F482654
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 330 | 1660 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10071805|Ga0207706_100718053 |
| Length | 198 |
| Sequence | VCLPNDAAHSRVSVPEIAGRVLLDEADLQRTLRRIAHEIVEKHPDIDRLVLVGIHTRGVYLADRLAALIEQFSDVRVPTGALDISFYRDDVRAHPQPVVKATRLDFPIDDRSVVLVDDVLFTGRTIRSAIEALFGYGRPERVQLAVLVDRGHRELPIRPDYVGKNLPTSRGERVQVELVEVDEIDRVLLVATPEEGSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 206 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 207 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 13.86 |
| Rhizosphere | 85.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207706_10071805 | 3300025933 | Bacteria | 3045 |
| 2 | JGI24751J29686_10052527 | 3300002459 | Bacteria | 840 |
| 3 | Ga0070658_10019697 | 3300005327 | Bacteria | 5402 |
| 4 | Ga0070683_100050631 | 3300005329 | Bacteria | 3846 |
| 5 | Ga0070683_100533832 | 3300005329 | Bacteria | 1121 |
| 6 | Ga0070690_100057382 | 3300005330 | Bacteria | 2499 |
| 7 | Ga0070690_100204498 | 3300005330 | Bacteria | 1376 |
| 8 | Ga0070666_10446498 | 3300005335 | Bacteria | 933 |
| 9 | Ga0070666_10589198 | 3300005335 | Bacteria | 811 |
| 10 | Ga0070680_100030592 | 3300005336 | Bacteria | 4325 |
| 11 | Ga0070682_100060298 | 3300005337 | Bacteria | 2399 |
| 12 | Ga0070682_100094265 | 3300005337 | Bacteria | 1964 |
| 13 | Ga0070682_100121684 | 3300005337 | Bacteria | 1753 |
| 14 | Ga0068868_100014878 | 3300005338 | Bacteria | 5742 |
| 15 | Ga0068868_100070695 | 3300005338 | Bacteria | 2783 |
| 16 | Ga0068868_100436961 | 3300005338 | Bacteria | 1136 |
| 17 | Ga0070660_100045555 | 3300005339 | Bacteria | 3359 |
| 18 | Ga0070660_100072052 | 3300005339 | Bacteria | 2699 |
| 19 | Ga0070660_100417719 | 3300005339 | Bacteria | 1110 |
| 20 | Ga0070689_100326559 | 3300005340 | Bacteria | 1283 |
| 21 | Ga0070691_10049409 | 3300005341 | Bacteria | 2004 |
| 22 | Ga0070691_10092900 | 3300005341 | Bacteria | 1490 |
| 23 | Ga0070691_10133890 | 3300005341 | Bacteria | 1258 |
| 24 | Ga0070687_100061854 | 3300005343 | Bacteria | 1980 |
| 25 | Ga0070687_100203635 | 3300005343 | Bacteria | 1201 |
| 26 | Ga0070661_100141021 | 3300005344 | Bacteria | 1816 |
| 27 | Ga0070661_100236970 | 3300005344 | Bacteria | 1404 |
| 28 | Ga0070692_10040334 | 3300005345 | Bacteria | 2388 |
| 29 | Ga0070668_100259546 | 3300005347 | Bacteria | 1444 |
| 30 | Ga0070674_100172250 | 3300005356 | Bacteria | 1651 |
| 31 | Ga0070673_100336345 | 3300005364 | Bacteria | 1337 |
| 32 | Ga0070688_100080236 | 3300005365 | Bacteria | 2110 |
| 33 | Ga0070688_100137421 | 3300005365 | Bacteria | 1656 |
| 34 | Ga0070688_100417502 | 3300005365 | Bacteria | 996 |
| 35 | Ga0070659_100026977 | 3300005366 | Bacteria | 4423 |
| 36 | Ga0070659_100080744 | 3300005366 | Bacteria | 2596 |
| 37 | Ga0070659_100083392 | 3300005366 | Bacteria | 2555 |
| 38 | Ga0070659_100126831 | 3300005366 | Bacteria | 2071 |
| 39 | Ga0070659_100453025 | 3300005366 | Bacteria | 1089 |
| 40 | Ga0070667_100157099 | 3300005367 | Bacteria | 2001 |
| 41 | Ga0070667_100479060 | 3300005367 | Bacteria | 1139 |
| 42 | Ga0070709_10631335 | 3300005434 | Bacteria | 827 |
| 43 | Ga0070714_100015377 | 3300005435 | Bacteria | 6158 |
| 44 | Ga0070714_100030056 | 3300005435 | Bacteria | 4520 |
| 45 | Ga0070714_100045883 | 3300005435 | Bacteria | 3705 |
| 46 | Ga0070714_100076915 | 3300005435 | Bacteria | 2898 |
| 47 | Ga0070714_100181521 | 3300005435 | Bacteria | 1915 |
| 48 | Ga0070714_100255330 | 3300005435 | Bacteria | 1622 |
| 49 | Ga0070714_100341402 | 3300005435 | Bacteria | 1405 |
| 50 | Ga0070713_100036244 | 3300005436 | Bacteria | 3979 |
| 51 | Ga0070713_100262556 | 3300005436 | Bacteria | 1578 |
| 52 | Ga0070713_100871942 | 3300005436 | Bacteria | 865 |
| 53 | Ga0070713_101050562 | 3300005436 | Bacteria | 786 |
| 54 | Ga0070710_10050315 | 3300005437 | Bacteria | 2335 |
| 55 | Ga0070710_10075013 | 3300005437 | Bacteria | 1958 |
| 56 | Ga0070710_10103895 | 3300005437 | Bacteria | 1696 |
| 57 | Ga0070701_10230257 | 3300005438 | Bacteria | 1109 |
| 58 | Ga0070711_100121906 | 3300005439 | Bacteria | 1930 |
| 59 | Ga0070711_100153455 | 3300005439 | Bacteria | 1739 |
| 60 | Ga0070711_100421600 | 3300005439 | Bacteria | 1088 |
| 61 | Ga0070705_100456571 | 3300005440 | Bacteria | 960 |
| 62 | Ga0070700_100023358 | 3300005441 | Bacteria | 3615 |
| 63 | Ga0070694_100109858 | 3300005444 | Bacteria | 1963 |
| 64 | Ga0070694_100425463 | 3300005444 | Bacteria | 1044 |
| 65 | Ga0070708_100947053 | 3300005445 | Bacteria | 808 |
| 66 | Ga0070678_100419961 | 3300005456 | Bacteria | 1166 |
| 67 | Ga0070662_100383012 | 3300005457 | Bacteria | 1158 |
| 68 | Ga0070681_10276823 | 3300005458 | Bacteria | 1589 |
| 69 | Ga0070681_10289966 | 3300005458 | Bacteria | 1547 |
| 70 | Ga0068867_100926546 | 3300005459 | Bacteria | 785 |
| 71 | Ga0070679_100326084 | 3300005530 | Bacteria | 1484 |
| 72 | Ga0070684_100000711 | 3300005535 | Bacteria | 23042 |
| 73 | Ga0070684_100046988 | 3300005535 | Bacteria | 3741 |
| 74 | Ga0070684_100189522 | 3300005535 | Bacteria | 1871 |
| 75 | Ga0070684_100620945 | 3300005535 | Bacteria | 1005 |
| 76 | Ga0068853_100252684 | 3300005539 | Bacteria | 1618 |
| 77 | Ga0068853_100571871 | 3300005539 | Bacteria | 1072 |
| 78 | Ga0070672_100463871 | 3300005543 | Bacteria | 1092 |
| 79 | Ga0070672_100569436 | 3300005543 | Bacteria | 985 |
| 80 | Ga0070686_100028012 | 3300005544 | Bacteria | 3413 |
| 81 | Ga0070686_100086716 | 3300005544 | Bacteria | 2085 |
| 82 | Ga0070686_101109041 | 3300005544 | Bacteria | 654 |
| 83 | Ga0070695_100117530 | 3300005545 | Bacteria | 1814 |
| 84 | Ga0070696_100009944 | 3300005546 | Bacteria | 6363 |
| 85 | Ga0070696_100269168 | 3300005546 | Bacteria | 1295 |
| 86 | Ga0070693_100043299 | 3300005547 | Bacteria | 2542 |
| 87 | Ga0070693_100182862 | 3300005547 | Bacteria | 1350 |
| 88 | Ga0070665_100176088 | 3300005548 | Bacteria | 2140 |
| 89 | Ga0070704_100570930 | 3300005549 | Bacteria | 991 |
| 90 | Ga0068855_100086346 | 3300005563 | Bacteria | 3628 |
| 91 | Ga0068855_100206577 | 3300005563 | Bacteria | 2209 |
| 92 | Ga0068855_101302663 | 3300005563 | Bacteria | 752 |
| 93 | Ga0070664_100210903 | 3300005564 | Bacteria | 1736 |
| 94 | Ga0068857_100000826 | 3300005577 | Bacteria | 23197 |
| 95 | Ga0068854_100125811 | 3300005578 | Bacteria | 1952 |
| 96 | Ga0068856_100097178 | 3300005614 | Bacteria | 2934 |
| 97 | Ga0068856_100145087 | 3300005614 | Bacteria | 2381 |
| 98 | Ga0068856_100343611 | 3300005614 | Bacteria | 1511 |
| 99 | Ga0070702_100011197 | 3300005615 | Bacteria | 4455 |
| 100 | Ga0070702_100116189 | 3300005615 | Bacteria | 1668 |
| 101 | Ga0070702_100589137 | 3300005615 | Bacteria | 832 |
| 102 | Ga0068852_100023900 | 3300005616 | Bacteria | 4929 |
| 103 | Ga0068852_100092729 | 3300005616 | Bacteria | 2705 |
| 104 | Ga0068859_100363338 | 3300005617 | Bacteria | 1543 |
| 105 | Ga0068864_100177596 | 3300005618 | Bacteria | 1945 |
| 106 | Ga0068864_100193675 | 3300005618 | Bacteria | 1864 |
| 107 | Ga0068864_100576596 | 3300005618 | Bacteria | 1090 |
| 108 | Ga0068866_10139716 | 3300005718 | Bacteria | 1389 |
| 109 | Ga0068851_10240822 | 3300005834 | Bacteria | 1023 |
| 110 | Ga0068870_10121953 | 3300005840 | Bacteria | 1503 |
| 111 | Ga0068863_100274218 | 3300005841 | Bacteria | 1633 |
| 112 | Ga0068863_100607551 | 3300005841 | Bacteria | 1083 |
| 113 | Ga0068858_100040334 | 3300005842 | Bacteria | 4330 |
| 114 | Ga0068860_100097088 | 3300005843 | Bacteria | 2809 |
| 115 | Ga0081455_10005720 | 3300005937 | Bacteria | 13556 |
| 116 | Ga0081539_10094969 | 3300005985 | Bacteria | 1533 |
| 117 | Ga0070717_10044362 | 3300006028 | Bacteria | 3630 |
| 118 | Ga0070717_10049655 | 3300006028 | Bacteria | 3445 |
| 119 | Ga0070717_10098352 | 3300006028 | Bacteria | 2480 |
| 120 | Ga0075368_10223971 | 3300006042 | Bacteria | 799 |
| 121 | Ga0070715_10002122 | 3300006163 | Bacteria | 5993 |
| 122 | Ga0070715_10025097 | 3300006163 | Bacteria | 2357 |
| 123 | Ga0070716_100007976 | 3300006173 | Bacteria | 5242 |
| 124 | Ga0070716_100081391 | 3300006173 | Bacteria | 1933 |
| 125 | Ga0070716_100213334 | 3300006173 | Bacteria | 1292 |
| 126 | Ga0070712_100006301 | 3300006175 | Bacteria | 7353 |
| 127 | Ga0070712_100043043 | 3300006175 | Bacteria | 3107 |
| 128 | Ga0070712_100050350 | 3300006175 | Bacteria | 2897 |
| 129 | Ga0070712_100276668 | 3300006175 | Bacteria | 1351 |
| 130 | Ga0070712_100307628 | 3300006175 | Bacteria | 1285 |
| 131 | Ga0097621_100217200 | 3300006237 | Bacteria | 1665 |
| 132 | Ga0097621_100258832 | 3300006237 | Bacteria | 1526 |
| 133 | Ga0068871_100183159 | 3300006358 | Bacteria | 1801 |
| 134 | Ga0075433_10152453 | 3300006852 | Bacteria | 2056 |
| 135 | Ga0075434_100000288 | 3300006871 | Bacteria | 35846 |
| 136 | Ga0075434_100000835 | 3300006871 | Bacteria | 24504 |
| 137 | Ga0068865_100235331 | 3300006881 | Bacteria | 1439 |
| 138 | Ga0068865_100687808 | 3300006881 | Bacteria | 873 |
| 139 | Ga0075436_100057620 | 3300006914 | Bacteria | 2683 |
| 140 | Ga0097620_100363348 | 3300006931 | Bacteria | 1543 |
| 141 | Ga0075435_100238217 | 3300007076 | Bacteria | 1547 |
| 142 | Ga0075435_100303935 | 3300007076 | Bacteria | 1365 |
| 143 | Ga0111539_10242456 | 3300009094 | Bacteria | 2098 |
| 144 | Ga0105245_10038700 | 3300009098 | Bacteria | 4244 |
| 145 | Ga0105245_10082528 | 3300009098 | Bacteria | 2940 |
| 146 | Ga0105245_10159386 | 3300009098 | Bacteria | 2140 |
| 147 | Ga0105245_10699292 | 3300009098 | Bacteria | 1047 |
| 148 | Ga0105247_10021640 | 3300009101 | Bacteria | 3870 |
| 149 | Ga0105247_10079909 | 3300009101 | Bacteria | 2059 |
| 150 | Ga0105247_10114629 | 3300009101 | Bacteria | 1739 |
| 151 | Ga0105243_10016466 | 3300009148 | Bacteria | 5590 |
| 152 | Ga0105243_10059911 | 3300009148 | Bacteria | 3040 |
| 153 | Ga0105243_10122078 | 3300009148 | Bacteria | 2198 |
| 154 | Ga0105243_10233965 | 3300009148 | Bacteria | 1632 |
| 155 | Ga0105241_10015941 | 3300009174 | Bacteria | 5506 |
| 156 | Ga0105241_10077338 | 3300009174 | Bacteria | 2597 |
| 157 | Ga0105241_11154247 | 3300009174 | Bacteria | 732 |
| 158 | Ga0105242_10016697 | 3300009176 | Bacteria | 5710 |
| 159 | Ga0105242_10050569 | 3300009176 | Bacteria | 3384 |
| 160 | Ga0105242_10175219 | 3300009176 | Bacteria | 1888 |
| 161 | Ga0105242_10366386 | 3300009176 | Bacteria | 1335 |
| 162 | Ga0105242_10644962 | 3300009176 | Bacteria | 1029 |
| 163 | Ga0105248_10118282 | 3300009177 | Bacteria | 2989 |
| 164 | Ga0105248_10135691 | 3300009177 | Bacteria | 2776 |
| 165 | Ga0105248_10594039 | 3300009177 | Bacteria | 1249 |
| 166 | Ga0105237_10112463 | 3300009545 | Bacteria | 2715 |
| 167 | Ga0105237_10520954 | 3300009545 | Bacteria | 1195 |
| 168 | Ga0105238_10029442 | 3300009551 | Bacteria | 5594 |
| 169 | Ga0105238_10038679 | 3300009551 | Bacteria | 4844 |
| 170 | Ga0105238_10046200 | 3300009551 | Bacteria | 4395 |
| 171 | Ga0105249_10064066 | 3300009553 | Bacteria | 3379 |
| 172 | Ga0105249_10391254 | 3300009553 | Bacteria | 1418 |
| 173 | Ga0105239_10018480 | 3300010375 | Bacteria | 7700 |
| 174 | Ga0105239_10242940 | 3300010375 | Bacteria | 2021 |
| 175 | Ga0105239_10280757 | 3300010375 | Bacteria | 1875 |
| 176 | Ga0105246_10024988 | 3300011119 | Bacteria | 3890 |
| 177 | Ga0105246_10031525 | 3300011119 | Bacteria | 3509 |
| 178 | Ga0105246_10060350 | 3300011119 | Bacteria | 2635 |
| 179 | Ga0105246_10126949 | 3300011119 | Bacteria | 1899 |
| 180 | Ga0157369_10006129 | 3300013105 | Bacteria | 13955 |
| 181 | Ga0157369_10185935 | 3300013105 | Bacteria | 2185 |
| 182 | Ga0157369_10358476 | 3300013105 | Bacteria | 1514 |
| 183 | Ga0157374_10047814 | 3300013296 | Bacteria | 3968 |
| 184 | Ga0157378_10111048 | 3300013297 | Bacteria | 2513 |
| 185 | Ga0157378_10892325 | 3300013297 | Bacteria | 919 |
| 186 | Ga0163162_10070208 | 3300013306 | Bacteria | 3554 |
| 187 | Ga0163162_10070822 | 3300013306 | Bacteria | 3538 |
| 188 | Ga0163162_10746676 | 3300013306 | Bacteria | 1098 |
| 189 | Ga0157372_10009702 | 3300013307 | Bacteria | 10235 |
| 190 | Ga0157372_10094023 | 3300013307 | Bacteria | 3412 |
| 191 | Ga0157375_10066456 | 3300013308 | Bacteria | 3600 |
| 192 | Ga0157375_10074921 | 3300013308 | Bacteria | 3407 |
| 193 | Ga0157375_10226619 | 3300013308 | Bacteria | 2028 |
| 194 | Ga0157375_10254135 | 3300013308 | Bacteria | 1918 |
| 195 | Ga0157375_10962733 | 3300013308 | Bacteria | 995 |
| 196 | Ga0163163_10427972 | 3300014325 | Bacteria | 1383 |
| 197 | Ga0157380_10874382 | 3300014326 | Bacteria | 923 |
| 198 | Ga0182008_10332498 | 3300014497 | Bacteria | 802 |
| 199 | Ga0157377_10004033 | 3300014745 | Bacteria | 6701 |
| 200 | Ga0157377_10167523 | 3300014745 | Bacteria | 1371 |
| 201 | Ga0157377_10181017 | 3300014745 | Bacteria | 1325 |
| 202 | Ga0157379_10170569 | 3300014968 | Bacteria | 1964 |
| 203 | Ga0157376_10045675 | 3300014969 | Bacteria | 3608 |
| 204 | Ga0157376_10108326 | 3300014969 | Bacteria | 2441 |
| 205 | Ga0163161_10098715 | 3300017792 | Bacteria | 2171 |
| 206 | Ga0206356_10442982 | 3300020070 | Bacteria | 1154 |
| 207 | Ga0206350_11205423 | 3300020080 | Bacteria | 799 |
| 208 | Ga0206354_10083614 | 3300020081 | Bacteria | 1446 |
| 209 | Ga0206353_10406373 | 3300020082 | Bacteria | 4312 |
| 210 | Ga0224572_1028317 | 3300024225 | Bacteria | 1074 |
| 211 | Ga0207656_10203187 | 3300025321 | Bacteria | 958 |
| 212 | Ga0207692_10031939 | 3300025898 | Bacteria | 2525 |
| 213 | Ga0207692_10036394 | 3300025898 | Bacteria | 2399 |
| 214 | Ga0207692_10683122 | 3300025898 | Bacteria | 665 |
| 215 | Ga0207710_10065052 | 3300025900 | Bacteria | 1661 |
| 216 | Ga0207688_10008115 | 3300025901 | Bacteria | 5708 |
| 217 | Ga0207685_10018551 | 3300025905 | Bacteria | 2274 |
| 218 | Ga0207685_10137038 | 3300025905 | Bacteria | 1093 |
| 219 | Ga0207699_10246608 | 3300025906 | Bacteria | 1229 |
| 220 | Ga0207643_10167051 | 3300025908 | Bacteria | 1326 |
| 221 | Ga0207705_10067037 | 3300025909 | Bacteria | 2597 |
| 222 | Ga0207705_11058418 | 3300025909 | Bacteria | 626 |
| 223 | Ga0207654_10116816 | 3300025911 | Bacteria | 1669 |
| 224 | Ga0207654_10283163 | 3300025911 | Bacteria | 1122 |
| 225 | Ga0207707_10063666 | 3300025912 | Bacteria | 3210 |
| 226 | Ga0207707_10174074 | 3300025912 | Bacteria | 1880 |
| 227 | Ga0207707_10346726 | 3300025912 | Bacteria | 1280 |
| 228 | Ga0207707_10354280 | 3300025912 | Bacteria | 1264 |
| 229 | Ga0207695_10639341 | 3300025913 | Bacteria | 945 |
| 230 | Ga0207695_10952515 | 3300025913 | Bacteria | 738 |
| 231 | Ga0207693_10000699 | 3300025915 | Bacteria | 30109 |
| 232 | Ga0207693_10019664 | 3300025915 | Bacteria | 5370 |
| 233 | Ga0207693_10039506 | 3300025915 | Bacteria | 3716 |
| 234 | Ga0207693_10146778 | 3300025915 | Bacteria | 1855 |
| 235 | Ga0207693_10193754 | 3300025915 | Bacteria | 1599 |
| 236 | Ga0207693_10560112 | 3300025915 | Bacteria | 891 |
| 237 | Ga0207663_10012215 | 3300025916 | Bacteria | 4635 |
| 238 | Ga0207663_10038971 | 3300025916 | Bacteria | 2876 |
| 239 | Ga0207663_10102947 | 3300025916 | Bacteria | 1922 |
| 240 | Ga0207663_10203507 | 3300025916 | Bacteria | 1430 |
| 241 | Ga0207660_10021568 | 3300025917 | Bacteria | 4333 |
| 242 | Ga0207662_10181143 | 3300025918 | Bacteria | 1356 |
| 243 | Ga0207657_10007767 | 3300025919 | Bacteria | 10952 |
| 244 | Ga0207657_10008585 | 3300025919 | Bacteria | 10349 |
| 245 | Ga0207657_10072730 | 3300025919 | Bacteria | 2907 |
| 246 | Ga0207657_10303564 | 3300025919 | Bacteria | 1264 |
| 247 | Ga0207649_10134993 | 3300025920 | Bacteria | 1681 |
| 248 | Ga0207649_10305385 | 3300025920 | Bacteria | 1165 |
| 249 | Ga0207652_10302195 | 3300025921 | Bacteria | 1444 |
| 250 | Ga0207646_10452268 | 3300025922 | Bacteria | 1159 |
| 251 | Ga0207694_10004311 | 3300025924 | Bacteria | 11119 |
| 252 | Ga0207659_10306727 | 3300025926 | Bacteria | 1306 |
| 253 | Ga0207687_10005354 | 3300025927 | Bacteria | 8494 |
| 254 | Ga0207687_10046316 | 3300025927 | Bacteria | 3010 |
| 255 | Ga0207687_10049026 | 3300025927 | Bacteria | 2935 |
| 256 | Ga0207687_10266307 | 3300025927 | Bacteria | 1368 |
| 257 | Ga0207700_10096997 | 3300025928 | Bacteria | 2342 |
| 258 | Ga0207700_10111732 | 3300025928 | Bacteria | 2200 |
| 259 | Ga0207700_10254380 | 3300025928 | Bacteria | 1502 |
| 260 | Ga0207700_10425781 | 3300025928 | Bacteria | 1167 |
| 261 | Ga0207664_10011651 | 3300025929 | Bacteria | 6263 |
| 262 | Ga0207664_10020004 | 3300025929 | Bacteria | 4956 |
| 263 | Ga0207664_10030170 | 3300025929 | Bacteria | 4139 |
| 264 | Ga0207664_10090927 | 3300025929 | Bacteria | 2502 |
| 265 | Ga0207664_10127933 | 3300025929 | Bacteria | 2134 |
| 266 | Ga0207664_10179334 | 3300025929 | Bacteria | 1818 |
| 267 | Ga0207664_10328056 | 3300025929 | Bacteria | 1351 |
| 268 | Ga0207664_10378923 | 3300025929 | Bacteria | 1256 |
| 269 | Ga0207664_10582789 | 3300025929 | Bacteria | 1004 |
| 270 | Ga0207690_10025425 | 3300025932 | Bacteria | 3718 |
| 271 | Ga0207690_10037988 | 3300025932 | Bacteria | 3130 |
| 272 | Ga0207706_10533734 | 3300025933 | Bacteria | 1011 |
| 273 | Ga0207686_10041205 | 3300025934 | Bacteria | 2814 |
| 274 | Ga0207686_10046847 | 3300025934 | Bacteria | 2669 |
| 275 | Ga0207686_10175510 | 3300025934 | Bacteria | 1515 |
| 276 | Ga0207686_10282212 | 3300025934 | Bacteria | 1226 |
| 277 | Ga0207686_10380662 | 3300025934 | Bacteria | 1070 |
| 278 | Ga0207686_10581824 | 3300025934 | Bacteria | 879 |
| 279 | Ga0207709_10071043 | 3300025935 | Bacteria | 2209 |
| 280 | Ga0207709_10171340 | 3300025935 | Bacteria | 1524 |
| 281 | Ga0207670_10356704 | 3300025936 | Bacteria | 1159 |
| 282 | Ga0207670_10528490 | 3300025936 | Bacteria | 961 |
| 283 | Ga0207669_10472310 | 3300025937 | Bacteria | 998 |
| 284 | Ga0207665_10005937 | 3300025939 | Bacteria | 8125 |
| 285 | Ga0207665_10015367 | 3300025939 | Bacteria | 5027 |
| 286 | Ga0207665_10059704 | 3300025939 | Bacteria | 2582 |
| 287 | Ga0207665_10072589 | 3300025939 | Bacteria | 2351 |
| 288 | Ga0207691_10346809 | 3300025940 | Bacteria | 1270 |
| 289 | Ga0207711_10082144 | 3300025941 | Bacteria | 2816 |
| 290 | Ga0207711_10083387 | 3300025941 | Bacteria | 2796 |
| 291 | Ga0207689_10146746 | 3300025942 | Bacteria | 1944 |
| 292 | Ga0207661_10000356 | 3300025944 | Bacteria | 29425 |
| 293 | Ga0207661_10052373 | 3300025944 | Bacteria | 3261 |
| 294 | Ga0207661_10443576 | 3300025944 | Bacteria | 1181 |
| 295 | Ga0207679_10168776 | 3300025945 | Bacteria | 1799 |
| 296 | Ga0207667_10024321 | 3300025949 | Bacteria | 6651 |
| 297 | Ga0207667_10197121 | 3300025949 | Bacteria | 2066 |
| 298 | Ga0207651_10655182 | 3300025960 | Bacteria | 922 |
| 299 | Ga0207712_10694195 | 3300025961 | Bacteria | 888 |
| 300 | Ga0207668_10028464 | 3300025972 | Bacteria | 3654 |
| 301 | Ga0207640_10387493 | 3300025981 | Bacteria | 1134 |
| 302 | Ga0207658_10138297 | 3300025986 | Bacteria | 1967 |
| 303 | Ga0207658_10398148 | 3300025986 | Bacteria | 1210 |
| 304 | Ga0207658_10437636 | 3300025986 | Bacteria | 1156 |
| 305 | Ga0207677_10301829 | 3300026023 | Bacteria | 1323 |
| 306 | Ga0207677_10493563 | 3300026023 | Bacteria | 1057 |
| 307 | Ga0207703_10025981 | 3300026035 | Bacteria | 4608 |
| 308 | Ga0207703_10612188 | 3300026035 | Bacteria | 1031 |
| 309 | Ga0207639_10247764 | 3300026041 | Bacteria | 1552 |
| 310 | Ga0207639_10367884 | 3300026041 | Bacteria | 1288 |
| 311 | Ga0207708_10002912 | 3300026075 | Bacteria | 12612 |
| 312 | Ga0207702_10033656 | 3300026078 | Bacteria | 4282 |
| 313 | Ga0207702_10132902 | 3300026078 | Bacteria | 2241 |
| 314 | Ga0207702_10233230 | 3300026078 | Bacteria | 1721 |
| 315 | Ga0207641_10264028 | 3300026088 | Bacteria | 1613 |
| 316 | Ga0207641_10909257 | 3300026088 | Bacteria | 874 |
| 317 | Ga0207648_10085529 | 3300026089 | Bacteria | 2751 |
| 318 | Ga0207648_10152869 | 3300026089 | Bacteria | 2037 |
| 319 | Ga0207676_10171203 | 3300026095 | Bacteria | 1892 |
| 320 | Ga0207674_10001737 | 3300026116 | Bacteria | 27843 |
| 321 | Ga0207674_10080902 | 3300026116 | Bacteria | 3251 |
| 322 | Ga0207674_11267847 | 3300026116 | Bacteria | 706 |
| 323 | Ga0207675_100177952 | 3300026118 | Bacteria | 2036 |
| 324 | Ga0207683_10374631 | 3300026121 | Bacteria | 1308 |
| 325 | Ga0207698_10154402 | 3300026142 | Bacteria | 1997 |
| 326 | Ga0207698_10233409 | 3300026142 | Bacteria | 1672 |
| 327 | Ga0207428_10662860 | 3300027907 | Bacteria | 748 |
| 328 | Ga0268266_10126001 | 3300028379 | Bacteria | 2286 |
| 329 | Ga0268265_10730780 | 3300028380 | Bacteria | 959 |
| 330 | Ga0268264_10112709 | 3300028381 | Bacteria | 2385 |
| 331 | Ga0265318_10005179 | 3300028577 | Bacteria | 6158 |
| 332 | Ga0265318_10092440 | 3300028577 | Bacteria | 1114 |
| 333 | Ga0265336_10056728 | 3300028666 | Bacteria | 1177 |
| 334 | Ga0265338_10022368 | 3300028800 | Bacteria | 6547 |
| 335 | Ga0265338_10100995 | 3300028800 | Bacteria | 2350 |
| 336 | Ga0265320_10077003 | 3300031240 | Bacteria | 1561 |
| 337 | Ga0265320_10361707 | 3300031240 | Bacteria | 641 |
| 338 | Ga0265327_10005540 | 3300031251 | Bacteria | 10492 |
| 339 | Ga0307408_100101784 | 3300031548 | Bacteria | 2190 |
| 340 | Ga0265314_10430199 | 3300031711 | Bacteria | 707 |
| 341 | Ga0316576_10207766 | 3300031727 | Bacteria | 1474 |
| 342 | Ga0307405_10018083 | 3300031731 | Bacteria | 3882 |
| 343 | Ga0307413_10076094 | 3300031824 | Bacteria | 2132 |
| 344 | Ga0307406_10569327 | 3300031901 | Bacteria | 929 |
| 345 | Ga0307407_10105726 | 3300031903 | Bacteria | 1756 |
| 346 | Ga0307412_10218851 | 3300031911 | Bacteria | 1458 |
| 347 | Ga0307416_100024690 | 3300032002 | Bacteria | 4393 |
| 348 | Ga0307411_10347681 | 3300032005 | Bacteria | 1207 |
| 349 | Ga0307415_100105236 | 3300032126 | Bacteria | 2080 |
| 350 | Ga0373958_0029522 | 3300034819 | Bacteria | 1068 |
| 351 | Ga0373959_0024036 | 3300034820 | Bacteria | 1189 |
| 352 | Ga0373928_0132971 | 3300035084 | Bacteria | 676 |
| 353 | Ga0373934_0078999 | 3300035086 | Bacteria | 1321 |
| 354 | Ga0373944_0033975 | 3300035089 | Bacteria | 1548 |
| 355 | Ga0373949_0093201 | 3300035090 | Bacteria | 817 |
| 356 | Ga0373952_0118189 | 3300035092 | Bacteria | 717 |
| 357 | Ga0373923_0054112 | 3300035111 | Bacteria | 1689 |
| 358 | Ga0373945_0003651 | 3300035116 | Bacteria | 4851 |
| 359 | Ga0373956_0032374 | 3300035119 | Bacteria | 2294 |
| 360 | Ga0373956_0034811 | 3300035119 | Bacteria | 2219 |
| 361 | Ga0373943_0002533 | 3300035170 | Bacteria | 8308 |
| 362 | Ga0373943_0002822 | 3300035170 | Bacteria | 7893 |
| 363 | Ga0373943_0122817 | 3300035170 | Bacteria | 1382 |
| 364 | Ga0373946_0019737 | 3300035171 | Bacteria | 2600 |
| 365 | Ga0373946_0041631 | 3300035171 | Bacteria | 1885 |
| 366 | Ga0373955_0014885 | 3300035172 | Bacteria | 3796 |
| 367 | Ga0373942_0176103 | 3300035207 | Bacteria | 699 |
| 368 | Ga0373962_0043449 | 3300035242 | Bacteria | 1274 |
| 369 | Ga0373924_0203602 | 3300035410 | Bacteria | 873 |
| 370 | Ga0373935_0005827 | 3300035692 | Bacteria | 7298 |
| 371 | Ga0373927_0301482 | 3300035695 | Bacteria | 1054 |
| 372 | Ga0373933_0009253 | 3300035724 | Bacteria | 5378 |
| 373 | Ga0373933_0271627 | 3300035724 | Bacteria | 1094 |
| 374 | Ga0373947_0002551 | 3300035725 | Bacteria | 10942 |
| 375 | Ga0373947_0003342 | 3300035725 | Bacteria | 9498 |
| 376 | Ga0373947_0050882 | 3300035725 | Bacteria | 2491 |
| 377 | Ga0373947_0125632 | 3300035725 | Bacteria | 1633 |
| 378 | Ga0373947_0255559 | 3300035725 | Bacteria | 1160 |
| 379 | Ga0373937_0016053 | 3300036401 | Bacteria | 6642 |
| 380 | Ga0373937_0241893 | 3300036401 | Bacteria | 1700 |
| 381 | Ga0373937_0263344 | 3300036401 | Bacteria | 1626 |
| 382 | Ga0373937_1060630 | 3300036401 | Bacteria | 759 |
| 383 | Ga0373925_0002657 | 3300037068 | Bacteria | 14187 |
| 384 | Ga0373925_0002831 | 3300037068 | Bacteria | 13686 |
| 385 | Ga0316581_0124895 | 3300037588 | Bacteria | 793 |
| 386 | Ga0436365_1554552 | 3300039437 | Bacteria | 1376 |
| 387 | Ga0436360_0625251 | 3300039438 | Bacteria | 1102 |
| 388 | Ga0436362_0906223 | 3300039453 | Bacteria | 874 |
| 389 | Ga0436362_1029002 | 3300039453 | Bacteria | 1628 |
| 390 | Ga0451837_0843915 | 3300041494 | Bacteria | 992 |
| 391 | Ga0450923_048650 | 3300042125 | Bacteria | 906 |
| 392 | Ga0439444_0032705 | 3300042437 | Bacteria | 985 |
| 393 | Ga0466969_0000256 | 3300044656 | Bacteria | 29049 |
| 394 | Ga0466969_0090012 | 3300044656 | Bacteria | 1455 |
| 395 | Ga0466965_0118278 | 3300044683 | Bacteria | 1367 |
| 396 | Ga0466966_0267654 | 3300044684 | Bacteria | 1028 |
| 397 | Ga0466961_0004860 | 3300044693 | Bacteria | 8455 |
| 398 | Ga0466961_0024643 | 3300044693 | Bacteria | 3871 |
| 399 | Ga0466963_0000010 | 3300044694 | Bacteria | 68690 |
| 400 | Ga0466963_0000729 | 3300044694 | Bacteria | 16148 |
| 401 | Ga0466963_0000923 | 3300044694 | Bacteria | 14990 |
| 402 | Ga0466963_0030090 | 3300044694 | Bacteria | 3500 |
| 403 | Ga0466963_0045083 | 3300044694 | Bacteria | 2903 |
| 404 | Ga0466963_0070894 | 3300044694 | Bacteria | 2344 |
| 405 | Ga0466963_0105940 | 3300044694 | Bacteria | 1927 |
| 406 | Ga0466963_0113070 | 3300044694 | Bacteria | 1864 |
| 407 | Ga0466964_0004448 | 3300044706 | Bacteria | 5180 |
| 408 | Ga0466964_0013913 | 3300044706 | Bacteria | 3056 |
| 409 | Ga0466964_0029938 | 3300044706 | Bacteria | 2152 |
| 410 | Ga0466964_0032653 | 3300044706 | Bacteria | 2069 |
| 411 | Ga0466971_0001870 | 3300044719 | Bacteria | 8943 |
| 412 | Ga0466971_0023374 | 3300044719 | Bacteria | 2755 |
| 413 | Ga0466968_0101901 | 3300044735 | Bacteria | 1282 |
| 414 | Ga0466968_0203363 | 3300044735 | Bacteria | 928 |
| 415 | Ga0466957_0003847 | 3300044842 | Bacteria | 8295 |
| 416 | Ga0466957_0008939 | 3300044842 | Bacteria | 5709 |
| 417 | Ga0466957_0009784 | 3300044842 | Bacteria | 5480 |
| 418 | Ga0466957_0017342 | 3300044842 | Bacteria | 4215 |
| 419 | Ga0466957_0162417 | 3300044842 | Bacteria | 1451 |
| 420 | Ga0466960_0051885 | 3300044901 | Bacteria | 1983 |
| 421 | Ga0466959_0034480 | 3300045049 | Bacteria | 3743 |
| 422 | Ga0466959_0037080 | 3300045049 | Bacteria | 3601 |
| 423 | Ga0466959_0156221 | 3300045049 | Bacteria | 1605 |
| 424 | Ga0466958_0016966 | 3300045836 | Bacteria | 4200 |
| 425 | Ga0466958_0017005 | 3300045836 | Bacteria | 4196 |
| 426 | Ga0466958_0043921 | 3300045836 | Bacteria | 2693 |
| 427 | Ga0466958_0068360 | 3300045836 | Bacteria | 2171 |
| 428 | Ga0466958_0158818 | 3300045836 | Bacteria | 1427 |
| 429 | Ga0466967_0000714 | 3300045976 | Bacteria | 16931 |
| 430 | Ga0466967_0001587 | 3300045976 | Bacteria | 13369 |
| 431 | Ga0466967_0006509 | 3300045976 | Bacteria | 8277 |
| 432 | Ga0466967_0009326 | 3300045976 | Bacteria | 7273 |
| 433 | Ga0466967_0014002 | 3300045976 | Bacteria | 6227 |
| 434 | Ga0466967_0031130 | 3300045976 | Bacteria | 4488 |
| 435 | Ga0466967_0034213 | 3300045976 | Bacteria | 4310 |
| 436 | Ga0466967_0047329 | 3300045976 | Bacteria | 3748 |
| 437 | Ga0466967_0115837 | 3300045976 | Bacteria | 2468 |
| 438 | Ga0466967_0138682 | 3300045976 | Bacteria | 2263 |
| 439 | Ga0466967_0217653 | 3300045976 | Bacteria | 1813 |
| 440 | Ga0495592_0000123 | 3300046454 | Bacteria | 68503 |
| 441 | Ga0495592_0030159 | 3300046454 | Bacteria | 4101 |
| 442 | Ga0495592_0107394 | 3300046454 | Bacteria | 1980 |
| 443 | Ga0495592_0146462 | 3300046454 | Bacteria | 1637 |
| 444 | Ga0495592_0205597 | 3300046454 | Bacteria | 1326 |
| 445 | Ga0495592_0411989 | 3300046454 | Bacteria | 854 |
| 446 | Ga0495603_0010950 | 3300046455 | Bacteria | 5502 |
| 447 | Ga0495603_0032069 | 3300046455 | Bacteria | 3162 |
| 448 | Ga0495603_0101372 | 3300046455 | Bacteria | 1681 |
| 449 | Ga0495603_0119915 | 3300046455 | Bacteria | 1533 |
| 450 | Ga0495629_0000994 | 3300046459 | Bacteria | 22717 |
| 451 | Ga0495629_0009028 | 3300046459 | Bacteria | 7313 |
| 452 | Ga0495629_0018064 | 3300046459 | Bacteria | 5055 |
| 453 | Ga0495629_0020910 | 3300046459 | Bacteria | 4670 |
| 454 | Ga0495641_0000793 | 3300046461 | Bacteria | 26791 |
| 455 | Ga0495641_0035515 | 3300046461 | Bacteria | 2348 |
| 456 | Ga0495641_0053393 | 3300046461 | Bacteria | 1838 |
| 457 | Ga0495641_0258530 | 3300046461 | Bacteria | 783 |
| 458 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 459 | Ga0495651_0096308 | 3300046462 | Bacteria | 2211 |
| 460 | Ga0495651_0496852 | 3300046462 | Bacteria | 781 |
| 461 | Ga0495653_0027988 | 3300046463 | Bacteria | 4511 |
| 462 | Ga0495653_0032669 | 3300046463 | Bacteria | 4130 |
| 463 | Ga0495653_0051597 | 3300046463 | Bacteria | 3157 |
| 464 | Ga0495653_0075091 | 3300046463 | Bacteria | 2517 |
| 465 | Ga0495653_0428875 | 3300046463 | Bacteria | 835 |
| 466 | Ga0495582_0000121 | 3300046473 | Bacteria | 41858 |
| 467 | Ga0495582_0003900 | 3300046473 | Bacteria | 8377 |
| 468 | Ga0495582_0130182 | 3300046473 | Bacteria | 1421 |
| 469 | Ga0495582_0180528 | 3300046473 | Bacteria | 1202 |
| 470 | Ga0495582_0207459 | 3300046473 | Bacteria | 1120 |
| 471 | Ga0495639_0001326 | 3300046475 | Bacteria | 11118 |
| 472 | Ga0495639_0003851 | 3300046475 | Bacteria | 6446 |
| 473 | Ga0495639_0128808 | 3300046475 | Bacteria | 1210 |
| 474 | Ga0495662_0060400 | 3300046476 | Bacteria | 1830 |
| 475 | Ga0495664_0077122 | 3300046477 | Bacteria | 1995 |
| 476 | Ga0495594_0025678 | 3300046499 | Bacteria | 3167 |
| 477 | Ga0495594_0046101 | 3300046499 | Bacteria | 2393 |
| 478 | Ga0495594_0264945 | 3300046499 | Bacteria | 979 |
| 479 | Ga0495608_0010283 | 3300046511 | Bacteria | 6528 |
| 480 | Ga0495608_0061017 | 3300046511 | Bacteria | 2480 |
| 481 | Ga0495608_0115181 | 3300046511 | Bacteria | 1726 |
| 482 | Ga0495608_0208543 | 3300046511 | Bacteria | 1229 |
| 483 | Ga0495618_0009350 | 3300046514 | Bacteria | 5915 |
| 484 | Ga0495618_0010759 | 3300046514 | Bacteria | 5539 |
| 485 | Ga0495618_0109320 | 3300046514 | Bacteria | 1770 |
| 486 | Ga0495618_0481744 | 3300046514 | Bacteria | 750 |
| 487 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 488 | Ga0495628_0083154 | 3300046516 | Bacteria | 2486 |
| 489 | Ga0495630_0001677 | 3300046517 | Bacteria | 15422 |
| 490 | Ga0495630_0024209 | 3300046517 | Bacteria | 4490 |
| 491 | Ga0495630_0390284 | 3300046517 | Bacteria | 1066 |
| 492 | Ga0495630_0626008 | 3300046517 | Bacteria | 824 |
| 493 | Ga0495644_0132582 | 3300046523 | Bacteria | 950 |
| 494 | Ga0495666_0028479 | 3300046526 | Bacteria | 2748 |
| 495 | Ga0495666_0214177 | 3300046526 | Bacteria | 883 |
| 496 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 497 | Ga0495652_0040377 | 3300046529 | Bacteria | 4033 |
| 498 | Ga0495652_0070137 | 3300046529 | Bacteria | 2931 |
| 499 | Ga0495665_0002067 | 3300046531 | Bacteria | 10864 |
| 500 | Ga0495665_0039796 | 3300046531 | Bacteria | 2503 |
| 501 | Ga0495665_0302097 | 3300046531 | Bacteria | 819 |
| 502 | Ga0495640_0005309 | 3300046533 | Bacteria | 10236 |
| 503 | Ga0495640_0066725 | 3300046533 | Bacteria | 2426 |
| 504 | Ga0495640_0093669 | 3300046533 | Bacteria | 1979 |
| 505 | Ga0495640_0175373 | 3300046533 | Bacteria | 1368 |
| 506 | Ga0495640_0228979 | 3300046533 | Bacteria | 1170 |
| 507 | Ga0495640_0501700 | 3300046533 | Bacteria | 738 |
| 508 | Ga0495586_0041599 | 3300046535 | Bacteria | 2475 |
| 509 | Ga0495587_0000083 | 3300046536 | Bacteria | 73166 |
| 510 | Ga0495587_0277296 | 3300046536 | Bacteria | 940 |
| 511 | Ga0495645_0000306 | 3300046543 | Bacteria | 35497 |
| 512 | Ga0495645_0128732 | 3300046543 | Bacteria | 1777 |
| 513 | Ga0495645_0305760 | 3300046543 | Bacteria | 1037 |
| 514 | Ga0495645_0470175 | 3300046543 | Bacteria | 790 |
| 515 | Ga0495667_0039034 | 3300046559 | Bacteria | 3160 |
| 516 | Ga0495667_0067366 | 3300046559 | Bacteria | 2339 |
| 517 | Ga0495667_0440249 | 3300046559 | Bacteria | 819 |
| 518 | Ga0495634_0006358 | 3300046642 | Bacteria | 8981 |
| 519 | Ga0495634_0018372 | 3300046642 | Bacteria | 4978 |
| 520 | Ga0495634_0072146 | 3300046642 | Bacteria | 2271 |
| 521 | Ga0495634_0246409 | 3300046642 | Bacteria | 1094 |
| 522 | Ga0495634_0250170 | 3300046642 | Bacteria | 1084 |
| 523 | Ga0495635_0006907 | 3300046663 | Bacteria | 7929 |
| 524 | Ga0495635_0020295 | 3300046663 | Bacteria | 4630 |
| 525 | Ga0495588_0061492 | 3300046674 | Bacteria | 1945 |
| 526 | Ga0495657_0002001 | 3300046675 | Bacteria | 17366 |
| 527 | Ga0495657_0003532 | 3300046675 | Bacteria | 12748 |
| 528 | Ga0495657_0225292 | 3300046675 | Bacteria | 1135 |
| 529 | Ga0495657_0278255 | 3300046675 | Bacteria | 1002 |
| 530 | Ga0495599_0000219 | 3300046678 | Bacteria | 36729 |
| 531 | Ga0495623_0000429 | 3300046679 | Bacteria | 27648 |
| 532 | Ga0495623_0215777 | 3300046679 | Bacteria | 1096 |
| 533 | Ga0495646_0136835 | 3300046680 | Bacteria | 1373 |
| 534 | Ga0495647_0037351 | 3300046681 | Bacteria | 1832 |
| 535 | Ga0495647_0097974 | 3300046681 | Bacteria | 1211 |
| 536 | Ga0495647_0102486 | 3300046681 | Bacteria | 1187 |
| 537 | Ga0495658_0000379 | 3300046683 | Bacteria | 24931 |
| 538 | Ga0495658_0113939 | 3300046683 | Bacteria | 1628 |
| 539 | Ga0495613_0005639 | 3300046689 | Bacteria | 9392 |
| 540 | Ga0495613_0009778 | 3300046689 | Bacteria | 7128 |
| 541 | Ga0495613_0019918 | 3300046689 | Bacteria | 5001 |
| 542 | Ga0495613_0024508 | 3300046689 | Bacteria | 4495 |
| 543 | Ga0495613_0143888 | 3300046689 | Bacteria | 1702 |
| 544 | Ga0495624_0004263 | 3300046690 | Bacteria | 10505 |
| 545 | Ga0495624_0011660 | 3300046690 | Bacteria | 6037 |
| 546 | Ga0495600_0010768 | 3300046809 | Bacteria | 5685 |
| 547 | Ga0495600_0120139 | 3300046809 | Bacteria | 1709 |
| 548 | Ga0495600_0237676 | 3300046809 | Bacteria | 1161 |
| 549 | Ga0495581_0002326 | 3300047315 | Bacteria | 10704 |
| 550 | Ga0495581_0012125 | 3300047315 | Bacteria | 4988 |
| 551 | Ga0495581_0087109 | 3300047315 | Bacteria | 1810 |
| 552 | Ga0495604_0000072 | 3300047317 | Bacteria | 88631 |
| 553 | Ga0495604_0057420 | 3300047317 | Bacteria | 2992 |
| 554 | Ga0495604_0133193 | 3300047317 | Bacteria | 1784 |
| 555 | Ga0495674_0013662 | 3300047319 | Bacteria | 7629 |
| 556 | Ga0495674_0063132 | 3300047319 | Bacteria | 3222 |
| 557 | Ga0495674_0120806 | 3300047319 | Bacteria | 2213 |
| 558 | Ga0495674_0151397 | 3300047319 | Bacteria | 1945 |
| 559 | Ga0495674_0225952 | 3300047319 | Bacteria | 1546 |
| 560 | Ga0495674_0261355 | 3300047319 | Bacteria | 1422 |
| 561 | Ga0495676_0002172 | 3300047321 | Bacteria | 17365 |
| 562 | Ga0495676_0017184 | 3300047321 | Bacteria | 6402 |
| 563 | Ga0495676_0107711 | 3300047321 | Bacteria | 2051 |
| 564 | Ga0495676_0174317 | 3300047321 | Bacteria | 1511 |
| 565 | Ga0495676_0181688 | 3300047321 | Bacteria | 1474 |
| 566 | Ga0495680_0003161 | 3300047322 | Bacteria | 16400 |
| 567 | Ga0495680_0023822 | 3300047322 | Bacteria | 5086 |
| 568 | Ga0495680_0137220 | 3300047322 | Bacteria | 1792 |
| 569 | Ga0495680_0210865 | 3300047322 | Bacteria | 1391 |
| 570 | Ga0495680_0346809 | 3300047322 | Bacteria | 1034 |
| 571 | Ga0495683_0128015 | 3300047323 | Bacteria | 1200 |
| 572 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 573 | Ga0495684_0005222 | 3300047471 | Bacteria | 10121 |
| 574 | Ga0495684_0029400 | 3300047471 | Bacteria | 4217 |
| 575 | Ga0495684_0071519 | 3300047471 | Bacteria | 2635 |
| 576 | Ga0495684_0162643 | 3300047471 | Bacteria | 1664 |
| 577 | Ga0495684_0199816 | 3300047471 | Bacteria | 1474 |
| 578 | Ga0495593_0003514 | 3300047673 | Bacteria | 9374 |
| 579 | Ga0495593_0063157 | 3300047673 | Bacteria | 1934 |
| 580 | Ga0495593_0210521 | 3300047673 | Bacteria | 976 |
| 581 | Ga0495593_0231898 | 3300047673 | Bacteria | 926 |
| 582 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 583 | Ga0495602_0353352 | 3300048088 | Bacteria | 1060 |
| 584 | Ga0495614_0003819 | 3300048089 | Bacteria | 6773 |
| 585 | Ga0495614_0008437 | 3300048089 | Bacteria | 4581 |
| 586 | Ga0495614_0152314 | 3300048089 | Bacteria | 1032 |
| 587 | Ga0496100_0012411 | 3300048903 | Bacteria | 4884 |
| 588 | Ga0496100_0012593 | 3300048903 | Bacteria | 4853 |
| 589 | Ga0496100_0052833 | 3300048903 | Bacteria | 2643 |
| 590 | Ga0496100_0079734 | 3300048903 | Bacteria | 2207 |
| 591 | Ga0496100_0095970 | 3300048903 | Bacteria | 2033 |
| 592 | Ga0496100_0111529 | 3300048903 | Bacteria | 1901 |
| 593 | Ga0496100_0340333 | 3300048903 | Bacteria | 1131 |
| 594 | Ga0496100_0390935 | 3300048903 | Bacteria | 1058 |
| 595 | Ga0496101_0015611 | 3300048904 | Bacteria | 5123 |
| 596 | Ga0496101_0028111 | 3300048904 | Bacteria | 3923 |
| 597 | Ga0496101_0033693 | 3300048904 | Bacteria | 3614 |
| 598 | Ga0496101_0070970 | 3300048904 | Bacteria | 2552 |
| 599 | Ga0496101_0188639 | 3300048904 | Bacteria | 1590 |
| 600 | Ga0496101_0189561 | 3300048904 | Bacteria | 1586 |
| 601 | Ga0496101_0353036 | 3300048904 | Bacteria | 1156 |
| 602 | Ga0496102_0002804 | 3300048905 | Bacteria | 14856 |
| 603 | Ga0496102_0021438 | 3300048905 | Bacteria | 5714 |
| 604 | Ga0496102_0040384 | 3300048905 | Bacteria | 4220 |
| 605 | Ga0496102_0296945 | 3300048905 | Bacteria | 1523 |
| 606 | Ga0496102_1376979 | 3300048905 | Bacteria | 624 |
| 607 | Ga0496103_0008754 | 3300048906 | Bacteria | 6005 |
| 608 | Ga0496103_0071379 | 3300048906 | Bacteria | 2173 |
| 609 | Ga0496103_0181259 | 3300048906 | Bacteria | 1354 |
| 610 | Ga0496104_0008696 | 3300048907 | Bacteria | 9030 |
| 611 | Ga0496104_0043760 | 3300048907 | Bacteria | 4205 |
| 612 | Ga0496104_0048689 | 3300048907 | Bacteria | 3996 |
| 613 | Ga0496104_0053246 | 3300048907 | Bacteria | 3823 |
| 614 | Ga0496104_0107364 | 3300048907 | Bacteria | 2675 |
| 615 | Ga0496104_0253621 | 3300048907 | Bacteria | 1672 |
| 616 | Ga0496104_0268810 | 3300048907 | Bacteria | 1617 |
| 617 | Ga0496104_0361476 | 3300048907 | Bacteria | 1364 |
| 618 | Ga0496104_0406775 | 3300048907 | Bacteria | 1273 |
| 619 | Ga0496104_0778099 | 3300048907 | Bacteria | 863 |
| 620 | Ga0496105_0004361 | 3300048908 | Bacteria | 10651 |
| 621 | Ga0496105_0016087 | 3300048908 | Bacteria | 5966 |
| 622 | Ga0496105_0023623 | 3300048908 | Bacteria | 4988 |
| 623 | Ga0496105_0047222 | 3300048908 | Bacteria | 3553 |
| 624 | Ga0496105_0124219 | 3300048908 | Bacteria | 2127 |
| 625 | Ga0496105_0176594 | 3300048908 | Bacteria | 1749 |
| 626 | Ga0496105_0177556 | 3300048908 | Bacteria | 1744 |
| 627 | Ga0496105_0285899 | 3300048908 | Bacteria | 1328 |
| 628 | Ga0496106_0005959 | 3300048909 | Bacteria | 9001 |
| 629 | Ga0496106_0055546 | 3300048909 | Bacteria | 2993 |
| 630 | Ga0496106_0056152 | 3300048909 | Bacteria | 2976 |
| 631 | Ga0496106_0359243 | 3300048909 | Bacteria | 1170 |
| 632 | Ga0496106_0574854 | 3300048909 | Bacteria | 903 |
| 633 | Ga0496106_0711088 | 3300048909 | Bacteria | 800 |
| 634 | Ga0496107_0004476 | 3300048910 | Bacteria | 9477 |
| 635 | Ga0496107_0016375 | 3300048910 | Bacteria | 5204 |
| 636 | Ga0496107_0168776 | 3300048910 | Bacteria | 1623 |
| 637 | Ga0496107_0173083 | 3300048910 | Bacteria | 1602 |
| 638 | Ga0496107_0207543 | 3300048910 | Bacteria | 1456 |
| 639 | Ga0496107_0340725 | 3300048910 | Bacteria | 1115 |
| 640 | Ga0496107_0462652 | 3300048910 | Bacteria | 942 |
| 641 | Ga0496107_0670160 | 3300048910 | Bacteria | 764 |
| 642 | Ga0496108_0008186 | 3300048911 | Bacteria | 8484 |
| 643 | Ga0496108_0008799 | 3300048911 | Bacteria | 8183 |
| 644 | Ga0496108_0018420 | 3300048911 | Bacteria | 5716 |
| 645 | Ga0496108_0027222 | 3300048911 | Bacteria | 4719 |
| 646 | Ga0496108_0060849 | 3300048911 | Bacteria | 3177 |
| 647 | Ga0496108_0070779 | 3300048911 | Bacteria | 2943 |
| 648 | Ga0496108_0078118 | 3300048911 | Bacteria | 2801 |
| 649 | Ga0496108_0146135 | 3300048911 | Bacteria | 2038 |
| 650 | Ga0496108_0282306 | 3300048911 | Bacteria | 1445 |
| 651 | Ga0496109_0011362 | 3300048912 | Bacteria | 7649 |
| 652 | Ga0496109_0012989 | 3300048912 | Bacteria | 7199 |
| 653 | Ga0496109_0024722 | 3300048912 | Bacteria | 5343 |
| 654 | Ga0496109_0030093 | 3300048912 | Bacteria | 4866 |
| 655 | Ga0496109_0066929 | 3300048912 | Bacteria | 3290 |
| 656 | Ga0496109_0117797 | 3300048912 | Bacteria | 2472 |
| 657 | Ga0496109_0182760 | 3300048912 | Bacteria | 1970 |
| 658 | Ga0496109_0247836 | 3300048912 | Bacteria | 1677 |
| 659 | Ga0496109_0306645 | 3300048912 | Bacteria | 1497 |
| 660 | Ga0496109_0447967 | 3300048912 | Bacteria | 1219 |
| 661 | Ga0496110_0004608 | 3300048913 | Bacteria | 10709 |
| 662 | Ga0496110_0005747 | 3300048913 | Bacteria | 9742 |
| 663 | Ga0496110_0020620 | 3300048913 | Bacteria | 5568 |
| 664 | Ga0496110_0102065 | 3300048913 | Bacteria | 2572 |
| 665 | Ga0496110_0404227 | 3300048913 | Bacteria | 1245 |
| 666 | Ga0496110_0635825 | 3300048913 | Bacteria | 966 |
| 667 | Ga0496110_0793374 | 3300048913 | Bacteria | 851 |
| 668 | Ga0496111_0000325 | 3300048914 | Bacteria | 23677 |
| 669 | Ga0496111_0003813 | 3300048914 | Bacteria | 9404 |
| 670 | Ga0496111_0063311 | 3300048914 | Bacteria | 2682 |
| 671 | Ga0496111_0066701 | 3300048914 | Bacteria | 2614 |
| 672 | Ga0496111_0124230 | 3300048914 | Bacteria | 1907 |
| 673 | Ga0496111_0170804 | 3300048914 | Bacteria | 1616 |
| 674 | Ga0496112_0001450 | 3300048915 | Bacteria | 18215 |
| 675 | Ga0496112_0034343 | 3300048915 | Bacteria | 4935 |
| 676 | Ga0496112_0054742 | 3300048915 | Bacteria | 3921 |
| 677 | Ga0496112_0133298 | 3300048915 | Bacteria | 2455 |
| 678 | Ga0496112_0214900 | 3300048915 | Bacteria | 1879 |
| 679 | Ga0496113_0005157 | 3300048916 | Bacteria | 8125 |
| 680 | Ga0496113_0005296 | 3300048916 | Bacteria | 8030 |
| 681 | Ga0496113_0098110 | 3300048916 | Bacteria | 2267 |
| 682 | Ga0496113_0218826 | 3300048916 | Bacteria | 1517 |
| 683 | Ga0496113_0470822 | 3300048916 | Bacteria | 1009 |
| 684 | Ga0496114_0008937 | 3300048917 | Bacteria | 7942 |
| 685 | Ga0496114_0026925 | 3300048917 | Bacteria | 4710 |
| 686 | Ga0496114_0029918 | 3300048917 | Bacteria | 4478 |
| 687 | Ga0496114_0034455 | 3300048917 | Bacteria | 4178 |
| 688 | Ga0496114_0041420 | 3300048917 | Bacteria | 3817 |
| 689 | Ga0496114_0048477 | 3300048917 | Bacteria | 3533 |
| 690 | Ga0496114_0074846 | 3300048917 | Bacteria | 2851 |
| 691 | Ga0496114_0088957 | 3300048917 | Bacteria | 2620 |
| 692 | Ga0496114_0095973 | 3300048917 | Bacteria | 2523 |
| 693 | Ga0496114_0173152 | 3300048917 | Bacteria | 1882 |
| 694 | Ga0496114_0191998 | 3300048917 | Bacteria | 1787 |
| 695 | Ga0496114_0216050 | 3300048917 | Bacteria | 1682 |
| 696 | Ga0496114_0220247 | 3300048917 | Bacteria | 1666 |
| 697 | Ga0496114_0800114 | 3300048917 | Bacteria | 821 |
| 698 | Ga0496115_0068503 | 3300048918 | Bacteria | 2873 |
| 699 | Ga0496115_0074222 | 3300048918 | Bacteria | 2761 |
| 700 | Ga0496115_0164385 | 3300048918 | Bacteria | 1835 |
| 701 | Ga0496115_0324720 | 3300048918 | Bacteria | 1258 |
| 702 | Ga0501031_0009177 | 3300049568 | Bacteria | 6429 |
| 703 | Ga0501031_0014338 | 3300049568 | Bacteria | 5153 |
| 704 | Ga0501031_0061433 | 3300049568 | Bacteria | 2448 |
| 705 | Ga0501032_0009030 | 3300049569 | Bacteria | 7244 |
| 706 | Ga0501032_0048642 | 3300049569 | Bacteria | 2863 |
| 707 | Ga0501032_0118592 | 3300049569 | Bacteria | 1750 |
| 708 | Ga0501033_0001810 | 3300049570 | Bacteria | 18675 |
| 709 | Ga0501034_0130633 | 3300049571 | Bacteria | 2495 |
| 710 | Ga0501034_1508767 | 3300049571 | Bacteria | 546 |
| 711 | Ga0501036_0001257 | 3300049572 | Bacteria | 19426 |
| 712 | Ga0501036_0003912 | 3300049572 | Bacteria | 11958 |
| 713 | Ga0501036_0229137 | 3300049572 | Bacteria | 1559 |
| 714 | Ga0501037_0005892 | 3300049573 | Bacteria | 8954 |
| 715 | Ga0501037_0059367 | 3300049573 | Bacteria | 2791 |
| 716 | Ga0501037_0060344 | 3300049573 | Bacteria | 2766 |
| 717 | Ga0501038_0001658 | 3300049574 | Bacteria | 20668 |
| 718 | Ga0501038_0024821 | 3300049574 | Bacteria | 5344 |
| 719 | Ga0501039_0000858 | 3300049575 | Bacteria | 21993 |
| 720 | Ga0501039_0004240 | 3300049575 | Bacteria | 10794 |
| 721 | Ga0501039_0031095 | 3300049575 | Bacteria | 4115 |
| 722 | Ga0501040_0003557 | 3300049576 | Bacteria | 10072 |
| 723 | Ga0501040_0014210 | 3300049576 | Bacteria | 5242 |
| 724 | Ga0501040_0041638 | 3300049576 | Bacteria | 3128 |
| 725 | Ga0501041_0005591 | 3300049577 | Bacteria | 7351 |
| 726 | Ga0501041_0029322 | 3300049577 | Bacteria | 3319 |
| 727 | Ga0501042_0001029 | 3300049578 | Bacteria | 15887 |
| 728 | Ga0501042_0003885 | 3300049578 | Bacteria | 9448 |
| 729 | Ga0501042_0032808 | 3300049578 | Bacteria | 3678 |
| 730 | Ga0501043_0052525 | 3300049579 | Bacteria | 3200 |
| 731 | Ga0501043_0115687 | 3300049579 | Bacteria | 2105 |
| 732 | Ga0501043_0420560 | 3300049579 | Bacteria | 1007 |
| 733 | Ga0501046_0005646 | 3300049580 | Bacteria | 11167 |
| 734 | Ga0501046_0009235 | 3300049580 | Bacteria | 8536 |
| 735 | Ga0501046_0022188 | 3300049580 | Bacteria | 5231 |
| 736 | Ga0501047_0813989 | 3300049581 | Bacteria | 749 |
| 737 | Ga0501048_0004941 | 3300049582 | Bacteria | 10170 |
| 738 | Ga0501048_0036201 | 3300049582 | Bacteria | 3548 |
| 739 | Ga0501067_0000073 | 3300049583 | Bacteria | 57130 |
| 740 | Ga0501068_0001291 | 3300049584 | Bacteria | 13289 |
| 741 | Ga0501068_0014638 | 3300049584 | Bacteria | 4490 |
| 742 | Ga0501068_0032040 | 3300049584 | Bacteria | 3124 |
| 743 | Ga0501069_0001022 | 3300049585 | Bacteria | 13346 |
| 744 | Ga0501069_0019455 | 3300049585 | Bacteria | 3672 |
| 745 | Ga0501069_0067601 | 3300049585 | Bacteria | 1999 |
| 746 | Ga0501069_0159672 | 3300049585 | Bacteria | 1298 |
| 747 | Ga0501070_0003884 | 3300049586 | Bacteria | 12890 |
| 748 | Ga0501070_0217631 | 3300049586 | Bacteria | 1567 |
| 749 | Ga0501070_0874659 | 3300049586 | Bacteria | 702 |
| 750 | Ga0501071_0000784 | 3300049587 | Bacteria | 16918 |
| 751 | Ga0501071_0005748 | 3300049587 | Bacteria | 8001 |
| 752 | Ga0501071_0056224 | 3300049587 | Bacteria | 2841 |
| 753 | Ga0501071_0112798 | 3300049587 | Bacteria | 2010 |
| 754 | Ga0501071_0231922 | 3300049587 | Bacteria | 1391 |
| 755 | Ga0501072_0000359 | 3300049588 | Bacteria | 32479 |
| 756 | Ga0501072_0018332 | 3300049588 | Bacteria | 5387 |
| 757 | Ga0501072_0061610 | 3300049588 | Bacteria | 2959 |
| 758 | Ga0501072_0096438 | 3300049588 | Bacteria | 2350 |
| 759 | Ga0501072_0126555 | 3300049588 | Bacteria | 2036 |
| 760 | Ga0501073_0012982 | 3300049589 | Bacteria | 6072 |
| 761 | Ga0501073_0134387 | 3300049589 | Bacteria | 1714 |
| 762 | Ga0501074_0003093 | 3300049590 | Bacteria | 11736 |
| 763 | Ga0501074_0004076 | 3300049590 | Bacteria | 10426 |
| 764 | Ga0501074_0020238 | 3300049590 | Bacteria | 4835 |
| 765 | Ga0501075_0002975 | 3300049591 | Bacteria | 11334 |
| 766 | Ga0501075_0011404 | 3300049591 | Bacteria | 6289 |
| 767 | Ga0501075_0012874 | 3300049591 | Bacteria | 5956 |
| 768 | Ga0501075_0650439 | 3300049591 | Bacteria | 804 |
| 769 | Ga0501076_0004387 | 3300049592 | Bacteria | 10024 |
| 770 | Ga0501076_0008210 | 3300049592 | Bacteria | 7648 |
| 771 | Ga0501077_0002413 | 3300049593 | Bacteria | 11222 |
| 772 | Ga0501077_0029104 | 3300049593 | Bacteria | 3511 |
| 773 | Ga0501077_0265616 | 3300049593 | Bacteria | 1091 |
| 774 | Ga0501077_0630031 | 3300049593 | Bacteria | 689 |
| 775 | Ga0501079_0009737 | 3300049741 | Bacteria | 7289 |
| 776 | Ga0501079_0032069 | 3300049741 | Bacteria | 4038 |
| 777 | Ga0501079_0106173 | 3300049741 | Bacteria | 2179 |
| 778 | Ga0501080_0004837 | 3300049742 | Bacteria | 12009 |
| 779 | Ga0501080_0043934 | 3300049742 | Bacteria | 4160 |
| 780 | Ga0501081_0001589 | 3300049743 | Bacteria | 14003 |
| 781 | Ga0501081_0010005 | 3300049743 | Bacteria | 6184 |
| 782 | Ga0501081_0026203 | 3300049743 | Bacteria | 3929 |
| 783 | Ga0501083_0004922 | 3300049744 | Bacteria | 9451 |
| 784 | Ga0501035_0041155 | 3300049822 | Bacteria | 4173 |
| 785 | Ga0501035_0263061 | 3300049822 | Bacteria | 1462 |
| 786 | Ga0501044_0080871 | 3300049823 | Bacteria | 3290 |
| 787 | Ga0501044_0085431 | 3300049823 | Bacteria | 3189 |
| 788 | Ga0501045_0009611 | 3300049824 | Bacteria | 6769 |
| 789 | Ga0501045_0037241 | 3300049824 | Bacteria | 3535 |
| 790 | Ga0501045_0108386 | 3300049824 | Bacteria | 2058 |
| 791 | nmdc:mga04h51_195379_c1 | 3300050495 | Bacteria | 793 |
| 792 | nmdc:mga08y16_431995_c1 | 3300050511 | Bacteria | 1345 |
| 793 | nmdc:mga08y16_478691_c1 | 3300050511 | Bacteria | 1267 |
| 794 | nmdc:mga08y16_708287_c1 | 3300050511 | Bacteria | 1006 |
| 795 | nmdc:mga0n895_12793_c1 | 3300050512 | Bacteria | 7537 |
| 796 | nmdc:mga0n895_47003_c1 | 3300050512 | Bacteria | 4219 |
| 797 | nmdc:mga0rr50_20791_c1 | 3300050513 | Bacteria | 4466 |
| 798 | nmdc:mga0rr50_370218_c1 | 3300050513 | Bacteria | 1207 |
| 799 | nmdc:mga08x19_41772_c1 | 3300050514 | Bacteria | 2921 |
| 800 | Ga0495601_0000626 | 3300053077 | Bacteria | 18860 |
| 801 | Ga0495601_0004479 | 3300053077 | Bacteria | 8075 |
| 802 | Ga0495601_0009387 | 3300053077 | Bacteria | 5786 |
| 803 | Ga0495601_0027268 | 3300053077 | Bacteria | 3531 |
| 804 | Ga0495601_0031372 | 3300053077 | Bacteria | 3302 |
| 805 | Ga0495601_0155059 | 3300053077 | Bacteria | 1495 |
| 806 | Ga0495601_0274325 | 3300053077 | Bacteria | 1100 |
| 807 | Ga0495601_0630576 | 3300053077 | Bacteria | 686 |
| 808 | Ga0495612_0034806 | 3300053078 | Bacteria | 2040 |
| 809 | Ga0495612_0106214 | 3300053078 | Bacteria | 1199 |
| 810 | Ga0495612_0123508 | 3300053078 | Bacteria | 1115 |
| 811 | Ga0495595_0002577 | 3300053084 | Bacteria | 7108 |
| 812 | Ga0495595_0032914 | 3300053084 | Bacteria | 2336 |
| 813 | Ga0495595_0348725 | 3300053084 | Bacteria | 747 |
| 814 | Ga0495619_0004115 | 3300053085 | Bacteria | 9302 |
| 815 | Ga0495619_0005077 | 3300053085 | Bacteria | 8362 |
| 816 | Ga0495619_0083257 | 3300053085 | Bacteria | 2157 |
| 817 | Ga0495619_0121978 | 3300053085 | Bacteria | 1787 |
| 818 | Ga0495619_0268725 | 3300053085 | Bacteria | 1182 |
| 819 | Ga0495619_0680122 | 3300053085 | Bacteria | 700 |
| 820 | Ga0500566_0382996 | 3300053094 | Bacteria | 635 |
| 821 | Ga0501084_0002111 | 3300054114 | Bacteria | 15886 |
| 822 | Ga0501084_0003765 | 3300054114 | Bacteria | 12332 |
| 823 | Ga0501084_0087951 | 3300054114 | Bacteria | 2608 |
| 824 | Ga0501082_0002634 | 3300060353 | Bacteria | 15687 |
| 825 | Ga0501082_0003234 | 3300060353 | Bacteria | 14205 |
| 826 | Ga0501082_0039078 | 3300060353 | Bacteria | 4093 |
| 827 | Ga0466962_0008372 | 3300061719 | Bacteria | 4956 |
| 828 | Ga0530510_0021511 | 3300061734 | Bacteria | 4589 |
| 829 | Ga0530510_0024554 | 3300061734 | Bacteria | 4302 |
| 830 | Ga0530510_0564019 | 3300061734 | Bacteria | 865 |
| 831 | Ga0207706_10071805 | |||
| 832 | JGI24751J29686_10052527 | |||
| 833 | Ga0070658_10019697 | |||
| 834 | Ga0070683_100050631 | |||
| 835 | Ga0070683_100533832 | |||
| 836 | Ga0070690_100057382 | |||
| 837 | Ga0070690_100204498 | |||
| 838 | Ga0070666_10446498 | |||
| 839 | Ga0070666_10589198 | |||
| 840 | Ga0070680_100030592 | |||
| 841 | Ga0070682_100060298 | |||
| 842 | Ga0070682_100094265 | |||
| 843 | Ga0070682_100121684 | |||
| 844 | Ga0068868_100014878 | |||
| 845 | Ga0068868_100070695 | |||
| 846 | Ga0068868_100436961 | |||
| 847 | Ga0070660_100045555 | |||
| 848 | Ga0070660_100072052 | |||
| 849 | Ga0070660_100417719 | |||
| 850 | Ga0070689_100326559 | |||
| 851 | Ga0070691_10049409 | |||
| 852 | Ga0070691_10092900 | |||
| 853 | Ga0070691_10133890 | |||
| 854 | Ga0070687_100061854 | |||
| 855 | Ga0070687_100203635 | |||
| 856 | Ga0070661_100141021 | |||
| 857 | Ga0070661_100236970 | |||
| 858 | Ga0070692_10040334 | |||
| 859 | Ga0070668_100259546 | |||
| 860 | Ga0070674_100172250 | |||
| 861 | Ga0070673_100336345 | |||
| 862 | Ga0070688_100080236 | |||
| 863 | Ga0070688_100137421 | |||
| 864 | Ga0070688_100417502 | |||
| 865 | Ga0070659_100026977 | |||
| 866 | Ga0070659_100080744 | |||
| 867 | Ga0070659_100083392 | |||
| 868 | Ga0070659_100126831 | |||
| 869 | Ga0070659_100453025 | |||
| 870 | Ga0070667_100157099 | |||
| 871 | Ga0070667_100479060 | |||
| 872 | Ga0070709_10631335 | |||
| 873 | Ga0070714_100015377 | |||
| 874 | Ga0070714_100030056 | |||
| 875 | Ga0070714_100045883 | |||
| 876 | Ga0070714_100076915 | |||
| 877 | Ga0070714_100181521 | |||
| 878 | Ga0070714_100255330 | |||
| 879 | Ga0070714_100341402 | |||
| 880 | Ga0070713_100036244 | |||
| 881 | Ga0070713_100262556 | |||
| 882 | Ga0070713_100871942 | |||
| 883 | Ga0070713_101050562 | |||
| 884 | Ga0070710_10050315 | |||
| 885 | Ga0070710_10075013 | |||
| 886 | Ga0070710_10103895 | |||
| 887 | Ga0070701_10230257 | |||
| 888 | Ga0070711_100121906 | |||
| 889 | Ga0070711_100153455 | |||
| 890 | Ga0070711_100421600 | |||
| 891 | Ga0070705_100456571 | |||
| 892 | Ga0070700_100023358 | |||
| 893 | Ga0070694_100109858 | |||
| 894 | Ga0070694_100425463 | |||
| 895 | Ga0070708_100947053 | |||
| 896 | Ga0070678_100419961 | |||
| 897 | Ga0070662_100383012 | |||
| 898 | Ga0070681_10276823 | |||
| 899 | Ga0070681_10289966 | |||
| 900 | Ga0068867_100926546 | |||
| 901 | Ga0070679_100326084 | |||
| 902 | Ga0070684_100000711 | |||
| 903 | Ga0070684_100046988 | |||
| 904 | Ga0070684_100189522 | |||
| 905 | Ga0070684_100620945 | |||
| 906 | Ga0068853_100252684 | |||
| 907 | Ga0068853_100571871 | |||
| 908 | Ga0070672_100463871 | |||
| 909 | Ga0070672_100569436 | |||
| 910 | Ga0070686_100028012 | |||
| 911 | Ga0070686_100086716 | |||
| 912 | Ga0070686_101109041 | |||
| 913 | Ga0070695_100117530 | |||
| 914 | Ga0070696_100009944 | |||
| 915 | Ga0070696_100269168 | |||
| 916 | Ga0070693_100043299 | |||
| 917 | Ga0070693_100182862 | |||
| 918 | Ga0070665_100176088 | |||
| 919 | Ga0070704_100570930 | |||
| 920 | Ga0068855_100086346 | |||
| 921 | Ga0068855_100206577 | |||
| 922 | Ga0068855_101302663 | |||
| 923 | Ga0070664_100210903 | |||
| 924 | Ga0068857_100000826 | |||
| 925 | Ga0068854_100125811 | |||
| 926 | Ga0068856_100097178 | |||
| 927 | Ga0068856_100145087 | |||
| 928 | Ga0068856_100343611 | |||
| 929 | Ga0070702_100011197 | |||
| 930 | Ga0070702_100116189 | |||
| 931 | Ga0070702_100589137 | |||
| 932 | Ga0068852_100023900 | |||
| 933 | Ga0068852_100092729 | |||
| 934 | Ga0068859_100363338 | |||
| 935 | Ga0068864_100177596 | |||
| 936 | Ga0068864_100193675 | |||
| 937 | Ga0068864_100576596 | |||
| 938 | Ga0068866_10139716 | |||
| 939 | Ga0068851_10240822 | |||
| 940 | Ga0068870_10121953 | |||
| 941 | Ga0068863_100274218 | |||
| 942 | Ga0068863_100607551 | |||
| 943 | Ga0068858_100040334 | |||
| 944 | Ga0068860_100097088 | |||
| 945 | Ga0081455_10005720 | |||
| 946 | Ga0081539_10094969 | |||
| 947 | Ga0070717_10044362 | |||
| 948 | Ga0070717_10049655 | |||
| 949 | Ga0070717_10098352 | |||
| 950 | Ga0075368_10223971 | |||
| 951 | Ga0070715_10002122 | |||
| 952 | Ga0070715_10025097 | |||
| 953 | Ga0070716_100007976 | |||
| 954 | Ga0070716_100081391 | |||
| 955 | Ga0070716_100213334 | |||
| 956 | Ga0070712_100006301 | |||
| 957 | Ga0070712_100043043 | |||
| 958 | Ga0070712_100050350 | |||
| 959 | Ga0070712_100276668 | |||
| 960 | Ga0070712_100307628 | |||
| 961 | Ga0097621_100217200 | |||
| 962 | Ga0097621_100258832 | |||
| 963 | Ga0068871_100183159 | |||
| 964 | Ga0075433_10152453 | |||
| 965 | Ga0075434_100000288 | |||
| 966 | Ga0075434_100000835 | |||
| 967 | Ga0068865_100235331 | |||
| 968 | Ga0068865_100687808 | |||
| 969 | Ga0075436_100057620 | |||
| 970 | Ga0097620_100363348 | |||
| 971 | Ga0075435_100238217 | |||
| 972 | Ga0075435_100303935 | |||
| 973 | Ga0111539_10242456 | |||
| 974 | Ga0105245_10038700 | |||
| 975 | Ga0105245_10082528 | |||
| 976 | Ga0105245_10159386 | |||
| 977 | Ga0105245_10699292 | |||
| 978 | Ga0105247_10021640 | |||
| 979 | Ga0105247_10079909 | |||
| 980 | Ga0105247_10114629 | |||
| 981 | Ga0105243_10016466 | |||
| 982 | Ga0105243_10059911 | |||
| 983 | Ga0105243_10122078 | |||
| 984 | Ga0105243_10233965 | |||
| 985 | Ga0105241_10015941 | |||
| 986 | Ga0105241_10077338 | |||
| 987 | Ga0105241_11154247 | |||
| 988 | Ga0105242_10016697 | |||
| 989 | Ga0105242_10050569 | |||
| 990 | Ga0105242_10175219 | |||
| 991 | Ga0105242_10366386 | |||
| 992 | Ga0105242_10644962 | |||
| 993 | Ga0105248_10118282 | |||
| 994 | Ga0105248_10135691 | |||
| 995 | Ga0105248_10594039 | |||
| 996 | Ga0105237_10112463 | |||
| 997 | Ga0105237_10520954 | |||
| 998 | Ga0105238_10029442 | |||
| 999 | Ga0105238_10038679 | |||
| 1000 | Ga0105238_10046200 | |||
| 1001 | Ga0105249_10064066 | |||
| 1002 | Ga0105249_10391254 | |||
| 1003 | Ga0105239_10018480 | |||
| 1004 | Ga0105239_10242940 | |||
| 1005 | Ga0105239_10280757 | |||
| 1006 | Ga0105246_10024988 | |||
| 1007 | Ga0105246_10031525 | |||
| 1008 | Ga0105246_10060350 | |||
| 1009 | Ga0105246_10126949 | |||
| 1010 | Ga0157369_10006129 | |||
| 1011 | Ga0157369_10185935 | |||
| 1012 | Ga0157369_10358476 | |||
| 1013 | Ga0157374_10047814 | |||
| 1014 | Ga0157378_10111048 | |||
| 1015 | Ga0157378_10892325 | |||
| 1016 | Ga0163162_10070208 | |||
| 1017 | Ga0163162_10070822 | |||
| 1018 | Ga0163162_10746676 | |||
| 1019 | Ga0157372_10009702 | |||
| 1020 | Ga0157372_10094023 | |||
| 1021 | Ga0157375_10066456 | |||
| 1022 | Ga0157375_10074921 | |||
| 1023 | Ga0157375_10226619 | |||
| 1024 | Ga0157375_10254135 | |||
| 1025 | Ga0157375_10962733 | |||
| 1026 | Ga0163163_10427972 | |||
| 1027 | Ga0157380_10874382 | |||
| 1028 | Ga0182008_10332498 | |||
| 1029 | Ga0157377_10004033 | |||
| 1030 | Ga0157377_10167523 | |||
| 1031 | Ga0157377_10181017 | |||
| 1032 | Ga0157379_10170569 | |||
| 1033 | Ga0157376_10045675 | |||
| 1034 | Ga0157376_10108326 | |||
| 1035 | Ga0163161_10098715 | |||
| 1036 | Ga0206356_10442982 | |||
| 1037 | Ga0206350_11205423 | |||
| 1038 | Ga0206354_10083614 | |||
| 1039 | Ga0206353_10406373 | |||
| 1040 | Ga0224572_1028317 | |||
| 1041 | Ga0207656_10203187 | |||
| 1042 | Ga0207692_10031939 | |||
| 1043 | Ga0207692_10036394 | |||
| 1044 | Ga0207692_10683122 | |||
| 1045 | Ga0207710_10065052 | |||
| 1046 | Ga0207688_10008115 | |||
| 1047 | Ga0207685_10018551 | |||
| 1048 | Ga0207685_10137038 | |||
| 1049 | Ga0207699_10246608 | |||
| 1050 | Ga0207643_10167051 | |||
| 1051 | Ga0207705_10067037 | |||
| 1052 | Ga0207705_11058418 | |||
| 1053 | Ga0207654_10116816 | |||
| 1054 | Ga0207654_10283163 | |||
| 1055 | Ga0207707_10063666 | |||
| 1056 | Ga0207707_10174074 | |||
| 1057 | Ga0207707_10346726 | |||
| 1058 | Ga0207707_10354280 | |||
| 1059 | Ga0207695_10639341 | |||
| 1060 | Ga0207695_10952515 | |||
| 1061 | Ga0207693_10000699 | |||
| 1062 | Ga0207693_10019664 | |||
| 1063 | Ga0207693_10039506 | |||
| 1064 | Ga0207693_10146778 | |||
| 1065 | Ga0207693_10193754 | |||
| 1066 | Ga0207693_10560112 | |||
| 1067 | Ga0207663_10012215 | |||
| 1068 | Ga0207663_10038971 | |||
| 1069 | Ga0207663_10102947 | |||
| 1070 | Ga0207663_10203507 | |||
| 1071 | Ga0207660_10021568 | |||
| 1072 | Ga0207662_10181143 | |||
| 1073 | Ga0207657_10007767 | |||
| 1074 | Ga0207657_10008585 | |||
| 1075 | Ga0207657_10072730 | |||
| 1076 | Ga0207657_10303564 | |||
| 1077 | Ga0207649_10134993 | |||
| 1078 | Ga0207649_10305385 | |||
| 1079 | Ga0207652_10302195 | |||
| 1080 | Ga0207646_10452268 | |||
| 1081 | Ga0207694_10004311 | |||
| 1082 | Ga0207659_10306727 | |||
| 1083 | Ga0207687_10005354 | |||
| 1084 | Ga0207687_10046316 | |||
| 1085 | Ga0207687_10049026 | |||
| 1086 | Ga0207687_10266307 | |||
| 1087 | Ga0207700_10096997 | |||
| 1088 | Ga0207700_10111732 | |||
| 1089 | Ga0207700_10254380 | |||
| 1090 | Ga0207700_10425781 | |||
| 1091 | Ga0207664_10011651 | |||
| 1092 | Ga0207664_10020004 | |||
| 1093 | Ga0207664_10030170 | |||
| 1094 | Ga0207664_10090927 | |||
| 1095 | Ga0207664_10127933 | |||
| 1096 | Ga0207664_10179334 | |||
| 1097 | Ga0207664_10328056 | |||
| 1098 | Ga0207664_10378923 | |||
| 1099 | Ga0207664_10582789 | |||
| 1100 | Ga0207690_10025425 | |||
| 1101 | Ga0207690_10037988 | |||
| 1102 | Ga0207706_10533734 | |||
| 1103 | Ga0207686_10041205 | |||
| 1104 | Ga0207686_10046847 | |||
| 1105 | Ga0207686_10175510 | |||
| 1106 | Ga0207686_10282212 | |||
| 1107 | Ga0207686_10380662 | |||
| 1108 | Ga0207686_10581824 | |||
| 1109 | Ga0207709_10071043 | |||
| 1110 | Ga0207709_10171340 | |||
| 1111 | Ga0207670_10356704 | |||
| 1112 | Ga0207670_10528490 | |||
| 1113 | Ga0207669_10472310 | |||
| 1114 | Ga0207665_10005937 | |||
| 1115 | Ga0207665_10015367 | |||
| 1116 | Ga0207665_10059704 | |||
| 1117 | Ga0207665_10072589 | |||
| 1118 | Ga0207691_10346809 | |||
| 1119 | Ga0207711_10082144 | |||
| 1120 | Ga0207711_10083387 | |||
| 1121 | Ga0207689_10146746 | |||
| 1122 | Ga0207661_10000356 | |||
| 1123 | Ga0207661_10052373 | |||
| 1124 | Ga0207661_10443576 | |||
| 1125 | Ga0207679_10168776 | |||
| 1126 | Ga0207667_10024321 | |||
| 1127 | Ga0207667_10197121 | |||
| 1128 | Ga0207651_10655182 | |||
| 1129 | Ga0207712_10694195 | |||
| 1130 | Ga0207668_10028464 | |||
| 1131 | Ga0207640_10387493 | |||
| 1132 | Ga0207658_10138297 | |||
| 1133 | Ga0207658_10398148 | |||
| 1134 | Ga0207658_10437636 | |||
| 1135 | Ga0207677_10301829 | |||
| 1136 | Ga0207677_10493563 | |||
| 1137 | Ga0207703_10025981 | |||
| 1138 | Ga0207703_10612188 | |||
| 1139 | Ga0207639_10247764 | |||
| 1140 | Ga0207639_10367884 | |||
| 1141 | Ga0207708_10002912 | |||
| 1142 | Ga0207702_10033656 | |||
| 1143 | Ga0207702_10132902 | |||
| 1144 | Ga0207702_10233230 | |||
| 1145 | Ga0207641_10264028 | |||
| 1146 | Ga0207641_10909257 | |||
| 1147 | Ga0207648_10085529 | |||
| 1148 | Ga0207648_10152869 | |||
| 1149 | Ga0207676_10171203 | |||
| 1150 | Ga0207674_10001737 | |||
| 1151 | Ga0207674_10080902 | |||
| 1152 | Ga0207674_11267847 | |||
| 1153 | Ga0207675_100177952 | |||
| 1154 | Ga0207683_10374631 | |||
| 1155 | Ga0207698_10154402 | |||
| 1156 | Ga0207698_10233409 | |||
| 1157 | Ga0207428_10662860 | |||
| 1158 | Ga0268266_10126001 | |||
| 1159 | Ga0268265_10730780 | |||
| 1160 | Ga0268264_10112709 | |||
| 1161 | Ga0265318_10005179 | |||
| 1162 | Ga0265318_10092440 | |||
| 1163 | Ga0265336_10056728 | |||
| 1164 | Ga0265338_10022368 | |||
| 1165 | Ga0265338_10100995 | |||
| 1166 | Ga0265320_10077003 | |||
| 1167 | Ga0265320_10361707 | |||
| 1168 | Ga0265327_10005540 | |||
| 1169 | Ga0307408_100101784 | |||
| 1170 | Ga0265314_10430199 | |||
| 1171 | Ga0316576_10207766 | |||
| 1172 | Ga0307405_10018083 | |||
| 1173 | Ga0307413_10076094 | |||
| 1174 | Ga0307406_10569327 | |||
| 1175 | Ga0307407_10105726 | |||
| 1176 | Ga0307412_10218851 | |||
| 1177 | Ga0307416_100024690 | |||
| 1178 | Ga0307411_10347681 | |||
| 1179 | Ga0307415_100105236 | |||
| 1180 | Ga0373958_0029522 | |||
| 1181 | Ga0373959_0024036 | |||
| 1182 | Ga0373928_0132971 | |||
| 1183 | Ga0373934_0078999 | |||
| 1184 | Ga0373944_0033975 | |||
| 1185 | Ga0373949_0093201 | |||
| 1186 | Ga0373952_0118189 | |||
| 1187 | Ga0373923_0054112 | |||
| 1188 | Ga0373945_0003651 | |||
| 1189 | Ga0373956_0032374 | |||
| 1190 | Ga0373956_0034811 | |||
| 1191 | Ga0373943_0002533 | |||
| 1192 | Ga0373943_0002822 | |||
| 1193 | Ga0373943_0122817 | |||
| 1194 | Ga0373946_0019737 | |||
| 1195 | Ga0373946_0041631 | |||
| 1196 | Ga0373955_0014885 | |||
| 1197 | Ga0373942_0176103 | |||
| 1198 | Ga0373962_0043449 | |||
| 1199 | Ga0373924_0203602 | |||
| 1200 | Ga0373935_0005827 | |||
| 1201 | Ga0373927_0301482 | |||
| 1202 | Ga0373933_0009253 | |||
| 1203 | Ga0373933_0271627 | |||
| 1204 | Ga0373947_0002551 | |||
| 1205 | Ga0373947_0003342 | |||
| 1206 | Ga0373947_0050882 | |||
| 1207 | Ga0373947_0125632 | |||
| 1208 | Ga0373947_0255559 | |||
| 1209 | Ga0373937_0016053 | |||
| 1210 | Ga0373937_0241893 | |||
| 1211 | Ga0373937_0263344 | |||
| 1212 | Ga0373937_1060630 | |||
| 1213 | Ga0373925_0002657 | |||
| 1214 | Ga0373925_0002831 | |||
| 1215 | Ga0316581_0124895 | |||
| 1216 | Ga0436365_1554552 | |||
| 1217 | Ga0436360_0625251 | |||
| 1218 | Ga0436362_0906223 | |||
| 1219 | Ga0436362_1029002 | |||
| 1220 | Ga0451837_0843915 | |||
| 1221 | Ga0450923_048650 | |||
| 1222 | Ga0439444_0032705 | |||
| 1223 | Ga0466969_0000256 | |||
| 1224 | Ga0466969_0090012 | |||
| 1225 | Ga0466965_0118278 | |||
| 1226 | Ga0466966_0267654 | |||
| 1227 | Ga0466961_0004860 | |||
| 1228 | Ga0466961_0024643 | |||
| 1229 | Ga0466963_0000010 | |||
| 1230 | Ga0466963_0000729 | |||
| 1231 | Ga0466963_0000923 | |||
| 1232 | Ga0466963_0030090 | |||
| 1233 | Ga0466963_0045083 | |||
| 1234 | Ga0466963_0070894 | |||
| 1235 | Ga0466963_0105940 | |||
| 1236 | Ga0466963_0113070 | |||
| 1237 | Ga0466964_0004448 | |||
| 1238 | Ga0466964_0013913 | |||
| 1239 | Ga0466964_0029938 | |||
| 1240 | Ga0466964_0032653 | |||
| 1241 | Ga0466971_0001870 | |||
| 1242 | Ga0466971_0023374 | |||
| 1243 | Ga0466968_0101901 | |||
| 1244 | Ga0466968_0203363 | |||
| 1245 | Ga0466957_0003847 | |||
| 1246 | Ga0466957_0008939 | |||
| 1247 | Ga0466957_0009784 | |||
| 1248 | Ga0466957_0017342 | |||
| 1249 | Ga0466957_0162417 | |||
| 1250 | Ga0466960_0051885 | |||
| 1251 | Ga0466959_0034480 | |||
| 1252 | Ga0466959_0037080 | |||
| 1253 | Ga0466959_0156221 | |||
| 1254 | Ga0466958_0016966 | |||
| 1255 | Ga0466958_0017005 | |||
| 1256 | Ga0466958_0043921 | |||
| 1257 | Ga0466958_0068360 | |||
| 1258 | Ga0466958_0158818 | |||
| 1259 | Ga0466967_0000714 | |||
| 1260 | Ga0466967_0001587 | |||
| 1261 | Ga0466967_0006509 | |||
| 1262 | Ga0466967_0009326 | |||
| 1263 | Ga0466967_0014002 | |||
| 1264 | Ga0466967_0031130 | |||
| 1265 | Ga0466967_0034213 | |||
| 1266 | Ga0466967_0047329 | |||
| 1267 | Ga0466967_0115837 | |||
| 1268 | Ga0466967_0138682 | |||
| 1269 | Ga0466967_0217653 | |||
| 1270 | Ga0495592_0000123 | |||
| 1271 | Ga0495592_0030159 | |||
| 1272 | Ga0495592_0107394 | |||
| 1273 | Ga0495592_0146462 | |||
| 1274 | Ga0495592_0205597 | |||
| 1275 | Ga0495592_0411989 | |||
| 1276 | Ga0495603_0010950 | |||
| 1277 | Ga0495603_0032069 | |||
| 1278 | Ga0495603_0101372 | |||
| 1279 | Ga0495603_0119915 | |||
| 1280 | Ga0495629_0000994 | |||
| 1281 | Ga0495629_0009028 | |||
| 1282 | Ga0495629_0018064 | |||
| 1283 | Ga0495629_0020910 | |||
| 1284 | Ga0495641_0000793 | |||
| 1285 | Ga0495641_0035515 | |||
| 1286 | Ga0495641_0053393 | |||
| 1287 | Ga0495641_0258530 | |||
| 1288 | Ga0495651_0000029 | |||
| 1289 | Ga0495651_0096308 | |||
| 1290 | Ga0495651_0496852 | |||
| 1291 | Ga0495653_0027988 | |||
| 1292 | Ga0495653_0032669 | |||
| 1293 | Ga0495653_0051597 | |||
| 1294 | Ga0495653_0075091 | |||
| 1295 | Ga0495653_0428875 | |||
| 1296 | Ga0495582_0000121 | |||
| 1297 | Ga0495582_0003900 | |||
| 1298 | Ga0495582_0130182 | |||
| 1299 | Ga0495582_0180528 | |||
| 1300 | Ga0495582_0207459 | |||
| 1301 | Ga0495639_0001326 | |||
| 1302 | Ga0495639_0003851 | |||
| 1303 | Ga0495639_0128808 | |||
| 1304 | Ga0495662_0060400 | |||
| 1305 | Ga0495664_0077122 | |||
| 1306 | Ga0495594_0025678 | |||
| 1307 | Ga0495594_0046101 | |||
| 1308 | Ga0495594_0264945 | |||
| 1309 | Ga0495608_0010283 | |||
| 1310 | Ga0495608_0061017 | |||
| 1311 | Ga0495608_0115181 | |||
| 1312 | Ga0495608_0208543 | |||
| 1313 | Ga0495618_0009350 | |||
| 1314 | Ga0495618_0010759 | |||
| 1315 | Ga0495618_0109320 | |||
| 1316 | Ga0495618_0481744 | |||
| 1317 | Ga0495628_0000016 | |||
| 1318 | Ga0495628_0083154 | |||
| 1319 | Ga0495630_0001677 | |||
| 1320 | Ga0495630_0024209 | |||
| 1321 | Ga0495630_0390284 | |||
| 1322 | Ga0495630_0626008 | |||
| 1323 | Ga0495644_0132582 | |||
| 1324 | Ga0495666_0028479 | |||
| 1325 | Ga0495666_0214177 | |||
| 1326 | Ga0495652_0000045 | |||
| 1327 | Ga0495652_0040377 | |||
| 1328 | Ga0495652_0070137 | |||
| 1329 | Ga0495665_0002067 | |||
| 1330 | Ga0495665_0039796 | |||
| 1331 | Ga0495665_0302097 | |||
| 1332 | Ga0495640_0005309 | |||
| 1333 | Ga0495640_0066725 | |||
| 1334 | Ga0495640_0093669 | |||
| 1335 | Ga0495640_0175373 | |||
| 1336 | Ga0495640_0228979 | |||
| 1337 | Ga0495640_0501700 | |||
| 1338 | Ga0495586_0041599 | |||
| 1339 | Ga0495587_0000083 | |||
| 1340 | Ga0495587_0277296 | |||
| 1341 | Ga0495645_0000306 | |||
| 1342 | Ga0495645_0128732 | |||
| 1343 | Ga0495645_0305760 | |||
| 1344 | Ga0495645_0470175 | |||
| 1345 | Ga0495667_0039034 | |||
| 1346 | Ga0495667_0067366 | |||
| 1347 | Ga0495667_0440249 | |||
| 1348 | Ga0495634_0006358 | |||
| 1349 | Ga0495634_0018372 | |||
| 1350 | Ga0495634_0072146 | |||
| 1351 | Ga0495634_0246409 | |||
| 1352 | Ga0495634_0250170 | |||
| 1353 | Ga0495635_0006907 | |||
| 1354 | Ga0495635_0020295 | |||
| 1355 | Ga0495588_0061492 | |||
| 1356 | Ga0495657_0002001 | |||
| 1357 | Ga0495657_0003532 | |||
| 1358 | Ga0495657_0225292 | |||
| 1359 | Ga0495657_0278255 | |||
| 1360 | Ga0495599_0000219 | |||
| 1361 | Ga0495623_0000429 | |||
| 1362 | Ga0495623_0215777 | |||
| 1363 | Ga0495646_0136835 | |||
| 1364 | Ga0495647_0037351 | |||
| 1365 | Ga0495647_0097974 | |||
| 1366 | Ga0495647_0102486 | |||
| 1367 | Ga0495658_0000379 | |||
| 1368 | Ga0495658_0113939 | |||
| 1369 | Ga0495613_0005639 | |||
| 1370 | Ga0495613_0009778 | |||
| 1371 | Ga0495613_0019918 | |||
| 1372 | Ga0495613_0024508 | |||
| 1373 | Ga0495613_0143888 | |||
| 1374 | Ga0495624_0004263 | |||
| 1375 | Ga0495624_0011660 | |||
| 1376 | Ga0495600_0010768 | |||
| 1377 | Ga0495600_0120139 | |||
| 1378 | Ga0495600_0237676 | |||
| 1379 | Ga0495581_0002326 | |||
| 1380 | Ga0495581_0012125 | |||
| 1381 | Ga0495581_0087109 | |||
| 1382 | Ga0495604_0000072 | |||
| 1383 | Ga0495604_0057420 | |||
| 1384 | Ga0495604_0133193 | |||
| 1385 | Ga0495674_0013662 | |||
| 1386 | Ga0495674_0063132 | |||
| 1387 | Ga0495674_0120806 | |||
| 1388 | Ga0495674_0151397 | |||
| 1389 | Ga0495674_0225952 | |||
| 1390 | Ga0495674_0261355 | |||
| 1391 | Ga0495676_0002172 | |||
| 1392 | Ga0495676_0017184 | |||
| 1393 | Ga0495676_0107711 | |||
| 1394 | Ga0495676_0174317 | |||
| 1395 | Ga0495676_0181688 | |||
| 1396 | Ga0495680_0003161 | |||
| 1397 | Ga0495680_0023822 | |||
| 1398 | Ga0495680_0137220 | |||
| 1399 | Ga0495680_0210865 | |||
| 1400 | Ga0495680_0346809 | |||
| 1401 | Ga0495683_0128015 | |||
| 1402 | Ga0495675_0000031 | |||
| 1403 | Ga0495684_0005222 | |||
| 1404 | Ga0495684_0029400 | |||
| 1405 | Ga0495684_0071519 | |||
| 1406 | Ga0495684_0162643 | |||
| 1407 | Ga0495684_0199816 | |||
| 1408 | Ga0495593_0003514 | |||
| 1409 | Ga0495593_0063157 | |||
| 1410 | Ga0495593_0210521 | |||
| 1411 | Ga0495593_0231898 | |||
| 1412 | Ga0495602_0000133 | |||
| 1413 | Ga0495602_0353352 | |||
| 1414 | Ga0495614_0003819 | |||
| 1415 | Ga0495614_0008437 | |||
| 1416 | Ga0495614_0152314 | |||
| 1417 | Ga0496100_0012411 | |||
| 1418 | Ga0496100_0012593 | |||
| 1419 | Ga0496100_0052833 | |||
| 1420 | Ga0496100_0079734 | |||
| 1421 | Ga0496100_0095970 | |||
| 1422 | Ga0496100_0111529 | |||
| 1423 | Ga0496100_0340333 | |||
| 1424 | Ga0496100_0390935 | |||
| 1425 | Ga0496101_0015611 | |||
| 1426 | Ga0496101_0028111 | |||
| 1427 | Ga0496101_0033693 | |||
| 1428 | Ga0496101_0070970 | |||
| 1429 | Ga0496101_0188639 | |||
| 1430 | Ga0496101_0189561 | |||
| 1431 | Ga0496101_0353036 | |||
| 1432 | Ga0496102_0002804 | |||
| 1433 | Ga0496102_0021438 | |||
| 1434 | Ga0496102_0040384 | |||
| 1435 | Ga0496102_0296945 | |||
| 1436 | Ga0496102_1376979 | |||
| 1437 | Ga0496103_0008754 | |||
| 1438 | Ga0496103_0071379 | |||
| 1439 | Ga0496103_0181259 | |||
| 1440 | Ga0496104_0008696 | |||
| 1441 | Ga0496104_0043760 | |||
| 1442 | Ga0496104_0048689 | |||
| 1443 | Ga0496104_0053246 | |||
| 1444 | Ga0496104_0107364 | |||
| 1445 | Ga0496104_0253621 | |||
| 1446 | Ga0496104_0268810 | |||
| 1447 | Ga0496104_0361476 | |||
| 1448 | Ga0496104_0406775 | |||
| 1449 | Ga0496104_0778099 | |||
| 1450 | Ga0496105_0004361 | |||
| 1451 | Ga0496105_0016087 | |||
| 1452 | Ga0496105_0023623 | |||
| 1453 | Ga0496105_0047222 | |||
| 1454 | Ga0496105_0124219 | |||
| 1455 | Ga0496105_0176594 | |||
| 1456 | Ga0496105_0177556 | |||
| 1457 | Ga0496105_0285899 | |||
| 1458 | Ga0496106_0005959 | |||
| 1459 | Ga0496106_0055546 | |||
| 1460 | Ga0496106_0056152 | |||
| 1461 | Ga0496106_0359243 | |||
| 1462 | Ga0496106_0574854 | |||
| 1463 | Ga0496106_0711088 | |||
| 1464 | Ga0496107_0004476 | |||
| 1465 | Ga0496107_0016375 | |||
| 1466 | Ga0496107_0168776 | |||
| 1467 | Ga0496107_0173083 | |||
| 1468 | Ga0496107_0207543 | |||
| 1469 | Ga0496107_0340725 | |||
| 1470 | Ga0496107_0462652 | |||
| 1471 | Ga0496107_0670160 | |||
| 1472 | Ga0496108_0008186 | |||
| 1473 | Ga0496108_0008799 | |||
| 1474 | Ga0496108_0018420 | |||
| 1475 | Ga0496108_0027222 | |||
| 1476 | Ga0496108_0060849 | |||
| 1477 | Ga0496108_0070779 | |||
| 1478 | Ga0496108_0078118 | |||
| 1479 | Ga0496108_0146135 | |||
| 1480 | Ga0496108_0282306 | |||
| 1481 | Ga0496109_0011362 | |||
| 1482 | Ga0496109_0012989 | |||
| 1483 | Ga0496109_0024722 | |||
| 1484 | Ga0496109_0030093 | |||
| 1485 | Ga0496109_0066929 | |||
| 1486 | Ga0496109_0117797 | |||
| 1487 | Ga0496109_0182760 | |||
| 1488 | Ga0496109_0247836 | |||
| 1489 | Ga0496109_0306645 | |||
| 1490 | Ga0496109_0447967 | |||
| 1491 | Ga0496110_0004608 | |||
| 1492 | Ga0496110_0005747 | |||
| 1493 | Ga0496110_0020620 | |||
| 1494 | Ga0496110_0102065 | |||
| 1495 | Ga0496110_0404227 | |||
| 1496 | Ga0496110_0635825 | |||
| 1497 | Ga0496110_0793374 | |||
| 1498 | Ga0496111_0000325 | |||
| 1499 | Ga0496111_0003813 | |||
| 1500 | Ga0496111_0063311 | |||
| 1501 | Ga0496111_0066701 | |||
| 1502 | Ga0496111_0124230 | |||
| 1503 | Ga0496111_0170804 | |||
| 1504 | Ga0496112_0001450 | |||
| 1505 | Ga0496112_0034343 | |||
| 1506 | Ga0496112_0054742 | |||
| 1507 | Ga0496112_0133298 | |||
| 1508 | Ga0496112_0214900 | |||
| 1509 | Ga0496113_0005157 | |||
| 1510 | Ga0496113_0005296 | |||
| 1511 | Ga0496113_0098110 | |||
| 1512 | Ga0496113_0218826 | |||
| 1513 | Ga0496113_0470822 | |||
| 1514 | Ga0496114_0008937 | |||
| 1515 | Ga0496114_0026925 | |||
| 1516 | Ga0496114_0029918 | |||
| 1517 | Ga0496114_0034455 | |||
| 1518 | Ga0496114_0041420 | |||
| 1519 | Ga0496114_0048477 | |||
| 1520 | Ga0496114_0074846 | |||
| 1521 | Ga0496114_0088957 | |||
| 1522 | Ga0496114_0095973 | |||
| 1523 | Ga0496114_0173152 | |||
| 1524 | Ga0496114_0191998 | |||
| 1525 | Ga0496114_0216050 | |||
| 1526 | Ga0496114_0220247 | |||
| 1527 | Ga0496114_0800114 | |||
| 1528 | Ga0496115_0068503 | |||
| 1529 | Ga0496115_0074222 | |||
| 1530 | Ga0496115_0164385 | |||
| 1531 | Ga0496115_0324720 | |||
| 1532 | Ga0501031_0009177 | |||
| 1533 | Ga0501031_0014338 | |||
| 1534 | Ga0501031_0061433 | |||
| 1535 | Ga0501032_0009030 | |||
| 1536 | Ga0501032_0048642 | |||
| 1537 | Ga0501032_0118592 | |||
| 1538 | Ga0501033_0001810 | |||
| 1539 | Ga0501034_0130633 | |||
| 1540 | Ga0501034_1508767 | |||
| 1541 | Ga0501036_0001257 | |||
| 1542 | Ga0501036_0003912 | |||
| 1543 | Ga0501036_0229137 | |||
| 1544 | Ga0501037_0005892 | |||
| 1545 | Ga0501037_0059367 | |||
| 1546 | Ga0501037_0060344 | |||
| 1547 | Ga0501038_0001658 | |||
| 1548 | Ga0501038_0024821 | |||
| 1549 | Ga0501039_0000858 | |||
| 1550 | Ga0501039_0004240 | |||
| 1551 | Ga0501039_0031095 | |||
| 1552 | Ga0501040_0003557 | |||
| 1553 | Ga0501040_0014210 | |||
| 1554 | Ga0501040_0041638 | |||
| 1555 | Ga0501041_0005591 | |||
| 1556 | Ga0501041_0029322 | |||
| 1557 | Ga0501042_0001029 | |||
| 1558 | Ga0501042_0003885 | |||
| 1559 | Ga0501042_0032808 | |||
| 1560 | Ga0501043_0052525 | |||
| 1561 | Ga0501043_0115687 | |||
| 1562 | Ga0501043_0420560 | |||
| 1563 | Ga0501046_0005646 | |||
| 1564 | Ga0501046_0009235 | |||
| 1565 | Ga0501046_0022188 | |||
| 1566 | Ga0501047_0813989 | |||
| 1567 | Ga0501048_0004941 | |||
| 1568 | Ga0501048_0036201 | |||
| 1569 | Ga0501067_0000073 | |||
| 1570 | Ga0501068_0001291 | |||
| 1571 | Ga0501068_0014638 | |||
| 1572 | Ga0501068_0032040 | |||
| 1573 | Ga0501069_0001022 | |||
| 1574 | Ga0501069_0019455 | |||
| 1575 | Ga0501069_0067601 | |||
| 1576 | Ga0501069_0159672 | |||
| 1577 | Ga0501070_0003884 | |||
| 1578 | Ga0501070_0217631 | |||
| 1579 | Ga0501070_0874659 | |||
| 1580 | Ga0501071_0000784 | |||
| 1581 | Ga0501071_0005748 | |||
| 1582 | Ga0501071_0056224 | |||
| 1583 | Ga0501071_0112798 | |||
| 1584 | Ga0501071_0231922 | |||
| 1585 | Ga0501072_0000359 | |||
| 1586 | Ga0501072_0018332 | |||
| 1587 | Ga0501072_0061610 | |||
| 1588 | Ga0501072_0096438 | |||
| 1589 | Ga0501072_0126555 | |||
| 1590 | Ga0501073_0012982 | |||
| 1591 | Ga0501073_0134387 | |||
| 1592 | Ga0501074_0003093 | |||
| 1593 | Ga0501074_0004076 | |||
| 1594 | Ga0501074_0020238 | |||
| 1595 | Ga0501075_0002975 | |||
| 1596 | Ga0501075_0011404 | |||
| 1597 | Ga0501075_0012874 | |||
| 1598 | Ga0501075_0650439 | |||
| 1599 | Ga0501076_0004387 | |||
| 1600 | Ga0501076_0008210 | |||
| 1601 | Ga0501077_0002413 | |||
| 1602 | Ga0501077_0029104 | |||
| 1603 | Ga0501077_0265616 | |||
| 1604 | Ga0501077_0630031 | |||
| 1605 | Ga0501079_0009737 | |||
| 1606 | Ga0501079_0032069 | |||
| 1607 | Ga0501079_0106173 | |||
| 1608 | Ga0501080_0004837 | |||
| 1609 | Ga0501080_0043934 | |||
| 1610 | Ga0501081_0001589 | |||
| 1611 | Ga0501081_0010005 | |||
| 1612 | Ga0501081_0026203 | |||
| 1613 | Ga0501083_0004922 | |||
| 1614 | Ga0501035_0041155 | |||
| 1615 | Ga0501035_0263061 | |||
| 1616 | Ga0501044_0080871 | |||
| 1617 | Ga0501044_0085431 | |||
| 1618 | Ga0501045_0009611 | |||
| 1619 | Ga0501045_0037241 | |||
| 1620 | Ga0501045_0108386 | |||
| 1621 | nmdc:mga04h51_195379_c1 | |||
| 1622 | nmdc:mga08y16_431995_c1 | |||
| 1623 | nmdc:mga08y16_478691_c1 | |||
| 1624 | nmdc:mga08y16_708287_c1 | |||
| 1625 | nmdc:mga0n895_12793_c1 | |||
| 1626 | nmdc:mga0n895_47003_c1 | |||
| 1627 | nmdc:mga0rr50_20791_c1 | |||
| 1628 | nmdc:mga0rr50_370218_c1 | |||
| 1629 | nmdc:mga08x19_41772_c1 | |||
| 1630 | Ga0495601_0000626 | |||
| 1631 | Ga0495601_0004479 | |||
| 1632 | Ga0495601_0009387 | |||
| 1633 | Ga0495601_0027268 | |||
| 1634 | Ga0495601_0031372 | |||
| 1635 | Ga0495601_0155059 | |||
| 1636 | Ga0495601_0274325 | |||
| 1637 | Ga0495601_0630576 | |||
| 1638 | Ga0495612_0034806 | |||
| 1639 | Ga0495612_0106214 | |||
| 1640 | Ga0495612_0123508 | |||
| 1641 | Ga0495595_0002577 | |||
| 1642 | Ga0495595_0032914 | |||
| 1643 | Ga0495595_0348725 | |||
| 1644 | Ga0495619_0004115 | |||
| 1645 | Ga0495619_0005077 | |||
| 1646 | Ga0495619_0083257 | |||
| 1647 | Ga0495619_0121978 | |||
| 1648 | Ga0495619_0268725 | |||
| 1649 | Ga0495619_0680122 | |||
| 1650 | Ga0500566_0382996 | |||
| 1651 | Ga0501084_0002111 | |||
| 1652 | Ga0501084_0003765 | |||
| 1653 | Ga0501084_0087951 | |||
| 1654 | Ga0501082_0002634 | |||
| 1655 | Ga0501082_0003234 | |||
| 1656 | Ga0501082_0039078 | |||
| 1657 | Ga0466962_0008372 | |||
| 1658 | Ga0530510_0021511 | |||
| 1659 | Ga0530510_0024554 | |||
| 1660 | Ga0530510_0564019 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1non-assembly1.cif.gz_A | pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus | 0.9551 | 9 | 186 |
| 1xz8-assembly1.cif.gz_A | pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form | 0.9508 | 9 | 186 |
| 4p81-assembly1.cif.gz_C | structure of ancestral pyrr protein (ancorangepyrr) | 0.947 | 10 | 186 |
| 1xzn-assembly1.cif.gz_B | pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form | 0.9453 | 7 | 186 |
| 4p81-assembly1.cif.gz_D | structure of ancestral pyrr protein (ancorangepyrr) | 0.9366 | 9 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8943 | 9 | 186 | 3.40.50.2020 |
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8792 | 9 | 186 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8634 | 1 | 185 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8457 | 1 | 185 | 3.40.50.2020 |
| 4rv4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8092 | 15 | 145 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A3CNI9-F1-model_v4 | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] | 0.961 | 8 | 186 |
GO:0003723
GO:0004845 GO:0006353 |
| AF-B5XKV8-F1-model_v4 | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] | 0.9575 | 8 | 188 |
GO:0003723
GO:0004845 GO:0006353 |
| AF-A0A351SVE5-F1-model_v4 | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] | 0.9495 | 8 | 186 |
GO:0004845
GO:0006355 |
| AF-Q5M5G0-F1-model_v4 | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] | 0.9463 | 8 | 188 |
GO:0003723
GO:0004845 GO:0006353 |
| AF-Q8XJB2-F1-model_v4 | Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] | 0.9459 | 9 | 186 |
GO:0003723
GO:0004845 GO:0006353 |