151
316 Ga0439463_009946 3300042016 Bacteria 2336
317 Ga0439463_025238 3300042016 Bacteria 1490
318 Ga0450911_001005 3300042115 Bacteria 7254
319 Ga0450911_002792 3300042115 Bacteria 3292
320 Ga0450894_002158 3300042131 Bacteria 2677
321 Ga0450896_051657 3300042133 Bacteria 656
322 Ga0450898_000324 3300042134 Bacteria 5421
323 Ga0450900_078226 3300042136 Bacteria 529
324 Ga0450903_011045 3300042138 Bacteria 1457
325 Ga0450903_020283 3300042138 Bacteria 1028
326 Ga0450903_042307 3300042138 Bacteria 673
327 Ga0450904_001481 3300042139 Bacteria 3262
328 Ga0450904_003275 3300042139 Bacteria 1775
329 Ga0450904_022331 3300042139 Bacteria 645
330 Ga0450905_001492 3300042142 Bacteria 2981
331 Ga0450905_006037 3300042142 Bacteria 1632
332 Ga0450905_021768 3300042142 Bacteria 950
333 Ga0450889_006958 3300042144 Bacteria 1138
334 Ga0450906_000914 3300042145 Bacteria 6442
335 Ga0450906_076923 3300042145 Bacteria 600
336 Ga0450907_100567 3300042146 Bacteria 503
337 Ga0450918_043507 3300042531 Bacteria 809
338 Ga0450893_0003145 3300042532 Bacteria 2594
339 Ga0450901_000311 3300042533 Bacteria 5951
340 Ga0439440_0001087 3300042993 Bacteria 4848
341 Ga0495617_004684 3300046452 Bacteria 4944
342 Ga0495617_010329 3300046452 Bacteria 3197
343 Ga0495617_033259 3300046452 Bacteria 1730
344 Ga0495627_000810 3300046453 Bacteria 22858
345 Ga0495627_001143 3300046453 Bacteria 17139
346 Ga0495627_004239 3300046453 Bacteria 6055
347 Ga0495627_006494 3300046453 Bacteria 4582
348 Ga0495627_022672 3300046453 Bacteria 2063
349 Ga0495627_024034 3300046453 Bacteria 1990
350 Ga0495592_0030778 3300046454 Bacteria 4059
351 Ga0495603_0011876 3300046455 Bacteria 5270
352 Ga0495590_0007727 3300046457 Bacteria 4131
353 Ga0495590_0011922 3300046457 Bacteria 3239
354 Ga0495590_0013501 3300046457 Bacteria 3000
355 Ga0495591_001155 3300046458 Bacteria 17315
356 Ga0495591_006386 3300046458 Bacteria 5219
357 Ga0495591_007252 3300046458 Bacteria 4742
358 Ga0495591_007370 3300046458 Bacteria 4686
359 Ga0495591_007644 3300046458 Bacteria 4558
360 Ga0495591_007669 3300046458 Bacteria 4548
361 Ga0495591_011483 3300046458 Bacteria 3352
362 Ga0495591_036181 3300046458 Bacteria 1439
363 Ga0495629_0755737 3300046459 Bacteria 643
364 Ga0495638_0011165 3300046460 Bacteria 6202
365 Ga0495638_0022088 3300046460 Bacteria 4179
366 Ga0495653_0023583 3300046463 Bacteria 4968
367 Ga0495653_0076256 3300046463 Bacteria 2492
368 Ga0495653_0090896 3300046463 Bacteria 2232
369 Ga0495653_0152125 3300046463 Bacteria 1615
370 Ga0495650_0049782 3300046471 Bacteria 1737
371 Ga0495650_0057233 3300046471 Bacteria 1578
372 Ga0495580_0200955 3300046472 Bacteria 1373
373 Ga0495605_0026001 3300046474 Bacteria 3045
374 Ga0495605_0049188 3300046474 Bacteria 2060
375 Ga0495605_0123030 3300046474 Bacteria 1175
376 Ga0495639_0002507 3300046475 Bacteria 8008
377 Ga0495639_0053748 3300046475 Bacteria 1835
378 Ga0495639_0601398 3300046475 Bacteria 565
379 Ga0495584_0010855 3300046491 Bacteria 4674
380 Ga0495584_0135646 3300046491 Bacteria 1249
381 Ga0495584_0416303 3300046491 Bacteria 683
382 Ga0495585_0006492 3300046492 Bacteria 7247
383 Ga0495585_0015212 3300046492 Bacteria 4471
384 Ga0495585_0018275 3300046492 Bacteria 4046
385 Ga0495594_0017438 3300046499 Bacteria 3795
386 Ga0495596_0009030 3300046500 Bacteria 4406
387 Ga0495596_0052679 3300046500 Bacteria 1593
388 Ga0495607_0006191 3300046501 Bacteria 8454
389 Ga0495607_0010371 3300046501 Bacteria 6267
390 Ga0495607_0023358 3300046501 Bacteria 3871
391 Ga0495607_0027948 3300046501 Bacteria 3483
392 Ga0495607_0043926 3300046501 Bacteria 2638
393 Ga0495607_0055803 3300046501 Bacteria 2270
394 Ga0495607_0139900 3300046501 Bacteria 1249
395 Ga0495607_0267865 3300046501 Bacteria 815
396 Ga0495583_0009218 3300046506 Bacteria 5918
397 Ga0495583_0012785 3300046506 Bacteria 4726
398 Ga0495583_0135363 3300046506 Bacteria 1029
399 Ga0495606_0003047 3300046507 Bacteria 18265
400 Ga0495606_0015732 3300046507 Bacteria 5809
401 Ga0495606_0016386 3300046507 Bacteria 5653
402 Ga0495606_0022242 3300046507 Bacteria 4624
403 Ga0495606_0053975 3300046507 Bacteria 2604
404 Ga0495606_0231021 3300046507 Bacteria 1036
405 Ga0495610_0013527 3300046512 Bacteria 4847
406 Ga0495610_0013908 3300046512 Bacteria 4754
407 Ga0495610_0013963 3300046512 Bacteria 4746
408 Ga0495610_0020334 3300046512 Bacteria 3687
409 Ga0495610_0020848 3300046512 Bacteria 3623
410 Ga0495610_0024945 3300046512 Bacteria 3219
411 Ga0495610_0151567 3300046512 Bacteria 988
412 Ga0495616_0012861 3300046513 Bacteria 4735
413 Ga0495616_0013844 3300046513 Bacteria 4535
414 Ga0495616_0022830 3300046513 Bacteria 3373
415 Ga0495616_0345568 3300046513 Unclassified 620
416 Ga0495620_0000541 3300046515 Bacteria 24054
417 Ga0495620_0001018 3300046515 Bacteria 17248
418 Ga0495620_0013871 3300046515 Bacteria 4112
419 Ga0495620_0016550 3300046515 Bacteria 3695
420 Ga0495620_0079755 3300046515 Bacteria 1325
421 Ga0495620_0087104 3300046515 Bacteria 1256
422 Ga0495620_0410529 3300046515 Bacteria 513
423 Ga0495628_0016960 3300046516 Bacteria 6069
424 Ga0495630_0299202 3300046517 Bacteria 1229
425 Ga0495631_0006632 3300046518 Bacteria 5952
426 Ga0495631_0011766 3300046518 Bacteria 4292
427 Ga0495631_0082780 3300046518 Bacteria 1383
428 Ga0495631_0287733 3300046518 Bacteria 699
429 Ga0495632_0006763 3300046519 Bacteria 7327
430 Ga0495632_0012829 3300046519 Bacteria 4809
431 Ga0495632_0014412 3300046519 Bacteria 4473
432 Ga0495632_0019451 3300046519 Bacteria 3698
433 Ga0495632_0019635 3300046519 Bacteria 3676
434 Ga0495632_0020449 3300046519 Bacteria 3583
435 Ga0495632_0032082 3300046519 Bacteria 2709
436 Ga0495632_0144123 3300046519 Bacteria 1104
437 Ga0495632_0226960 3300046519 Bacteria 843
438 Ga0495637_0006188 3300046520 Bacteria 6022
439 Ga0495637_0010276 3300046520 Bacteria 4534
440 Ga0495637_0039629 3300046520 Bacteria 2032
441 Ga0495637_0111858 3300046520 Bacteria 1057
442 Ga0495637_0365829 3300046520 Bacteria 504
443 Ga0495643_0014153 3300046522 Bacteria 4754
444 Ga0495643_0322346 3300046522 Bacteria 698
445 Ga0495644_0005943 3300046523 Bacteria 4758
446 Ga0495644_0036428 3300046523 Bacteria 1856
447 Ga0495648_0022907 3300046524 Bacteria 4288
448 Ga0495648_0033869 3300046524 Bacteria 3331
449 Ga0495648_0064488 3300046524 Bacteria 2157
450 Ga0495648_0069849 3300046524 Bacteria 2043
451 Ga0495648_0159098 3300046524 Bacteria 1169
452 Ga0495648_0483429 3300046524 Bacteria 534
453 Ga0495666_0022371 3300046526 Bacteria 3130
454 Ga0495666_0136323 3300046526 Bacteria 1145
455 Ga0495666_0299437 3300046526 Bacteria 727
456 Ga0495652_0100729 3300046529 Bacteria 2343
457 Ga0495654_0007901 3300046530 Bacteria 5914
458 Ga0495654_0011506 3300046530 Bacteria 4784
459 Ga0495654_0012204 3300046530 Bacteria 4622
460 Ga0495654_0012426 3300046530 Bacteria 4573
461 Ga0495654_0016147 3300046530 Bacteria 3952
462 Ga0495654_0020443 3300046530 Bacteria 3449
463 Ga0495654_0036912 3300046530 Bacteria 2454
464 Ga0495654_0061131 3300046530 Bacteria 1809
465 Ga0495654_0063005 3300046530 Bacteria 1776
466 Ga0495654_0087461 3300046530 Bacteria 1450
467 Ga0495654_0114126 3300046530 Bacteria 1229
468 Ga0495665_0530551 3300046531 Bacteria 592
469 Ga0495587_0007914 3300046536 Bacteria 6864
470 Ga0495587_0078080 3300046536 Bacteria 1921
471 Ga0495609_0006215 3300046538 Bacteria 6134
472 Ga0495609_0007044 3300046538 Bacteria 5661
473 Ga0495609_0009365 3300046538 Bacteria 4742
474 Ga0495609_0009379 3300046538 Bacteria 4736
475 Ga0495609_0372002 3300046538 Bacteria 574
476 Ga0495597_0005919 3300046542 Bacteria 6385
477 Ga0495597_0010124 3300046542 Bacteria 4620
478 Ga0495622_0003103 3300046557 Bacteria 7875
479 Ga0495622_0008899 3300046557 Bacteria 4652
480 Ga0495622_0051517 3300046557 Bacteria 1909
481 Ga0495633_0011913 3300046558 Bacteria 4654
482 Ga0495633_0032628 3300046558 Bacteria 2515
483 Ga0495668_0009771 3300046616 Bacteria 5856
484 Ga0495668_0063413 3300046616 Bacteria 2035
485 Ga0495668_0552460 3300046616 Bacteria 635
486 Ga0495634_0010409 3300046642 Bacteria 6814
487 Ga0495634_0021710 3300046642 Bacteria 4532
488 Ga0495611_0000533 3300046648 Bacteria 22444
489 Ga0495611_0028320 3300046648 Bacteria 2452
490 Ga0495625_0014932 3300046660 Bacteria 6174
491 Ga0495625_0022059 3300046660 Bacteria 4888
492 Ga0495625_0033324 3300046660 Bacteria 3810
493 Ga0495625_0049401 3300046660 Bacteria 3024
494 Ga0495625_0089576 3300046660 Bacteria 2129
495 Ga0495635_0009500 3300046663 Bacteria 6797
496 Ga0495659_0001182 3300046664 Bacteria 9064
497 Ga0495659_0003189 3300046664 Bacteria 5253
498 Ga0495661_0001773 3300046665 Bacteria 17355
499 Ga0495661_0011567 3300046665 Bacteria 5983
500 Ga0495661_0017508 3300046665 Bacteria 4730
501 Ga0495661_0025390 3300046665 Bacteria 3827
502 Ga0495661_0051810 3300046665 Bacteria 2476
503 Ga0495661_0114022 3300046665 Bacteria 1502
504 Ga0495588_0038419 3300046674 Bacteria 2435
505 Ga0495588_0284052 3300046674 Bacteria 872
506 Ga0495623_0008751 3300046679 Bacteria 6572
507 Ga0495623_0272578 3300046679 Bacteria 944
508 Ga0495646_0015656 3300046680 Bacteria 4812
509 Ga0495646_0030269 3300046680 Bacteria 3380
510 Ga0495613_0019131 3300046689 Bacteria 5104
511 Ga0495613_0042719 3300046689 Bacteria 3354
512 Ga0495624_0006645 3300046690 Bacteria 8175
513 Ga0495670_0004726 3300046691 Bacteria 6688
514 Ga0495670_0005868 3300046691 Bacteria 6019
515 Ga0495670_0009600 3300046691 Bacteria 4753
516 Ga0495670_0117443 3300046691 Bacteria 1380
517 Ga0495671_0010571 3300046692 Bacteria 5102
518 Ga0495671_0026540 3300046692 Bacteria 3002
519 Ga0495671_0031948 3300046692 Bacteria 2689
520 Ga0495671_0046125 3300046692 Bacteria 2179
521 Ga0495671_0105579 3300046692 Bacteria 1375
522 Ga0495671_0467173 3300046692 Bacteria 603
523 Ga0495649_0006725 3300046694 Bacteria 7124
524 Ga0495649_0009344 3300046694 Bacteria 5833
525 Ga0495649_0023250 3300046694 Bacteria 3463
526 Ga0495649_0046448 3300046694 Bacteria 2364
527 Ga0495649_0058758 3300046694 Bacteria 2072
528 Ga0495649_0088999 3300046694 Bacteria 1646
529 Ga0495589_0006201 3300046794 Bacteria 6313
530 Ga0495589_0006708 3300046794 Bacteria 6063
531 Ga0495589_0010389 3300046794 Bacteria 4836
532 Ga0495589_0106710 3300046794 Bacteria 1353
533 Ga0495589_0243403 3300046794 Bacteria 841
534 Ga0495589_0272186 3300046794 Bacteria 788
535 Ga0495600_0128351 3300046809 Bacteria 1648
536 Ga0495660_0007512 3300046810 Bacteria 6398
537 Ga0495660_0014390 3300046810 Bacteria 4578
538 Ga0495660_0018471 3300046810 Bacteria 4009
539 Ga0495660_0023146 3300046810 Bacteria 3545
540 Ga0495660_0115765 3300046810 Bacteria 1362
541 Ga0495660_0259240 3300046810 Bacteria 803
542 Ga0495604_0027772 3300047317 Bacteria 4500
543 Ga0495604_0028414 3300047317 Bacteria 4449
544 Ga0495674_0062006 3300047319 Bacteria 3256
545 Ga0495672_0009200 3300047320 Bacteria 7191
546 Ga0495672_0012168 3300047320 Bacteria 6021
547 Ga0495672_0018399 3300047320 Bacteria 4639
548 Ga0495672_0084394 3300047320 Bacteria 1761
549 Ga0495676_0027690 3300047321 Bacteria 4856
550 Ga0495676_0033107 3300047321 Bacteria 4357
551 Ga0495680_0022793 3300047322 Bacteria 5214
552 Ga0495680_0033131 3300047322 Bacteria 4186
553 Ga0495680_0816177 3300047322 Bacteria 608
554 Ga0495683_0013590 3300047323 Bacteria 4254
555 Ga0495683_0014986 3300047323 Bacteria 4038
556 Ga0495683_0016497 3300047323 Bacteria 3835
557 Ga0495683_0053431 3300047323 Bacteria 2015
558 Ga0495687_012671 3300047443 Bacteria 4444
559 Ga0495675_0033110 3300047444 Bacteria 3298
560 Ga0495675_0411293 3300047444 Bacteria 787
561 Ga0495679_004782 3300047446 Bacteria 6131
562 Ga0495679_005067 3300047446 Bacteria 5913
563 Ga0495679_006284 3300047446 Bacteria 5141
564 Ga0495679_007342 3300047446 Bacteria 4606
565 Ga0495679_007598 3300047446 Bacteria 4506
566 Ga0495679_009005 3300047446 Bacteria 4022
567 Ga0495679_024829 3300047446 Bacteria 2013
568 Ga0495679_084736 3300047446 Bacteria 895
569 Ga0495673_0012280 3300047469 Bacteria 4553
570 Ga0495673_0034645 3300047469 Bacteria 2332
571 Ga0495673_0039839 3300047469 Bacteria 2129
572 Ga0495673_0067706 3300047469 Bacteria 1510
573 Ga0495681_0007998 3300047470 Bacteria 6677
574 Ga0495681_0013088 3300047470 Bacteria 4837
575 Ga0495681_0014365 3300047470 Bacteria 4543
576 Ga0495681_0015913 3300047470 Bacteria 4243
577 Ga0495681_0017538 3300047470 Bacteria 3971
578 Ga0495681_0021478 3300047470 Bacteria 3477
579 Ga0495681_0031763 3300047470 Bacteria 2667
580 Ga0495684_0027859 3300047471 Bacteria 4339
581 Ga0495686_0017198 3300047472 Bacteria 4879
582 Ga0495686_0028324 3300047472 Bacteria 3648
583 Ga0495686_0391820 3300047472 Bacteria 747
584 Ga0495593_0012674 3300047673 Bacteria 4814
585 Ga0495593_0571116 3300047673 Bacteria 567
586 Ga0495602_0024682 3300048088 Bacteria 5830
587 Ga0495602_0168373 3300048088 Bacteria 1703
588 Ga0495626_0003926 3300048091 Bacteria 9305
589 Ga0495626_0012962 3300048091 Bacteria 4347
590 Ga0495626_0014781 3300048091 Bacteria 4012
591 Ga0495626_0017972 3300048091 Bacteria 3563
592 Ga0495626_0040772 3300048091 Bacteria 2191
593 Ga0495626_0325299 3300048091 Bacteria 603
594 Ga0496102_0015028 3300048905 Bacteria 6737
595 Ga0496103_0007043 3300048906 Bacteria 6712
596 Ga0496112_0868947 3300048915 Bacteria 825
597 Ga0496116_0010235 3300048919 Bacteria 7887
598 Ga0496116_0011881 3300048919 Bacteria 7163
599 Ga0496116_0014498 3300048919 Bacteria 6289
600 Ga0496116_0045697 3300048919 Bacteria 2961
601 Ga0496116_0064715 3300048919 Bacteria 2349
602 Ga0496116_0290925 3300048919 Bacteria 784
603 Ga0496117_0003788 3300048920 Bacteria 17261
604 Ga0496117_0015710 3300048920 Bacteria 6429
605 Ga0496117_0017174 3300048920 Bacteria 6056
606 Ga0496117_0017394 3300048920 Bacteria 6002
607 Ga0496117_0024137 3300048920 Bacteria 4820
608 Ga0496117_0024269 3300048920 Bacteria 4801
609 Ga0496117_0038709 3300048920 Bacteria 3531
610 Ga0496117_0040078 3300048920 Bacteria 3450
611 Ga0496117_0047714 3300048920 Bacteria 3068
612 Ga0496118_0021090 3300048921 Bacteria 5749
613 Ga0496118_0021928 3300048921 Bacteria 5602
614 Ga0496118_0026565 3300048921 Bacteria 4927
615 Ga0496118_0026643 3300048921 Bacteria 4917
616 Ga0496118_0044946 3300048921 Bacteria 3452
617 Ga0496118_0072353 3300048921 Bacteria 2476
618 Ga0496118_0151486 3300048921 Bacteria 1451
619 Ga0496118_0490780 3300048921 Bacteria 613
620 Ga0496118_0635397 3300048921 Bacteria 504
621 Ga0496119_0003234 3300048922 Bacteria 17056
622 Ga0496119_0014700 3300048922 Bacteria 6098
623 Ga0496119_0034340 3300048922 Bacteria 3343
624 Ga0496119_0050935 3300048922 Bacteria 2548
625 Ga0496119_0320503 3300048922 Bacteria 759
626 Ga0496120_0002734 3300048923 Bacteria 17217
627 Ga0496120_0011264 3300048923 Bacteria 6164
628 Ga0496120_0027552 3300048923 Bacteria 3492
629 Ga0496120_0040869 3300048923 Bacteria 2721
630 Ga0496121_0027608 3300048924 Bacteria 5308
631 Ga0496121_0037018 3300048924 Bacteria 4339
632 Ga0496121_0102499 3300048924 Bacteria 2204
633 Ga0496121_0108652 3300048924 Bacteria 2121
634 Ga0496121_0159886 3300048924 Bacteria 1649
635 Ga0496121_0549821 3300048924 Bacteria 722
636 Ga0496122_0009759 3300048925 Bacteria 10028
637 Ga0496122_0025352 3300048925 Bacteria 5152
638 Ga0496122_0038137 3300048925 Bacteria 3855
639 Ga0496122_0052514 3300048925 Bacteria 3084
640 Ga0496122_0053026 3300048925 Bacteria 3061
641 Ga0496122_0055181 3300048925 Bacteria 2976
642 Ga0496122_0473332 3300048925 Bacteria 615
643 Ga0496122_0615068 3300048925 Bacteria 506
644 Ga0496123_0017780 3300048926 Bacteria 5697
645 Ga0496123_0019673 3300048926 Bacteria 5316
646 Ga0496123_0036289 3300048926 Bacteria 3498
647 Ga0496123_0041895 3300048926 Bacteria 3168
648 Ga0496123_0140762 3300048926 Bacteria 1319
649 Ga0496124_0001360 3300048927 Bacteria 36640
650 Ga0496124_0004110 3300048927 Bacteria 17199
651 Ga0496124_0020023 3300048927 Bacteria 6198
652 Ga0496124_0032675 3300048927 Bacteria 4589
653 Ga0496124_0038867 3300048927 Bacteria 4128
654 Ga0496124_0047130 3300048927 Bacteria 3688
655 Ga0496124_0049803 3300048927 Bacteria 3571
656 Ga0496124_0063583 3300048927 Bacteria 3082
657 Ga0496124_0461017 3300048927 Bacteria 863
658 Ga0496125_0001314 3300048928 Bacteria 36791
659 Ga0496125_0004031 3300048928 Bacteria 17234
660 Ga0496125_0026261 3300048928 Bacteria 5311
661 Ga0496125_0026595 3300048928 Bacteria 5267
662 Ga0496125_0032567 3300048928 Bacteria 4629
663 Ga0496125_0037057 3300048928 Bacteria 4245
664 Ga0496125_0040000 3300048928 Bacteria 4028
665 Ga0496125_0090000 3300048928 Bacteria 2305
666 Ga0496125_0095654 3300048928 Bacteria 2208
667 Ga0496126_0001465 3300048929 Bacteria 36787
668 Ga0496126_0036152 3300048929 Bacteria 4620
669 Ga0496126_0042232 3300048929 Bacteria 4212
670 Ga0496126_0067566 3300048929 Bacteria 3193
671 Ga0496126_0080917 3300048929 Bacteria 2873
672 Ga0496126_0489283 3300048929 Bacteria 985
673 Ga0495678_006294 3300049459 Bacteria 6332
674 Ga0495678_010004 3300049459 Bacteria 4639
675 Ga0495678_010014 3300049459 Bacteria 4635
676 Ga0495678_026192 3300049459 Bacteria 2493
677 Ga0495678_031863 3300049459 Bacteria 2193
678 Ga0495678_033723 3300049459 Bacteria 2111
679 Ga0495678_042164 3300049459 Bacteria 1820
680 Ga0495678_050096 3300049459 Bacteria 1620
681 Ga0495682_0004569 3300049460 Bacteria 5894
682 Ga0495682_0144744 3300049460 Bacteria 848
683 Ga0501235_004019 3300049669 Bacteria 3184
684 Ga0501241_001529 3300049758 Bacteria 4668
685 nmdc:mga00v17_32366_c1 3300050491 Bacteria 3090
686 Ga0500644_0120422 3300053088 Bacteria 1022
687 Ga0500572_002223 3300053111 Bacteria 4737
688 Ga0500621_040931 3300053126 Bacteria 1869
689 Ga0500634_0005727 3300053161 Bacteria 5937

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042138 Ga0450903_042307 Ga0450903_042307_460_639 59
2 3300042145 Ga0450906_076923 Ga0450906_076923_342_521 59
3 3300046491 Ga0495584_0135646 Ga0495584_0135646_88_267 59
4 3300046501 Ga0495607_0055803 Ga0495607_0055803_28_207 59
5 3300046519 Ga0495632_0014412 Ga0495632_0014412_391_570 59
6 3300046530 Ga0495654_0114126 Ga0495654_0114126_11_190 59
7 3300046538 Ga0495609_0007044 Ga0495609_0007044_1553_1732 59
8 3300046694 Ga0495649_0006725 Ga0495649_0006725_3930_4109 59
9 3300047443 Ga0495687_012671 Ga0495687_012671_3703_3882 59
10 3300048091 Ga0495626_0003926 Ga0495626_0003926_5205_5384 59
11 3300009011 Ga0105251_10016148 Ga0105251_100161484 64
12 3300009011 Ga0105251_10048612 Ga0105251_100486123 64
13 3300009036 Ga0105244_10012245 Ga0105244_100122455 64
14 3300013100 Ga0157373_10027040 Ga0157373_100270402 64
15 3300013100 Ga0157373_10062807 Ga0157373_100628073 64
16 3300013102 Ga0157371_10036018 Ga0157371_100360182 64
17 3300013104 Ga0157370_10039583 Ga0157370_100395833 64
18 3300013105 Ga0157369_10062767 Ga0157369_100627672 64
19 3300013307 Ga0157372_10060956 Ga0157372_100609562 64
20 3300014497 Ga0182008_10007839 Ga0182008_100078395 64
21 3300015261 Ga0182006_1015770 Ga0182006_10157703 64
22 3300015261 Ga0182006_1084722 Ga0182006_10847222 64
23 3300042013 Ga0439456_009554 Ga0439456_009554_1215_1409 64
24 3300042139 Ga0450904_022331 Ga0450904_022331_120_314 64
25 3300042533 Ga0450901_000311 Ga0450901_000311_3130_3324 64
26 3300046453 Ga0495627_004239 Ga0495627_004239_2735_2929 64
27 3300046454 Ga0495592_0030778 Ga0495592_0030778_1145_1339 64
28 3300046458 Ga0495591_007252 Ga0495591_007252_1539_1733 64
29 3300046460 Ga0495638_0011165 Ga0495638_0011165_2728_2922 64
30 3300046463 Ga0495653_0076256 Ga0495653_0076256_131_325 64
31 3300046472 Ga0495580_0200955 Ga0495580_0200955_990_1184 64
32 3300046474 Ga0495605_0123030 Ga0495605_0123030_335_529 64
33 3300046491 Ga0495584_0010855 Ga0495584_0010855_2900_3094 64
34 3300046500 Ga0495596_0052679 Ga0495596_0052679_12_206 64
35 3300046512 Ga0495610_0013527 Ga0495610_0013527_2404_2598 64
36 3300046519 Ga0495632_0020449 Ga0495632_0020449_1612_1806 64
37 3300046519 Ga0495632_0226960 Ga0495632_0226960_270_464 64
38 3300046520 Ga0495637_0365829 Ga0495637_0365829_210_404 64
39 3300046524 Ga0495648_0033869 Ga0495648_0033869_1598_1792 64
40 3300046526 Ga0495666_0022371 Ga0495666_0022371_357_551 64
41 3300046536 Ga0495587_0078080 Ga0495587_0078080_608_802 64
42 3300046542 Ga0495597_0005919 Ga0495597_0005919_3415_3609 64
43 3300046642 Ga0495634_0021710 Ga0495634_0021710_1648_1842 64
44 3300046660 Ga0495625_0022059 Ga0495625_0022059_2476_2670 64
45 3300046674 Ga0495588_0038419 Ga0495588_0038419_223_417 64
46 3300046679 Ga0495623_0272578 Ga0495623_0272578_28_222 64
47 3300046680 Ga0495646_0030269 Ga0495646_0030269_801_995 64
48 3300046689 Ga0495613_0019131 Ga0495613_0019131_1683_1877 64
49 3300046690 Ga0495624_0006645 Ga0495624_0006645_3120_3314 64
50 3300046692 Ga0495671_0010571 Ga0495671_0010571_2241_2435 64
51 3300046809 Ga0495600_0128351 Ga0495600_0128351_308_502 64
52 3300047317 Ga0495604_0027772 Ga0495604_0027772_422_616 64
53 3300047320 Ga0495672_0012168 Ga0495672_0012168_4079_4273 64
54 3300047321 Ga0495676_0027690 Ga0495676_0027690_1724_1918 64
55 3300047322 Ga0495680_0033131 Ga0495680_0033131_2960_3154 64
56 3300047444 Ga0495675_0411293 Ga0495675_0411293_407_601 64
57 3300047470 Ga0495681_0007998 Ga0495681_0007998_3185_3379 64
58 3300047471 Ga0495684_0027859 Ga0495684_0027859_1379_1573 64
59 3300047673 Ga0495593_0012674 Ga0495593_0012674_2952_3146 64
60 3300048088 Ga0495602_0024682 Ga0495602_0024682_1721_1915 64
61 3300048091 Ga0495626_0017972 Ga0495626_0017972_11_205 64
62 3300048919 Ga0496116_0064715 Ga0496116_0064715_456_650 64
63 3300048920 Ga0496117_0040078 Ga0496117_0040078_1543_1737 64
64 3300048921 Ga0496118_0044946 Ga0496118_0044946_1714_1908 64
65 3300048922 Ga0496119_0050935 Ga0496119_0050935_1332_1526 64
66 3300048923 Ga0496120_0027552 Ga0496120_0027552_1677_1871 64
67 3300048924 Ga0496121_0108652 Ga0496121_0108652_390_584 64
68 3300048927 Ga0496124_0049803 Ga0496124_0049803_1665_1859 64
69 3300049460 Ga0495682_0144744 Ga0495682_0144744_16_210 64
70 iso_pu_bacteria 2511231006 2511264533 66
71 iso_pu_bacteria 2511231010 2511290117 66
72 iso_pu_bacteria 2511231011 2511295643 66
73 iso_pu_bacteria 2511231012 2511299761 66
74 iso_pu_bacteria 2511231016 2511326657 66
75 iso_pu_bacteria 2511231018 2511338857 66
76 iso_pu_bacteria 2511231019 2511343942 66
77 iso_pu_bacteria 2511231023 2511366579 66
78 iso_pu_bacteria 2511231031 2511410958 66
79 iso_pu_bacteria 2511231156 2511823175 66
80 iso_pu_bacteria 2512047018 2512326278 66
81 iso_pu_bacteria 2582580891 2583790832 66
82 iso_pu_bacteria 2597489887 2597856405 66
83 iso_pu_bacteria 2597489888 2597862443 66
84 iso_pu_bacteria 2597489889 2597868202 66
85 iso_pu_bacteria 2599185179 2599448941 66
86 iso_pu_bacteria 2599185185 2599483342 66
87 iso_pu_bacteria 2599185188 2599501278 66
88 iso_pu_bacteria 2599185189 2599508928 66
89 iso_pu_bacteria 2599185191 2599517760 66
90 iso_pu_bacteria 2599185212 2599616356 66
91 iso_pu_bacteria 2599185248 2599770639 66
92 iso_pu_bacteria 2599185257 2599805245 66
93 iso_pu_bacteria 2599185288 2599879756 66
94 iso_pu_bacteria 2599185289 2599886521 66
95 iso_pu_bacteria 2599185291 2599896886 66
96 iso_pu_bacteria 2599185300 2599934003 66
97 iso_pu_bacteria 2599185302 2599945583 66
98 iso_pu_bacteria 2599185303 2599948266 66
99 iso_pu_bacteria 2599185304 2599957519 66
100 iso_pu_bacteria 2599185305 2599959579 66
101 iso_pu_bacteria 2599185306 2599966174 66
102 iso_pu_bacteria 2599185308 2599978212 66
103 iso_pu_bacteria 2599185309 2599986032 66
104 iso_pu_bacteria 2599185310 2599987124 66
105 iso_pu_bacteria 2599185311 2599996981 66
106 iso_pu_bacteria 2599185312 2600002583 66
107 iso_pu_bacteria 2599185313 2600006425 66
108 iso_pu_bacteria 2599185314 2600012318 66
109 iso_pu_bacteria 2599185315 2600016774 66
110 iso_pu_bacteria 2599185316 2600024812 66
111 iso_pu_bacteria 2599185317 2600032856 66
112 iso_pu_bacteria 2599185318 2600035374 66
113 iso_pu_bacteria 2599185319 2600041222 66
114 iso_pu_bacteria 2599185320 2600045447 66
115 iso_pu_bacteria 2599185321 2600054840 66
116 iso_pu_bacteria 2599185322 2600058344 66
117 iso_pu_bacteria 2599185323 2600063980 66
118 iso_pu_bacteria 2599185324 2600073104 66
119 iso_pu_bacteria 2599185325 2600079396 66
120 iso_pu_bacteria 2600254930 2600360093 66
121 iso_pu_bacteria 2600254931 2600363954 66
122 iso_pu_bacteria 2600255296 2601691024 66
123 iso_pu_bacteria 2600255318 2601800223 66
124 iso_pu_bacteria 2603880185 2606074510 66
125 iso_pu_bacteria 2603880199 2606127373 66
126 iso_pu_bacteria 2619619299 2621301430 66
127 iso_pu_bacteria 2623620443 2624478975 66
128 iso_pu_bacteria 2643221571 2643868738 66
129 iso_pu_bacteria 2643221713 2644624125 66
130 iso_pu_bacteria 2667528170 2671092242 66
131 iso_pu_bacteria 2667528176 2671127516 66
132 iso_pu_bacteria 2671180172 2671768020 66
133 iso_pu_bacteria 2675903420 2677897605 66
134 iso_pu_bacteria 2675903515 2678261714 66
135 iso_pu_bacteria 2713897148 2715752888 66
136 iso_pu_bacteria 2713897149 2715758696 66
137 iso_pu_bacteria 2718217725 2718632862 66
138 iso_pu_bacteria 2721755607 2723247335 66
139 iso_pu_bacteria 2738541265 2738673651 66
140 iso_pu_bacteria 2738541282 2738752044 66
141 iso_pu_bacteria 2738541294 2738809218 66
142 iso_pu_bacteria 2738541303 2738861085 66
143 iso_pu_bacteria 2738541309 2738896578 66
144 iso_pu_bacteria 2738543025 2739312931 66
145 iso_pu_bacteria 2740892503 2743735817 66
146 iso_pu_bacteria 2744054620 2745008063 66
147 iso_pu_bacteria 2773857673 2774136232 66
148 iso_pu_bacteria 2784132063 2784260301 66
149 iso_pu_bacteria 2791355520 2794594501 66
150 iso_pu_bacteria 2808606361 2808858968 66
151 iso_pu_bacteria 2808606376 2808927239 66
152 iso_pu_bacteria 2808606378 2808939054 66
153 iso_pu_bacteria 2808606380 2808949358 66
154 iso_pu_bacteria 2808606382 2808960373 66
155 iso_pu_bacteria 2808606383 2808967470 66
156 iso_pu_bacteria 2808606385 2808975364 66
157 iso_pu_bacteria 2808606388 2808990997 66
158 iso_pu_bacteria 2808606389 2809002300 66
159 iso_pu_bacteria 2808606445 2809215970 66
160 iso_pu_bacteria 2816332298 2817489216 66
161 iso_pu_bacteria 2834028612 2834029121 66
162 iso_pu_bacteria 2842826826 2842828831 66
163 iso_pu_bacteria 2842832357 2842835557 66
164 iso_pu_bacteria 2842837860 2842842565 66
165 iso_pu_bacteria 2842843487 2842847299 66
166 iso_pu_bacteria 2842854478 2842857122 66
167 iso_pu_bacteria 2852612431 2852615398 66
168 iso_pu_bacteria 2852657418 2852658474 66
169 iso_pu_bacteria 2852667396 2852670366 66
170 iso_pu_bacteria 2860339153 2860340494 66
171 iso_pu_bacteria 2860867994 2860869143 66
172 iso_pu_bacteria 2878029506 2878030934 66
173 iso_pu_bacteria 2880230671 2880231853 66
174 iso_pu_bacteria 2904518522 2904520888 66
175 iso_pu_bacteria 2908446538 2908448038 66
176 iso_pu_bacteria 2913036834 2913038049 66
177 iso_pu_bacteria 2919063839 2919064552 66
178 iso_pu_bacteria 2919385768 2919385979 66
179 iso_pu_bacteria 2919481497 2919482960 66
180 iso_pu_bacteria 2919487758 2919490768 66
181 iso_pu_bacteria 2919697872 2919700076 66
182 iso_pu_bacteria 2923153595 2923154826 66
183 iso_pu_bacteria 2923586266 2923590827 66
184 iso_pu_bacteria 2929189879 2929191142 66
185 iso_pu_bacteria 2931369376 2931371159 66
186 iso_pu_bacteria 2931396565 2931399603 66
187 iso_pu_bacteria 2945928738 2945929440 66
188 iso_pu_bacteria 2945961074 2945965719 66
189 iso_pu_bacteria 2946006987 2946011703 66
190 iso_pu_bacteria 2946027586 2946029382 66
191 iso_pu_bacteria 2947233263 2947235954 66
192 iso_pu_bacteria 2969304461 2969305759 66
193 iso_pu_bacteria 2974289157 2974292617 66
194 iso_pu_bacteria 2984286254 2984291205 66
195 iso_pu_bacteria 2988728565 2988733041 66
196 iso_pu_bacteria 3007395558 3007400350 66
197 iso_pu_bacteria 3007511990 3007512572 66
198 iso_pu_bacteria 3007614139 3007618236 66
199 iso_pu_bacteria 3007718800 3007720924 66
200 iso_pu_bacteria 3007861166 3007863581 66
201 iso_pu_bacteria 3007866637 3007871398 66
202 iso_pu_bacteria 8015687852 8015689055 66
203 iso_pu_bacteria 8019775933 8019776743 66
204 iso_pu_bacteria 8029995093 8029999566 66
205 iso_pu_bacteria 8054285046 8054286757 66
206 iso_pu_bacteria 8054347763 8054348427 66
207 iso_pu_bacteria 8055770955 8055772174 66
208 iso_pu_bacteria 8056143049 8056147776 66
209 iso_pu_bacteria 8056148874 8056149262 66
210 iso_pu_bacteria 8056161164 8056166758 66
211 iso_pu_bacteria 8056172158 8056175980 66
212 iso_pu_bacteria 8056569372 8056569848 66
213 3300013100 Ga0157373_10408416 Ga0157373_104084162 67
214 3300041407 Ga0439447_047242 Ga0439447_047242_570_773 67
215 3300042006 Ga0439432_000218 Ga0439432_000218_2835_3038 67
216 3300042131 Ga0450894_002158 Ga0450894_002158_1572_1775 67
217 3300042133 Ga0450896_051657 Ga0450896_051657_89_292 67
218 3300042134 Ga0450898_000324 Ga0450898_000324_2529_2732 67
219 3300046453 Ga0495627_024034 Ga0495627_024034_725_928 67
220 3300046458 Ga0495591_036181 Ga0495591_036181_192_395 67
221 3300046507 Ga0495606_0015732 Ga0495606_0015732_2211_2414 67
222 3300046515 Ga0495620_0016550 Ga0495620_0016550_1538_1741 67
223 3300046520 Ga0495637_0010276 Ga0495637_0010276_1935_2138 67
224 3300046524 Ga0495648_0022907 Ga0495648_0022907_1639_1842 67
225 3300046530 Ga0495654_0007901 Ga0495654_0007901_2717_2920 67
226 3300046530 Ga0495654_0012426 Ga0495654_0012426_2527_2730 67
227 3300046794 Ga0495589_0006708 Ga0495589_0006708_3016_3219 67
228 3300047446 Ga0495679_005067 Ga0495679_005067_3043_3246 67
229 3300047446 Ga0495679_007598 Ga0495679_007598_2281_2484 67
230 3300047470 Ga0495681_0021478 Ga0495681_0021478_880_1083 67
231 3300048920 Ga0496117_0024137 Ga0496117_0024137_2692_2895 67
232 3300048921 Ga0496118_0072353 Ga0496118_0072353_348_551 67
233 3300048922 Ga0496119_0003234 Ga0496119_0003234_3160_3363 67
234 3300048922 Ga0496119_0034340 Ga0496119_0034340_1272_1475 67
235 3300048923 Ga0496120_0002734 Ga0496120_0002734_3144_3347 67
236 3300048923 Ga0496120_0040869 Ga0496120_0040869_2246_2449 67
237 3300048925 Ga0496122_0038137 Ga0496122_0038137_3113_3316 67
238 3300048925 Ga0496122_0053026 Ga0496122_0053026_2845_3048 67
239 3300048925 Ga0496122_0055181 Ga0496122_0055181_308_511 67
240 3300048926 Ga0496123_0036289 Ga0496123_0036289_3060_3263 67
241 3300048927 Ga0496124_0047130 Ga0496124_0047130_2736_2939 67
242 3300048928 Ga0496125_0026595 Ga0496125_0026595_2373_2576 67
243 3300048928 Ga0496125_0040000 Ga0496125_0040000_1968_2171 67
244 3300048928 Ga0496125_0090000 Ga0496125_0090000_1230_1433 67
245 3300048928 Ga0496125_0095654 Ga0496125_0095654_785_988 67
246 3300048929 Ga0496126_0036152 Ga0496126_0036152_1870_2073 67
247 3300048929 Ga0496126_0067566 Ga0496126_0067566_1971_2174 67
248 3300009176 Ga0105242_10001117 Ga0105242_100011172 68
249 2124908027 MRS2a_Contig_10507 MRS2a_00390020 70
250 3300002737 JGI25162J39368_1000314 JGI25162J39368_100031423 70
251 3300002738 JGI25154J39366_1008106 JGI25154J39366_10081063 70
252 3300002771 JGI25163J39215_1000669 JGI25163J39215_10006698 70
253 3300002772 JGI25164J39214_1000233 JGI25164J39214_100023323 70
254 3300003214 JGI25165J46597_1000429 JGI25165J46597_100042928 70
255 3300003751 Ga0055538_1000073 Ga0055538_100007350 70
256 3300003752 Ga0055539_1000109 Ga0055539_100010950 70
257 3300003756 Ga0055533_1000117 Ga0055533_100011750 70
258 3300003758 Ga0055532_1000120 Ga0055532_100012073 70
259 3300003759 Ga0055525_1000156 Ga0055525_100015650 70
260 3300003761 Ga0055535_1012414 Ga0055535_10124142 70
261 3300003781 Ga0055536_1000217 Ga0055536_100021734 70
262 3300003781 Ga0055536_1080317 Ga0055536_10803172 70
263 3300003791 Ga0055530_10000454 Ga0055530_1000045424 70
264 3300003791 Ga0055530_10000608 Ga0055530_1000060823 70
265 3300003792 Ga0055540_1000782 Ga0055540_100078223 70
266 3300003792 Ga0055540_1000856 Ga0055540_100085624 70
267 3300003792 Ga0055540_1000983 Ga0055540_100098318 70
268 3300003794 Ga0055531_10000458 Ga0055531_1000045842 70
269 3300003794 Ga0055531_10081760 Ga0055531_100817602 70
270 3300003841 Ga0055541_1000074 Ga0055541_100007450 70
271 3300005288 Ga0065714_10003741 Ga0065714_100037417 70
272 3300005288 Ga0065714_10073190 Ga0065714_100731903 70
273 3300005288 Ga0065714_10100675 Ga0065714_101006752 70
274 3300005288 Ga0065714_10121432 Ga0065714_101214321 70
275 3300005288 Ga0065714_10158722 Ga0065714_101587222 70
276 3300005288 Ga0065714_10285499 Ga0065714_102854992 70
277 3300005288 Ga0065714_10400322 Ga0065714_104003221 70
278 3300005288 Ga0065714_10414697 Ga0065714_104146971 70
279 3300005289 Ga0065704_10085319 Ga0065704_100853192 70
280 3300005289 Ga0065704_10202127 Ga0065704_102021273 70
281 3300005289 Ga0065704_10512990 Ga0065704_105129902 70
282 3300005293 Ga0065715_10183624 Ga0065715_101836242 70
283 3300005328 Ga0070676_11084806 Ga0070676_110848062 70
284 3300005331 Ga0070670_100001560 Ga0070670_10000156021 70
285 3300005344 Ga0070661_100000219 Ga0070661_10000021938 70
286 3300005353 Ga0070669_100005257 Ga0070669_1000052576 70
287 3300005353 Ga0070669_100193851 Ga0070669_1001938512 70
288 3300005354 Ga0070675_100908006 Ga0070675_1009080062 70
289 3300005366 Ga0070659_100343444 Ga0070659_1003434442 70
290 3300005457 Ga0070662_100000526 Ga0070662_1000005265 70
291 3300005539 Ga0068853_100044913 Ga0068853_1000449134 70
292 3300005548 Ga0070665_100197824 Ga0070665_1001978243 70
293 3300005548 Ga0070665_102241838 Ga0070665_1022418382 70
294 3300005564 Ga0070664_100001287 Ga0070664_10000128719 70
295 3300005564 Ga0070664_100219163 Ga0070664_1002191631 70
296 3300005577 Ga0068857_101085710 Ga0068857_1010857102 70
297 3300005578 Ga0068854_100088869 Ga0068854_1000888693 70
298 3300005834 Ga0068851_10000037 Ga0068851_1000003724 70
299 3300006048 Ga0075363_100794700 Ga0075363_1007947002 70
300 3300006051 Ga0075364_10091225 Ga0075364_100912252 70
301 3300006051 Ga0075364_10645866 Ga0075364_106458662 70
302 3300006058 Ga0075432_10044984 Ga0075432_100449843 70
303 3300006177 Ga0075362_10409339 Ga0075362_104093392 70
304 3300006946 Ga0079104_1031169 Ga0079104_10311692 70
305 3300006946 Ga0079104_1113999 Ga0079104_11139992 70
306 3300009011 Ga0105251_10012223 Ga0105251_100122238 70
307 3300009011 Ga0105251_10012906 Ga0105251_100129064 70
308 3300009011 Ga0105251_10025392 Ga0105251_100253923 70
309 3300009011 Ga0105251_10095695 Ga0105251_100956952 70
310 3300009011 Ga0105251_10237219 Ga0105251_102372192 70
311 3300009036 Ga0105244_10002831 Ga0105244_100028316 70
312 3300009036 Ga0105244_10008193 Ga0105244_100081936 70
313 3300009036 Ga0105244_10014588 Ga0105244_100145884 70
314 3300009036 Ga0105244_10014962 Ga0105244_100149624 70
315 3300009036 Ga0105244_10017866 Ga0105244_100178662 70
316 3300009036 Ga0105244_10054715 Ga0105244_100547153 70
317 3300009036 Ga0105244_10108772 Ga0105244_101087722 70
318 3300009036 Ga0105244_10281955 Ga0105244_102819551 70
319 3300009092 Ga0105250_10001299 Ga0105250_1000129919 70
320 3300009092 Ga0105250_10002968 Ga0105250_100029687 70
321 3300009092 Ga0105250_10003980 Ga0105250_100039806 70
322 3300009092 Ga0105250_10006308 Ga0105250_100063083 70
323 3300009092 Ga0105250_10006540 Ga0105250_100065405 70
324 3300009092 Ga0105250_10010198 Ga0105250_100101984 70
325 3300009092 Ga0105250_10049892 Ga0105250_100498923 70
326 3300009092 Ga0105250_10268924 Ga0105250_102689242 70
327 3300009092 Ga0105250_10314310 Ga0105250_103143102 70
328 3300009148 Ga0105243_10001686 Ga0105243_1000168621 70
329 3300009176 Ga0105242_10479699 Ga0105242_104796992 70
330 3300009177 Ga0105248_10360193 Ga0105248_103601932 70
331 3300009545 Ga0105237_10000196 Ga0105237_1000019665 70
332 3300009545 Ga0105237_11306265 Ga0105237_113062652 70
333 3300011119 Ga0105246_10000347 Ga0105246_1000034730 70
334 3300011119 Ga0105246_10184366 Ga0105246_101843662 70
335 3300012498 Ga0157345_1000275 Ga0157345_10002756 70
336 3300012502 Ga0157347_1023079 Ga0157347_10230792 70
337 3300013100 Ga0157373_10002861 Ga0157373_1000286115 70
338 3300013100 Ga0157373_10010905 Ga0157373_100109057 70
339 3300013100 Ga0157373_10014633 Ga0157373_100146336 70
340 3300013100 Ga0157373_10015166 Ga0157373_100151665 70
341 3300013100 Ga0157373_10035028 Ga0157373_100350284 70
342 3300013100 Ga0157373_10042598 Ga0157373_100425984 70
343 3300013100 Ga0157373_10049466 Ga0157373_100494661 70
344 3300013100 Ga0157373_11478315 Ga0157373_114783152 70
345 3300013102 Ga0157371_10005463 Ga0157371_1000546315 70
346 3300013102 Ga0157371_10011393 Ga0157371_100113935 70
347 3300013102 Ga0157371_10017484 Ga0157371_100174845 70
348 3300013102 Ga0157371_11129102 Ga0157371_111291022 70
349 3300013102 Ga0157371_11262203 Ga0157371_112622032 70
350 3300013104 Ga0157370_10033664 Ga0157370_100336643 70
351 3300013104 Ga0157370_10040981 Ga0157370_100409814 70
352 3300013104 Ga0157370_10091076 Ga0157370_100910763 70
353 3300013104 Ga0157370_10113572 Ga0157370_101135723 70
354 3300013104 Ga0157370_10125900 Ga0157370_101259002 70
355 3300013104 Ga0157370_10229640 Ga0157370_102296403 70
356 3300013104 Ga0157370_10569065 Ga0157370_105690651 70
357 3300013105 Ga0157369_10029322 Ga0157369_100293225 70
358 3300013105 Ga0157369_10032822 Ga0157369_100328225 70
359 3300013105 Ga0157369_10057162 Ga0157369_100571624 70
360 3300013105 Ga0157369_10403856 Ga0157369_104038562 70
361 3300013105 Ga0157369_10968652 Ga0157369_109686522 70
362 3300013105 Ga0157369_10969952 Ga0157369_109699522 70
363 3300013306 Ga0163162_10013275 Ga0163162_100132755 70
364 3300013306 Ga0163162_10070183 Ga0163162_100701833 70
365 3300013306 Ga0163162_10070757 Ga0163162_100707572 70
366 3300013306 Ga0163162_10116012 Ga0163162_101160122 70
367 3300013306 Ga0163162_10145310 Ga0163162_101453102 70
368 3300013306 Ga0163162_11051021 Ga0163162_110510212 70
369 3300013308 Ga0157375_10017263 Ga0157375_100172637 70
370 3300013308 Ga0157375_10040228 Ga0157375_100402284 70
371 3300013308 Ga0157375_10348925 Ga0157375_103489252 70
372 3300014497 Ga0182008_10006874 Ga0182008_100068745 70
373 3300014497 Ga0182008_10006946 Ga0182008_100069466 70
374 3300014497 Ga0182008_10009184 Ga0182008_100091843 70
375 3300014497 Ga0182008_10009723 Ga0182008_100097232 70
376 3300014497 Ga0182008_10023747 Ga0182008_100237475 70
377 3300014497 Ga0182008_10038097 Ga0182008_100380971 70
378 3300014497 Ga0182008_10091972 Ga0182008_100919723 70
379 3300015261 Ga0182006_1004889 Ga0182006_10048898 70
380 3300015261 Ga0182006_1005668 Ga0182006_10056686 70
381 3300015261 Ga0182006_1027577 Ga0182006_10275772 70
382 3300015261 Ga0182006_1030332 Ga0182006_10303322 70
383 3300015261 Ga0182006_1196957 Ga0182006_11969572 70
384 3300015262 Ga0182007_10001094 Ga0182007_1000109417 70
385 3300015262 Ga0182007_10002411 Ga0182007_100024116 70
386 3300015262 Ga0182007_10005509 Ga0182007_100055095 70
387 3300015262 Ga0182007_10006179 Ga0182007_100061795 70
388 3300015265 Ga0182005_1001507 Ga0182005_10015076 70
389 3300017792 Ga0163161_10002369 Ga0163161_1000236916 70
390 3300017792 Ga0163161_10019070 Ga0163161_100190704 70
391 3300017792 Ga0163161_10020602 Ga0163161_100206023 70
392 3300017792 Ga0163161_10020764 Ga0163161_100207646 70
393 3300017792 Ga0163161_10082956 Ga0163161_100829564 70
394 3300017792 Ga0163161_10094157 Ga0163161_100941572 70
395 3300017792 Ga0163161_10094905 Ga0163161_100949052 70
396 3300017792 Ga0163161_10101375 Ga0163161_101013751 70
397 3300017792 Ga0163161_10172702 Ga0163161_101727023 70
398 3300017792 Ga0163161_10188602 Ga0163161_101886022 70
399 3300017792 Ga0163161_10434744 Ga0163161_104347442 70
400 3300017792 Ga0163161_10434745 Ga0163161_104347452 70
401 3300017792 Ga0163161_11283940 Ga0163161_112839402 70
402 3300017792 Ga0163161_11918908 Ga0163161_119189082 70
403 3300025206 Ga0209435_100620 Ga0209435_1006208 70
404 3300025207 Ga0209760_100046 Ga0209760_10004643 70
405 3300025224 Ga0209784_100015 Ga0209784_10001582 70
406 3300025225 Ga0209566_100012 Ga0209566_10001282 70
407 3300025226 Ga0209674_100027 Ga0209674_10002782 70
408 3300025229 Ga0209147_100019 Ga0209147_10001982 70
409 3300025230 Ga0209563_100031 Ga0209563_10003182 70
410 3300025230 Ga0209563_100578 Ga0209563_10057811 70
411 3300025231 Ga0207427_100029 Ga0207427_100029306 70
412 3300025233 Ga0209437_100009 Ga0209437_100009561 70
413 3300025233 Ga0209437_103326 Ga0209437_1033264 70
414 3300025242 Ga0209258_100296 Ga0209258_10029642 70
415 3300025246 Ga0209646_1000213 Ga0209646_100021349 70
416 3300025253 Ga0209677_100016 Ga0209677_10001682 70
417 3300025256 Ga0209759_1022755 Ga0209759_10227553 70
418 3300025261 Ga0209233_1000032 Ga0209233_1000032561 70
419 3300025291 Ga0209675_1002947 Ga0209675_10029473 70
420 3300025292 Ga0209676_1000016 Ga0209676_1000016105 70
421 3300025292 Ga0209676_1000080 Ga0209676_1000080271 70
422 3300025292 Ga0209676_1000397 Ga0209676_100039744 70
423 3300025292 Ga0209676_1003696 Ga0209676_100369610 70
424 3300025292 Ga0209676_1007897 Ga0209676_10078975 70
425 3300025298 Ga0209050_1000208 Ga0209050_100020819 70
426 3300025298 Ga0209050_1000588 Ga0209050_100058851 70
427 3300025298 Ga0209050_1000978 Ga0209050_100097824 70
428 3300025298 Ga0209050_1001235 Ga0209050_10012352 70
429 3300025303 Ga0209051_1000219 Ga0209051_100021952 70
430 3300025303 Ga0209051_1000422 Ga0209051_100042251 70
431 3300025303 Ga0209051_1000498 Ga0209051_100049836 70
432 3300025303 Ga0209051_1008755 Ga0209051_10087553 70
433 3300025303 Ga0209051_1086793 Ga0209051_10867932 70
434 3300025304 Ga0209257_1000342 Ga0209257_100034251 70
435 3300025304 Ga0209257_1005479 Ga0209257_10054793 70
436 3300025321 Ga0207656_10000014 Ga0207656_1000001483 70
437 3300025711 Ga0207696_1000032 Ga0207696_1000032314 70
438 3300025711 Ga0207696_1000221 Ga0207696_100022130 70
439 3300025711 Ga0207696_1004504 Ga0207696_10045045 70
440 3300025711 Ga0207696_1011909 Ga0207696_10119094 70
441 3300025711 Ga0207696_1014700 Ga0207696_10147002 70
442 3300025711 Ga0207696_1019928 Ga0207696_10199282 70
443 3300025711 Ga0207696_1206397 Ga0207696_12063972 70
444 3300025728 Ga0207655_1000563 Ga0207655_100056340 70
445 3300025728 Ga0207655_1001730 Ga0207655_10017308 70
446 3300025728 Ga0207655_1001921 Ga0207655_10019219 70
447 3300025728 Ga0207655_1002210 Ga0207655_100221019 70
448 3300025728 Ga0207655_1008923 Ga0207655_10089233 70
449 3300025728 Ga0207655_1009718 Ga0207655_10097183 70
450 3300025728 Ga0207655_1013256 Ga0207655_10132564 70
451 3300025728 Ga0207655_1072946 Ga0207655_10729463 70
452 3300025735 Ga0207713_1000751 Ga0207713_100075131 70
453 3300025735 Ga0207713_1001304 Ga0207713_100130421 70
454 3300025735 Ga0207713_1004618 Ga0207713_10046186 70
455 3300025735 Ga0207713_1005033 Ga0207713_10050337 70
456 3300025735 Ga0207713_1060590 Ga0207713_10605902 70
457 3300025735 Ga0207713_1094647 Ga0207713_10946472 70
458 3300025735 Ga0207713_1101584 Ga0207713_11015842 70
459 3300025735 Ga0207713_1133211 Ga0207713_11332112 70
460 3300025907 Ga0207645_10323487 Ga0207645_103234872 70
461 3300025914 Ga0207671_10000019 Ga0207671_10000019194 70
462 3300025914 Ga0207671_10756619 Ga0207671_107566192 70
463 3300025920 Ga0207649_10000002 Ga0207649_10000002472 70
464 3300025923 Ga0207681_10000584 Ga0207681_1000058418 70
465 3300025923 Ga0207681_10351496 Ga0207681_103514963 70
466 3300025925 Ga0207650_10000198 Ga0207650_1000019828 70
467 3300025933 Ga0207706_10006246 Ga0207706_1000624614 70
468 3300025933 Ga0207706_11118717 Ga0207706_111187171 70
469 3300025934 Ga0207686_10004351 Ga0207686_1000435114 70
470 3300025935 Ga0207709_10000228 Ga0207709_1000022835 70
471 3300025935 Ga0207709_10218401 Ga0207709_102184012 70
472 3300025941 Ga0207711_10337733 Ga0207711_103377332 70
473 3300025945 Ga0207679_10000006 Ga0207679_1000000618 70
474 3300025945 Ga0207679_10168660 Ga0207679_101686601 70
475 3300025981 Ga0207640_10111564 Ga0207640_101115642 70
476 3300026041 Ga0207639_10036231 Ga0207639_100362313 70
477 3300026116 Ga0207674_10477926 Ga0207674_104779262 70
478 3300027111 Ga0209281_1005084 Ga0209281_10050843 70
479 3300027111 Ga0209281_1009764 Ga0209281_10097642 70
480 3300028379 Ga0268266_10486158 Ga0268266_104861583 70
481 3300028379 Ga0268266_11515706 Ga0268266_115157062 70
482 3300028786 Ga0307517_10077807 Ga0307517_100778073 70
483 3300030521 Ga0307511_10097542 Ga0307511_100975423 70
484 3300030733 Ga0314311_1008105 Ga0314311_10081053 70
485 3300030734 Ga0316179_1104439 Ga0316179_11044392 70
486 3300030744 Ga0316181_1138181 Ga0316181_11381812 70
487 3300031344 Ga0265316_10640564 Ga0265316_106405642 70
488 3300031507 Ga0307509_10075412 Ga0307509_100754125 70
489 3300031548 Ga0307408_100001454 Ga0307408_1000014546 70
490 3300031548 Ga0307408_100014079 Ga0307408_1000140796 70
491 3300031548 Ga0307408_100044212 Ga0307408_1000442125 70
492 3300031548 Ga0307408_100117588 Ga0307408_1001175883 70
493 3300031548 Ga0307408_100277440 Ga0307408_1002774402 70
494 3300031730 Ga0307516_10448767 Ga0307516_104487672 70
495 3300031731 Ga0307405_10000211 Ga0307405_100002116 70
496 3300031731 Ga0307405_10006627 Ga0307405_100066275 70
497 3300031731 Ga0307405_10015096 Ga0307405_100150962 70
498 3300031731 Ga0307405_10068258 Ga0307405_100682583 70
499 3300031731 Ga0307405_10764482 Ga0307405_107644821 70
500 3300031824 Ga0307413_10161084 Ga0307413_101610842 70
501 3300031824 Ga0307413_10201067 Ga0307413_102010673 70
502 3300031824 Ga0307413_10354414 Ga0307413_103544142 70
503 3300031824 Ga0307413_11085657 Ga0307413_110856572 70
504 3300031901 Ga0307406_10005906 Ga0307406_100059066 70
505 3300031901 Ga0307406_10114886 Ga0307406_101148861 70
506 3300031901 Ga0307406_12141292 Ga0307406_121412922 70
507 3300031903 Ga0307407_10010259 Ga0307407_100102594 70
508 3300031903 Ga0307407_10511291 Ga0307407_105112912 70
509 3300031911 Ga0307412_10010299 Ga0307412_100102995 70
510 3300031911 Ga0307412_10011063 Ga0307412_100110636 70
511 3300031911 Ga0307412_10031694 Ga0307412_100316943 70
512 3300031911 Ga0307412_10359686 Ga0307412_103596862 70
513 3300031995 Ga0307409_100049132 Ga0307409_1000491322 70
514 3300032002 Ga0307416_100094947 Ga0307416_1000949473 70
515 3300032002 Ga0307416_101579234 Ga0307416_1015792342 70
516 3300032002 Ga0307416_103348128 Ga0307416_1033481282 70
517 3300032004 Ga0307414_10018788 Ga0307414_100187884 70
518 3300032004 Ga0307414_10045625 Ga0307414_100456254 70
519 3300032004 Ga0307414_10359384 Ga0307414_103593841 70
520 3300032004 Ga0307414_10399394 Ga0307414_103993943 70
521 3300032005 Ga0307411_10181079 Ga0307411_101810792 70
522 3300032005 Ga0307411_10582136 Ga0307411_105821362 70
523 3300032005 Ga0307411_12224294 Ga0307411_122242942 70
524 3300033180 Ga0307510_10045373 Ga0307510_100453733 70
525 3300038705 Ga0237819_01118 Ga0237819_01118_3895_4107 70
526 3300041405 Ga0439438_001775 Ga0439438_001775_34_246 70
527 3300041405 Ga0439438_005677 Ga0439438_005677_499_711 70
528 3300041405 Ga0439438_035191 Ga0439438_035191_216_428 70
529 3300041407 Ga0439447_005066 Ga0439447_005066_3856_4068 70
530 3300041407 Ga0439447_015790 Ga0439447_015790_199_411 70
531 3300041411 Ga0439466_0002005 Ga0439466_0002005_3801_4013 70
532 3300041411 Ga0439466_0002810 Ga0439466_0002810_3997_4209 70
533 3300041411 Ga0439466_0023603 Ga0439466_0023603_217_429 70
534 3300041491 Ga0451833_0896841 Ga0451833_0896841_68_280 70
535 3300041498 Ga0451841_1119567 Ga0451841_1119567_133_345 70
536 3300042006 Ga0439432_004736 Ga0439432_004736_3228_3440 70
537 3300042009 Ga0439451_001422 Ga0439451_001422_3987_4199 70
538 3300042009 Ga0439451_001463 Ga0439451_001463_1579_1791 70
539 3300042009 Ga0439451_001543 Ga0439451_001543_1721_1933 70
540 3300042010 Ga0439452_002186 Ga0439452_002186_4048_4260 70
541 3300042010 Ga0439452_010650 Ga0439452_010650_1638_1850 70
542 3300042013 Ga0439456_000904 Ga0439456_000904_2732_2944 70
543 3300042013 Ga0439456_015497 Ga0439456_015497_1239_1451 70
544 3300042013 Ga0439456_088308 Ga0439456_088308_436_648 70
545 3300042013 Ga0439456_124524 Ga0439456_124524_102_314 70
546 3300042016 Ga0439463_001133 Ga0439463_001133_2953_3165 70
547 3300042016 Ga0439463_009946 Ga0439463_009946_1872_2084 70
548 3300042016 Ga0439463_025238 Ga0439463_025238_1062_1274 70
549 3300042115 Ga0450911_001005 Ga0450911_001005_2970_3182 70
550 3300042115 Ga0450911_002792 Ga0450911_002792_1970_2182 70
551 3300042136 Ga0450900_078226 Ga0450900_078226_158_370 70
552 3300042138 Ga0450903_011045 Ga0450903_011045_792_1004 70
553 3300042138 Ga0450903_020283 Ga0450903_020283_288_500 70
554 3300042139 Ga0450904_001481 Ga0450904_001481_2697_2909 70
555 3300042139 Ga0450904_003275 Ga0450904_003275_1533_1745 70
556 3300042142 Ga0450905_001492 Ga0450905_001492_2693_2905 70
557 3300042142 Ga0450905_006037 Ga0450905_006037_808_1020 70
558 3300042142 Ga0450905_021768 Ga0450905_021768_646_858 70
559 3300042144 Ga0450889_006958 Ga0450889_006958_523_735 70
560 3300042145 Ga0450906_000914 Ga0450906_000914_4022_4234 70
561 3300042146 Ga0450907_100567 Ga0450907_100567_45_257 70
562 3300042531 Ga0450918_043507 Ga0450918_043507_360_572 70
563 3300042532 Ga0450893_0003145 Ga0450893_0003145_1534_1746 70
564 3300042993 Ga0439440_0001087 Ga0439440_0001087_1895_2107 70
565 3300046452 Ga0495617_004684 Ga0495617_004684_1040_1252 70
566 3300046452 Ga0495617_010329 Ga0495617_010329_215_427 70
567 3300046452 Ga0495617_033259 Ga0495617_033259_783_995 70
568 3300046453 Ga0495627_000810 Ga0495627_000810_20615_20827 70
569 3300046453 Ga0495627_001143 Ga0495627_001143_3095_3307 70
570 3300046453 Ga0495627_006494 Ga0495627_006494_1651_1863 70
571 3300046453 Ga0495627_022672 Ga0495627_022672_290_502 70
572 3300046455 Ga0495603_0011876 Ga0495603_0011876_2286_2498 70
573 3300046457 Ga0495590_0007727 Ga0495590_0007727_1247_1459 70
574 3300046457 Ga0495590_0011922 Ga0495590_0011922_586_798 70
575 3300046457 Ga0495590_0013501 Ga0495590_0013501_2751_2963 70
576 3300046458 Ga0495591_001155 Ga0495591_001155_13849_14061 70
577 3300046458 Ga0495591_006386 Ga0495591_006386_2244_2456 70
578 3300046458 Ga0495591_007370 Ga0495591_007370_2897_3109 70
579 3300046458 Ga0495591_007644 Ga0495591_007644_1673_1885 70
580 3300046458 Ga0495591_007669 Ga0495591_007669_2676_2888 70
581 3300046458 Ga0495591_011483 Ga0495591_011483_388_600 70
582 3300046459 Ga0495629_0755737 Ga0495629_0755737_49_261 70
583 3300046460 Ga0495638_0022088 Ga0495638_0022088_2658_2870 70
584 3300046463 Ga0495653_0023583 Ga0495653_0023583_3778_3990 70
585 3300046463 Ga0495653_0090896 Ga0495653_0090896_1472_1684 70
586 3300046463 Ga0495653_0152125 Ga0495653_0152125_703_915 70
587 3300046471 Ga0495650_0049782 Ga0495650_0049782_493_705 70
588 3300046471 Ga0495650_0057233 Ga0495650_0057233_883_1095 70
589 3300046474 Ga0495605_0026001 Ga0495605_0026001_2737_2949 70
590 3300046474 Ga0495605_0049188 Ga0495605_0049188_208_420 70
591 3300046475 Ga0495639_0002507 Ga0495639_0002507_3897_4109 70
592 3300046475 Ga0495639_0053748 Ga0495639_0053748_1180_1392 70
593 3300046475 Ga0495639_0601398 Ga0495639_0601398_307_519 70
594 3300046491 Ga0495584_0416303 Ga0495584_0416303_219_431 70
595 3300046492 Ga0495585_0006492 Ga0495585_0006492_4070_4282 70
596 3300046492 Ga0495585_0015212 Ga0495585_0015212_2614_2826 70
597 3300046492 Ga0495585_0018275 Ga0495585_0018275_2718_2930 70
598 3300046499 Ga0495594_0017438 Ga0495594_0017438_1690_1902 70
599 3300046500 Ga0495596_0009030 Ga0495596_0009030_1081_1293 70
600 3300046501 Ga0495607_0006191 Ga0495607_0006191_3986_4198 70
601 3300046501 Ga0495607_0010371 Ga0495607_0010371_2231_2443 70
602 3300046501 Ga0495607_0023358 Ga0495607_0023358_1658_1870 70
603 3300046501 Ga0495607_0027948 Ga0495607_0027948_2900_3112 70
604 3300046501 Ga0495607_0043926 Ga0495607_0043926_1727_1939 70
605 3300046501 Ga0495607_0139900 Ga0495607_0139900_971_1183 70
606 3300046501 Ga0495607_0267865 Ga0495607_0267865_202_414 70
607 3300046506 Ga0495583_0009218 Ga0495583_0009218_2719_2931 70
608 3300046506 Ga0495583_0012785 Ga0495583_0012785_2898_3110 70
609 3300046506 Ga0495583_0135363 Ga0495583_0135363_39_251 70
610 3300046507 Ga0495606_0003047 Ga0495606_0003047_3904_4116 70
611 3300046507 Ga0495606_0016386 Ga0495606_0016386_2775_2987 70
612 3300046507 Ga0495606_0022242 Ga0495606_0022242_1656_1868 70
613 3300046507 Ga0495606_0053975 Ga0495606_0053975_466_678 70
614 3300046507 Ga0495606_0231021 Ga0495606_0231021_303_515 70
615 3300046512 Ga0495610_0013908 Ga0495610_0013908_2927_3139 70
616 3300046512 Ga0495610_0013963 Ga0495610_0013963_2492_2704 70
617 3300046512 Ga0495610_0020334 Ga0495610_0020334_1036_1248 70
618 3300046512 Ga0495610_0020848 Ga0495610_0020848_2711_2923 70
619 3300046512 Ga0495610_0024945 Ga0495610_0024945_466_678 70
620 3300046512 Ga0495610_0151567 Ga0495610_0151567_698_910 70
621 3300046513 Ga0495616_0012861 Ga0495616_0012861_1584_1796 70
622 3300046513 Ga0495616_0013844 Ga0495616_0013844_1651_1863 70
623 3300046513 Ga0495616_0022830 Ga0495616_0022830_1515_1727 70
624 3300046513 Ga0495616_0345568 Ga0495616_0345568_113_325 70
625 3300046515 Ga0495620_0000541 Ga0495620_0000541_20742_20954 70
626 3300046515 Ga0495620_0001018 Ga0495620_0001018_13864_14076 70
627 3300046515 Ga0495620_0013871 Ga0495620_0013871_1149_1361 70
628 3300046515 Ga0495620_0079755 Ga0495620_0079755_587_799 70
629 3300046515 Ga0495620_0087104 Ga0495620_0087104_1019_1231 70
630 3300046515 Ga0495620_0410529 Ga0495620_0410529_190_402 70
631 3300046516 Ga0495628_0016960 Ga0495628_0016960_3363_3575 70
632 3300046517 Ga0495630_0299202 Ga0495630_0299202_469_681 70
633 3300046518 Ga0495631_0006632 Ga0495631_0006632_1750_1962 70
634 3300046518 Ga0495631_0011766 Ga0495631_0011766_2218_2430 70
635 3300046518 Ga0495631_0082780 Ga0495631_0082780_1034_1246 70
636 3300046518 Ga0495631_0287733 Ga0495631_0287733_286_498 70
637 3300046519 Ga0495632_0006763 Ga0495632_0006763_3857_4069 70
638 3300046519 Ga0495632_0012829 Ga0495632_0012829_2974_3186 70
639 3300046519 Ga0495632_0019451 Ga0495632_0019451_2774_2986 70
640 3300046519 Ga0495632_0019635 Ga0495632_0019635_747_959 70
641 3300046519 Ga0495632_0032082 Ga0495632_0032082_2380_2592 70
642 3300046519 Ga0495632_0144123 Ga0495632_0144123_626_838 70
643 3300046520 Ga0495637_0006188 Ga0495637_0006188_1619_1831 70
644 3300046520 Ga0495637_0039629 Ga0495637_0039629_261_473 70
645 3300046520 Ga0495637_0111858 Ga0495637_0111858_325_537 70
646 3300046522 Ga0495643_0014153 Ga0495643_0014153_2926_3138 70
647 3300046522 Ga0495643_0322346 Ga0495643_0322346_419_631 70
648 3300046523 Ga0495644_0005943 Ga0495644_0005943_1620_1832 70
649 3300046523 Ga0495644_0036428 Ga0495644_0036428_1149_1361 70
650 3300046524 Ga0495648_0064488 Ga0495648_0064488_274_486 70
651 3300046524 Ga0495648_0069849 Ga0495648_0069849_1209_1421 70
652 3300046524 Ga0495648_0159098 Ga0495648_0159098_472_684 70
653 3300046524 Ga0495648_0483429 Ga0495648_0483429_17_229 70
654 3300046526 Ga0495666_0136323 Ga0495666_0136323_275_487 70
655 3300046526 Ga0495666_0299437 Ga0495666_0299437_241_453 70
656 3300046529 Ga0495652_0100729 Ga0495652_0100729_1134_1346 70
657 3300046530 Ga0495654_0011506 Ga0495654_0011506_1670_1882 70
658 3300046530 Ga0495654_0012204 Ga0495654_0012204_2050_2262 70
659 3300046530 Ga0495654_0016147 Ga0495654_0016147_1040_1252 70
660 3300046530 Ga0495654_0020443 Ga0495654_0020443_571_783 70
661 3300046530 Ga0495654_0036912 Ga0495654_0036912_293_505 70
662 3300046530 Ga0495654_0061131 Ga0495654_0061131_1230_1442 70
663 3300046530 Ga0495654_0063005 Ga0495654_0063005_262_474 70
664 3300046530 Ga0495654_0087461 Ga0495654_0087461_701_913 70
665 3300046531 Ga0495665_0530551 Ga0495665_0530551_197_409 70
666 3300046536 Ga0495587_0007914 Ga0495587_0007914_3806_4018 70
667 3300046538 Ga0495609_0006215 Ga0495609_0006215_1736_1948 70
668 3300046538 Ga0495609_0009365 Ga0495609_0009365_2897_3109 70
669 3300046538 Ga0495609_0009379 Ga0495609_0009379_2877_3089 70
670 3300046538 Ga0495609_0372002 Ga0495609_0372002_290_502 70
671 3300046542 Ga0495597_0010124 Ga0495597_0010124_1635_1847 70
672 3300046557 Ga0495622_0003103 Ga0495622_0003103_3755_3967 70
673 3300046557 Ga0495622_0008899 Ga0495622_0008899_2774_2986 70
674 3300046557 Ga0495622_0051517 Ga0495622_0051517_943_1155 70
675 3300046558 Ga0495633_0011913 Ga0495633_0011913_2777_2989 70
676 3300046558 Ga0495633_0032628 Ga0495633_0032628_1758_1970 70
677 3300046616 Ga0495668_0009771 Ga0495668_0009771_1661_1873 70
678 3300046616 Ga0495668_0063413 Ga0495668_0063413_350_562 70
679 3300046616 Ga0495668_0552460 Ga0495668_0552460_262_474 70
680 3300046642 Ga0495634_0010409 Ga0495634_0010409_2839_3051 70
681 3300046648 Ga0495611_0000533 Ga0495611_0000533_20608_20820 70
682 3300046648 Ga0495611_0028320 Ga0495611_0028320_1483_1695 70
683 3300046660 Ga0495625_0014932 Ga0495625_0014932_2673_2885 70
684 3300046660 Ga0495625_0033324 Ga0495625_0033324_861_1073 70
685 3300046660 Ga0495625_0049401 Ga0495625_0049401_56_268 70
686 3300046660 Ga0495625_0089576 Ga0495625_0089576_1666_1878 70
687 3300046663 Ga0495635_0009500 Ga0495635_0009500_3791_4003 70
688 3300046664 Ga0495659_0001182 Ga0495659_0001182_3898_4110 70
689 3300046664 Ga0495659_0003189 Ga0495659_0003189_2659_2871 70
690 3300046665 Ga0495661_0001773 Ga0495661_0001773_3264_3476 70
691 3300046665 Ga0495661_0011567 Ga0495661_0011567_2678_2890 70
692 3300046665 Ga0495661_0017508 Ga0495661_0017508_1633_1845 70
693 3300046665 Ga0495661_0025390 Ga0495661_0025390_2604_2816 70
694 3300046665 Ga0495661_0051810 Ga0495661_0051810_19_231 70
695 3300046665 Ga0495661_0114022 Ga0495661_0114022_212_424 70
696 3300046674 Ga0495588_0284052 Ga0495588_0284052_310_522 70
697 3300046679 Ga0495623_0008751 Ga0495623_0008751_3790_4002 70
698 3300046680 Ga0495646_0015656 Ga0495646_0015656_2575_2787 70
699 3300046689 Ga0495613_0042719 Ga0495613_0042719_1520_1732 70
700 3300046691 Ga0495670_0004726 Ga0495670_0004726_2763_2975 70
701 3300046691 Ga0495670_0005868 Ga0495670_0005868_2234_2446 70
702 3300046691 Ga0495670_0009600 Ga0495670_0009600_2923_3135 70
703 3300046691 Ga0495670_0117443 Ga0495670_0117443_64_276 70
704 3300046692 Ga0495671_0026540 Ga0495671_0026540_880_1092 70
705 3300046692 Ga0495671_0031948 Ga0495671_0031948_1631_1843 70
706 3300046692 Ga0495671_0046125 Ga0495671_0046125_1639_1851 70
707 3300046692 Ga0495671_0105579 Ga0495671_0105579_167_379 70
708 3300046692 Ga0495671_0467173 Ga0495671_0467173_192_404 70
709 3300046694 Ga0495649_0009344 Ga0495649_0009344_3372_3584 70
710 3300046694 Ga0495649_0023250 Ga0495649_0023250_2110_2322 70
711 3300046694 Ga0495649_0046448 Ga0495649_0046448_1230_1442 70
712 3300046694 Ga0495649_0058758 Ga0495649_0058758_240_452 70
713 3300046694 Ga0495649_0088999 Ga0495649_0088999_1098_1310 70
714 3300046794 Ga0495589_0006201 Ga0495589_0006201_2753_2965 70
715 3300046794 Ga0495589_0010389 Ga0495589_0010389_2990_3202 70
716 3300046794 Ga0495589_0106710 Ga0495589_0106710_999_1211 70
717 3300046794 Ga0495589_0243403 Ga0495589_0243403_348_560 70
718 3300046794 Ga0495589_0272186 Ga0495589_0272186_354_566 70
719 3300046810 Ga0495660_0007512 Ga0495660_0007512_3384_3596 70
720 3300046810 Ga0495660_0014390 Ga0495660_0014390_2764_2976 70
721 3300046810 Ga0495660_0018471 Ga0495660_0018471_2127_2339 70
722 3300046810 Ga0495660_0023146 Ga0495660_0023146_2809_3021 70
723 3300046810 Ga0495660_0115765 Ga0495660_0115765_450_662 70
724 3300046810 Ga0495660_0259240 Ga0495660_0259240_294_506 70
725 3300047317 Ga0495604_0028414 Ga0495604_0028414_465_677 70
726 3300047319 Ga0495674_0062006 Ga0495674_0062006_307_519 70
727 3300047320 Ga0495672_0009200 Ga0495672_0009200_3138_3350 70
728 3300047320 Ga0495672_0018399 Ga0495672_0018399_1572_1784 70
729 3300047320 Ga0495672_0084394 Ga0495672_0084394_310_522 70
730 3300047321 Ga0495676_0033107 Ga0495676_0033107_1659_1871 70
731 3300047322 Ga0495680_0022793 Ga0495680_0022793_1249_1461 70
732 3300047322 Ga0495680_0816177 Ga0495680_0816177_66_278 70
733 3300047323 Ga0495683_0013590 Ga0495683_0013590_2900_3112 70
734 3300047323 Ga0495683_0014986 Ga0495683_0014986_2728_2940 70
735 3300047323 Ga0495683_0016497 Ga0495683_0016497_2051_2263 70
736 3300047323 Ga0495683_0053431 Ga0495683_0053431_272_484 70
737 3300047444 Ga0495675_0033110 Ga0495675_0033110_2715_2927 70
738 3300047446 Ga0495679_004782 Ga0495679_004782_2682_2894 70
739 3300047446 Ga0495679_006284 Ga0495679_006284_2723_2935 70
740 3300047446 Ga0495679_007342 Ga0495679_007342_2779_2991 70
741 3300047446 Ga0495679_009005 Ga0495679_009005_2683_2895 70
742 3300047446 Ga0495679_024829 Ga0495679_024829_1627_1839 70
743 3300047446 Ga0495679_084736 Ga0495679_084736_128_340 70
744 3300047469 Ga0495673_0012280 Ga0495673_0012280_1633_1845 70
745 3300047469 Ga0495673_0034645 Ga0495673_0034645_433_645 70
746 3300047469 Ga0495673_0039839 Ga0495673_0039839_248_460 70
747 3300047469 Ga0495673_0067706 Ga0495673_0067706_525_737 70
748 3300047470 Ga0495681_0013088 Ga0495681_0013088_2980_3192 70
749 3300047470 Ga0495681_0014365 Ga0495681_0014365_2802_3014 70
750 3300047470 Ga0495681_0015913 Ga0495681_0015913_1422_1634 70
751 3300047470 Ga0495681_0017538 Ga0495681_0017538_1945_2157 70
752 3300047470 Ga0495681_0031763 Ga0495681_0031763_470_682 70
753 3300047472 Ga0495686_0017198 Ga0495686_0017198_2809_3021 70
754 3300047472 Ga0495686_0028324 Ga0495686_0028324_1905_2117 70
755 3300047472 Ga0495686_0391820 Ga0495686_0391820_404_616 70
756 3300047673 Ga0495593_0571116 Ga0495593_0571116_81_293 70
757 3300048088 Ga0495602_0168373 Ga0495602_0168373_1337_1549 70
758 3300048091 Ga0495626_0012962 Ga0495626_0012962_3947_4159 70
759 3300048091 Ga0495626_0014781 Ga0495626_0014781_1118_1330 70
760 3300048091 Ga0495626_0040772 Ga0495626_0040772_339_551 70
761 3300048091 Ga0495626_0325299 Ga0495626_0325299_156_368 70
762 3300048905 Ga0496102_0015028 Ga0496102_0015028_3775_3987 70
763 3300048906 Ga0496103_0007043 Ga0496103_0007043_2812_3024 70
764 3300048915 Ga0496112_0868947 Ga0496112_0868947_158_370 70
765 3300048919 Ga0496116_0010235 Ga0496116_0010235_3863_4075 70
766 3300048919 Ga0496116_0011881 Ga0496116_0011881_5078_5290 70
767 3300048919 Ga0496116_0014498 Ga0496116_0014498_2551_2763 70
768 3300048919 Ga0496116_0045697 Ga0496116_0045697_2701_2913 70
769 3300048919 Ga0496116_0290925 Ga0496116_0290925_518_730 70
770 3300048920 Ga0496117_0003788 Ga0496117_0003788_3197_3409 70
771 3300048920 Ga0496117_0015710 Ga0496117_0015710_3568_3780 70
772 3300048920 Ga0496117_0017174 Ga0496117_0017174_2656_2868 70
773 3300048920 Ga0496117_0017394 Ga0496117_0017394_1695_1907 70
774 3300048920 Ga0496117_0024269 Ga0496117_0024269_2188_2400 70
775 3300048920 Ga0496117_0038709 Ga0496117_0038709_2501_2713 70
776 3300048920 Ga0496117_0047714 Ga0496117_0047714_104_316 70
777 3300048921 Ga0496118_0021090 Ga0496118_0021090_4618_4830 70
778 3300048921 Ga0496118_0021928 Ga0496118_0021928_2829_3041 70
779 3300048921 Ga0496118_0026565 Ga0496118_0026565_1688_1900 70
780 3300048921 Ga0496118_0026643 Ga0496118_0026643_2398_2610 70
781 3300048921 Ga0496118_0151486 Ga0496118_0151486_648_860 70
782 3300048921 Ga0496118_0490780 Ga0496118_0490780_118_330 70
783 3300048921 Ga0496118_0635397 Ga0496118_0635397_99_311 70
784 3300048922 Ga0496119_0014700 Ga0496119_0014700_2698_2910 70
785 3300048922 Ga0496119_0320503 Ga0496119_0320503_91_303 70
786 3300048923 Ga0496120_0011264 Ga0496120_0011264_2753_2965 70
787 3300048924 Ga0496121_0027608 Ga0496121_0027608_3472_3684 70
788 3300048924 Ga0496121_0037018 Ga0496121_0037018_1854_2066 70
789 3300048924 Ga0496121_0102499 Ga0496121_0102499_1645_1857 70
790 3300048924 Ga0496121_0159886 Ga0496121_0159886_824_1036 70
791 3300048924 Ga0496121_0549821 Ga0496121_0549821_212_424 70
792 3300048925 Ga0496122_0009759 Ga0496122_0009759_4824_5036 70
793 3300048925 Ga0496122_0025352 Ga0496122_0025352_2220_2432 70
794 3300048925 Ga0496122_0052514 Ga0496122_0052514_43_255 70
795 3300048925 Ga0496122_0473332 Ga0496122_0473332_118_330 70
796 3300048925 Ga0496122_0615068 Ga0496122_0615068_31_243 70
797 3300048926 Ga0496123_0017780 Ga0496123_0017780_3793_4005 70
798 3300048926 Ga0496123_0019673 Ga0496123_0019673_2214_2426 70
799 3300048926 Ga0496123_0041895 Ga0496123_0041895_1635_1847 70
800 3300048926 Ga0496123_0140762 Ga0496123_0140762_260_472 70
801 3300048927 Ga0496124_0001360 Ga0496124_0001360_5007_5219 70
802 3300048927 Ga0496124_0004110 Ga0496124_0004110_13847_14059 70
803 3300048927 Ga0496124_0020023 Ga0496124_0020023_3535_3747 70
804 3300048927 Ga0496124_0032675 Ga0496124_0032675_2751_2963 70
805 3300048927 Ga0496124_0038867 Ga0496124_0038867_1446_1658 70
806 3300048927 Ga0496124_0063583 Ga0496124_0063583_2725_2937 70
807 3300048927 Ga0496124_0461017 Ga0496124_0461017_294_506 70
808 3300048928 Ga0496125_0001314 Ga0496125_0001314_5127_5339 70
809 3300048928 Ga0496125_0004031 Ga0496125_0004031_13870_14082 70
810 3300048928 Ga0496125_0026261 Ga0496125_0026261_2896_3108 70
811 3300048928 Ga0496125_0032567 Ga0496125_0032567_3320_3532 70
812 3300048928 Ga0496125_0037057 Ga0496125_0037057_1090_1302 70
813 3300048929 Ga0496126_0001465 Ga0496126_0001465_5118_5330 70
814 3300048929 Ga0496126_0042232 Ga0496126_0042232_3128_3340 70
815 3300048929 Ga0496126_0080917 Ga0496126_0080917_907_1119 70
816 3300048929 Ga0496126_0489283 Ga0496126_0489283_341_553 70
817 3300049459 Ga0495678_006294 Ga0495678_006294_2778_2990 70
818 3300049459 Ga0495678_010004 Ga0495678_010004_2765_2977 70
819 3300049459 Ga0495678_010014 Ga0495678_010014_653_865 70
820 3300049459 Ga0495678_026192 Ga0495678_026192_267_479 70
821 3300049459 Ga0495678_031863 Ga0495678_031863_1124_1336 70
822 3300049459 Ga0495678_033723 Ga0495678_033723_272_484 70
823 3300049459 Ga0495678_042164 Ga0495678_042164_1569_1781 70
824 3300049459 Ga0495678_050096 Ga0495678_050096_138_350 70
825 3300049460 Ga0495682_0004569 Ga0495682_0004569_1645_1857 70
826 3300049669 Ga0501235_004019 Ga0501235_004019_1386_1598 70
827 3300049758 Ga0501241_001529 Ga0501241_001529_1727_1939 70
828 3300050491 nmdc:mga00v17_32366_c1 nmdc:mga00v17_32366_c1_1426_1638 70
829 3300053088 Ga0500644_0120422 Ga0500644_0120422_765_977 70
830 3300053111 Ga0500572_002223 Ga0500572_002223_2904_3116 70
831 3300053126 Ga0500621_040931 Ga0500621_040931_281_493 70
832 3300053161 Ga0500634_0005727 Ga0500634_0005727_2694_2906 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05489

Phage_tail_X

Phage Tail Protein X

2

62

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u5b-assembly1.cif.gz_6 cryoem structure of pyocin r2 - precontracted - baseplate 0.857 2 56
6u5b-assembly1.cif.gz_6 cryoem structure of pyocin r2 - precontracted - baseplate 0.8308 2 56
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.7989 1 56
4uz3-assembly1.cif.gz_A crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose 0.7646 1 55
6sgb-assembly1.cif.gz_CJ mt-ssu assemblosome of trypanosoma brucei 0.7445 1 54
ID Description Score Start End Superfamily
4a1iG01 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8003 1 55 3.10.350.10
4a1iG01 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7864 1 55 3.10.350.10
5c8qB02 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7322 1 53 3.10.350.10
1y7mB01 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7248 2 55 3.10.350.10
af_A0A0R0GJZ6_73_142_3.10.350.10 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7245 2 56 3.10.350.10
ID Description Score Start End GO Terms
AF-A0A8B2TUJ1-F1-model_v4 deleted 0.9709 2 56
AF-A0A5F1U8F8-F1-model_v4 deleted 0.9296 2 55
AF-V0XX61-F1-model_v4 deleted 0.9293 2 56
AF-A0A439F0D7-F1-model_v4 deleted 0.9281 2 56
AF-A0A1I1F5Z9-F1-model_v4 P2-like prophage tail protein X 0.9278 1 56

Feature Viewer

pLDDT pTM Quality
81.35 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map