F482644

General Info

Members Datasets Scaffolds Average Seq Length
830 362 1660 317

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10000542|Ga0075369_100005426
Length 341
Sequence VPGPVLARIYGVDVDAFVLAHRATWDRLEALVKRRRRLTGAEVDELVDLYQRVSTHLSMVRTSSTDAVLIGRLSGLVARARSVVTGAHAPLWSEFTRFWTVSFPVVAWRSRRWWLGSAIAFFAVTALIAVWVAGNPEVQAAIGTPSEIDELVNHDFASYYSEHPAASFGLQVWVNNAWVAAQCIAFAVLLGLPIPYVLFQNAANLGLTAGLMFDAGKGDVFLGLITPHGLLELTAVFLAAAAGMRLGWMVVSPGDRPRVQVLAEQGRAVVSVAGGLVAVLLVCGLIEAVVTPSPLPTAARIGIGFAAEVAFLAYVFHFGRKAERAGETGDLEDAPDVVPTG

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
339 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
340 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
341 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
342 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
343 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
344 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
345 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
346 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
347 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
348 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
349 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
350 2891562705 Microbispora tritici MT50 Isolate Unclassified
351 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
352 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
353 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
354 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
355 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
356 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
357 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
358 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
359 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
360 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
361 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
362 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0.12
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0.12
Rhizoplane 8.07
Rhizosphere 78.67
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10000542 3300006186 Bacteria 11919
2 JGI24744J21845_10000843 3300002077 Bacteria 5789
3 JGI24742J22300_10007086 3300002244 Bacteria 1848
4 JGI24751J29686_10009233 3300002459 Bacteria 2025
5 Ga0055540_1000751 3300003792 Bacteria 22029
6 Ga0070658_10369315 3300005327 Bacteria 1230
7 Ga0070676_10001758 3300005328 Bacteria 11015
8 Ga0070676_10076873 3300005328 Bacteria 2017
9 Ga0070683_100330357 3300005329 Bacteria 1451
10 Ga0070690_100007386 3300005330 Bacteria 6295
11 Ga0070670_100121966 3300005331 Bacteria 2248
12 Ga0068869_100102475 3300005334 Bacteria 2167
13 Ga0070666_10001180 3300005335 Bacteria 15847
14 Ga0070682_100004076 3300005337 Bacteria 8117
15 Ga0068868_100002553 3300005338 Bacteria 12660
16 Ga0068868_100023036 3300005338 Bacteria 4710
17 Ga0070660_100024308 3300005339 Bacteria 4495
18 Ga0070689_100001468 3300005340 Bacteria 15046
19 Ga0070691_10001233 3300005341 Bacteria 10771
20 Ga0070692_10071240 3300005345 Bacteria 1852
21 Ga0070668_100001731 3300005347 Bacteria 15868
22 Ga0070668_100008810 3300005347 Bacteria 7496
23 Ga0070668_100215602 3300005347 Bacteria 1581
24 Ga0070669_100005294 3300005353 Bacteria 9315
25 Ga0070671_100003966 3300005355 Bacteria 11654
26 Ga0070671_100059295 3300005355 Bacteria 3185
27 Ga0070671_100137648 3300005355 Bacteria 2059
28 Ga0070671_100149833 3300005355 Bacteria 1970
29 Ga0070674_100001547 3300005356 Bacteria 12315
30 Ga0070688_100016198 3300005365 Bacteria 4257
31 Ga0070659_100000157 3300005366 Bacteria 52408
32 Ga0070659_100007108 3300005366 Bacteria 8118
33 Ga0070667_100002788 3300005367 Bacteria 15092
34 Ga0070667_100012517 3300005367 Bacteria 7017
35 Ga0070667_100026501 3300005367 Bacteria 4823
36 Ga0070709_10000585 3300005434 Bacteria 21344
37 Ga0070709_10021563 3300005434 Bacteria 3754
38 Ga0070709_10028065 3300005434 Bacteria 3354
39 Ga0070714_100000623 3300005435 Bacteria 25206
40 Ga0070714_100006030 3300005435 Bacteria 9306
41 Ga0070714_100010693 3300005435 Bacteria 7262
42 Ga0070714_100015312 3300005435 Bacteria 6170
43 Ga0070714_100058888 3300005435 Bacteria 3292
44 Ga0070714_100078995 3300005435 Bacteria 2860
45 Ga0070714_100100001 3300005435 Bacteria 2553
46 Ga0070714_100279046 3300005435 Bacteria 1552
47 Ga0070713_100011669 3300005436 Bacteria 6411
48 Ga0070713_100036078 3300005436 Bacteria 3987
49 Ga0070713_100050524 3300005436 Bacteria 3435
50 Ga0070713_100301679 3300005436 Bacteria 1474
51 Ga0070713_100410236 3300005436 Bacteria 1266
52 Ga0070710_10000425 3300005437 Bacteria 19915
53 Ga0070710_10003324 3300005437 Bacteria 7632
54 Ga0070710_10008156 3300005437 Bacteria 5092
55 Ga0070710_10012804 3300005437 Bacteria 4178
56 Ga0070710_10151561 3300005437 Bacteria 1430
57 Ga0070701_10028008 3300005438 Bacteria 2767
58 Ga0070711_100001076 3300005439 Bacteria 14601
59 Ga0070711_100003424 3300005439 Bacteria 9244
60 Ga0070711_100023223 3300005439 Bacteria 4030
61 Ga0070705_100002157 3300005440 Bacteria 10001
62 Ga0070705_100243802 3300005440 Bacteria 1257
63 Ga0070700_100010716 3300005441 Bacteria 5064
64 Ga0070694_100072875 3300005444 Bacteria 2370
65 Ga0070708_100004109 3300005445 Bacteria 11420
66 Ga0070708_100014318 3300005445 Bacteria 6522
67 Ga0070708_100034887 3300005445 Bacteria 4379
68 Ga0070708_100039109 3300005445 Bacteria 4148
69 Ga0070708_100119587 3300005445 Bacteria 2429
70 Ga0070708_100281316 3300005445 Bacteria 1566
71 Ga0070663_100020361 3300005455 Bacteria 4391
72 Ga0070663_100057343 3300005455 Bacteria 2794
73 Ga0070678_100000661 3300005456 Bacteria 16894
74 Ga0070678_100076050 3300005456 Bacteria 2528
75 Ga0070678_100091875 3300005456 Bacteria 2330
76 Ga0070662_100128404 3300005457 Bacteria 1951
77 Ga0068867_100003005 3300005459 Bacteria 11884
78 Ga0068867_100432461 3300005459 Bacteria 1117
79 Ga0070706_100002953 3300005467 Bacteria 16877
80 Ga0070706_100003936 3300005467 Bacteria 14469
81 Ga0070706_100004325 3300005467 Bacteria 13751
82 Ga0070706_100007743 3300005467 Bacteria 10043
83 Ga0070706_100009304 3300005467 Bacteria 9155
84 Ga0070707_100000788 3300005468 Bacteria 31321
85 Ga0070707_100004079 3300005468 Bacteria 13712
86 Ga0070707_100033657 3300005468 Bacteria 4886
87 Ga0070707_100115978 3300005468 Bacteria 2599
88 Ga0070698_100000080 3300005471 Bacteria 73829
89 Ga0070698_100002105 3300005471 Bacteria 22106
90 Ga0070698_100004969 3300005471 Bacteria 14570
91 Ga0070698_100007313 3300005471 Bacteria 11952
92 Ga0070698_100059333 3300005471 Bacteria 3864
93 Ga0070699_100024618 3300005518 Bacteria 5189
94 Ga0070679_100114263 3300005530 Bacteria 2685
95 Ga0070684_100033725 3300005535 Bacteria 4374
96 Ga0070697_100012470 3300005536 Bacteria 6660
97 Ga0068853_100005376 3300005539 Bacteria 10027
98 Ga0068853_100352433 3300005539 Bacteria 1369
99 Ga0070695_100013477 3300005545 Bacteria 4915
100 Ga0070695_100043470 3300005545 Bacteria 2857
101 Ga0070696_100007819 3300005546 Bacteria 7139
102 Ga0070696_100046982 3300005546 Bacteria 2995
103 Ga0070696_100077561 3300005546 Bacteria 2348
104 Ga0070693_100005084 3300005547 Bacteria 6285
105 Ga0070665_100009474 3300005548 Bacteria 9854
106 Ga0070665_100072015 3300005548 Bacteria 3464
107 Ga0070704_100000337 3300005549 Bacteria 21281
108 Ga0070704_100108483 3300005549 Bacteria 2108
109 Ga0068855_100127637 3300005563 Bacteria 2907
110 Ga0068855_100189360 3300005563 Bacteria 2322
111 Ga0068857_100153615 3300005577 Bacteria 2086
112 Ga0068854_100004018 3300005578 Bacteria 9231
113 Ga0068854_100091842 3300005578 Bacteria 2260
114 Ga0068854_100210699 3300005578 Bacteria 1532
115 Ga0070702_100000269 3300005615 Bacteria 17716
116 Ga0070702_100175791 3300005615 Bacteria 1396
117 Ga0068852_100277312 3300005616 Bacteria 1615
118 Ga0068859_100008304 3300005617 Bacteria 10520
119 Ga0068859_100060506 3300005617 Bacteria 3816
120 Ga0068864_100296325 3300005618 Bacteria 1513
121 Ga0068866_10000952 3300005718 Bacteria 12734
122 Ga0068861_100000769 3300005719 Bacteria 19249
123 Ga0068861_100028894 3300005719 Bacteria 4049
124 Ga0068861_100052856 3300005719 Bacteria 3089
125 Ga0068863_100004130 3300005841 Bacteria 14357
126 Ga0068863_100007926 3300005841 Bacteria 10382
127 Ga0068863_100547921 3300005841 Bacteria 1142
128 Ga0068858_100030282 3300005842 Bacteria 5025
129 Ga0068858_100096681 3300005842 Bacteria 2752
130 Ga0068858_100109697 3300005842 Bacteria 2576
131 Ga0068858_100285880 3300005842 Bacteria 1571
132 Ga0068860_100000986 3300005843 Bacteria 31453
133 Ga0068860_100004025 3300005843 Bacteria 15092
134 Ga0068862_100000024 3300005844 Bacteria 197686
135 Ga0068862_100276785 3300005844 Bacteria 1537
136 Ga0068862_100284984 3300005844 Bacteria 1515
137 Ga0081455_10011728 3300005937 Bacteria 8786
138 Ga0081455_10041186 3300005937 Bacteria 4065
139 Ga0070717_10004963 3300006028 Bacteria 9680
140 Ga0070717_10010850 3300006028 Bacteria 6896
141 Ga0070717_10028100 3300006028 Bacteria 4499
142 Ga0070717_10040741 3300006028 Bacteria 3785
143 Ga0070717_10048033 3300006028 Bacteria 3499
144 Ga0070717_10310201 3300006028 Bacteria 1404
145 Ga0075365_10013609 3300006038 Bacteria 4874
146 Ga0075365_10065472 3300006038 Bacteria 2436
147 Ga0075365_10087617 3300006038 Bacteria 2117
148 Ga0075365_10107905 3300006038 Bacteria 1912
149 Ga0075365_10154526 3300006038 Bacteria 1597
150 Ga0075363_100000956 3300006048 Bacteria 10259
151 Ga0075363_100004063 3300006048 Bacteria 6335
152 Ga0075364_10006975 3300006051 Bacteria 6674
153 Ga0075364_10009189 3300006051 Bacteria 5921
154 Ga0075364_10017701 3300006051 Bacteria 4456
155 Ga0075364_10022608 3300006051 Bacteria 3973
156 Ga0070715_10000998 3300006163 Bacteria 7935
157 Ga0070715_10002776 3300006163 Bacteria 5445
158 Ga0070715_10008985 3300006163 Bacteria 3507
159 Ga0070716_100000358 3300006173 Bacteria 18707
160 Ga0070716_100003074 3300006173 Bacteria 7790
161 Ga0070716_100003659 3300006173 Bacteria 7273
162 Ga0070712_100006379 3300006175 Bacteria 7317
163 Ga0070712_100011811 3300006175 Bacteria 5550
164 Ga0070712_100147988 3300006175 Bacteria 1799
165 Ga0070712_100225079 3300006175 Bacteria 1487
166 Ga0075362_10068365 3300006177 Bacteria 1618
167 Ga0075367_10011068 3300006178 Bacteria 4757
168 Ga0075369_10001209 3300006186 Bacteria 8756
169 Ga0075369_10002619 3300006186 Bacteria 6442
170 Ga0075369_10003179 3300006186 Bacteria 5956
171 Ga0075369_10004619 3300006186 Bacteria 5108
172 Ga0075369_10005746 3300006186 Bacteria 4656
173 Ga0075369_10051963 3300006186 Bacteria 1776
174 Ga0075369_10098097 3300006186 Bacteria 1313
175 Ga0097621_100125163 3300006237 Bacteria 2183
176 Ga0097621_100305105 3300006237 Bacteria 1407
177 Ga0075370_10017532 3300006353 Bacteria 3870
178 Ga0075370_10018885 3300006353 Bacteria 3744
179 Ga0075370_10100666 3300006353 Bacteria 1672
180 Ga0068871_100027012 3300006358 Bacteria 4485
181 Ga0068871_100116803 3300006358 Bacteria 2250
182 Ga0068871_100251728 3300006358 Bacteria 1539
183 Ga0075428_100003675 3300006844 Bacteria 16830
184 Ga0075430_100001881 3300006846 Bacteria 17188
185 Ga0075430_100060950 3300006846 Bacteria 3171
186 Ga0075431_100119129 3300006847 Bacteria 2724
187 Ga0075433_10064256 3300006852 Bacteria 3217
188 Ga0075433_10074231 3300006852 Bacteria 2993
189 Ga0075434_100002503 3300006871 Bacteria 16204
190 Ga0075434_100025854 3300006871 Bacteria 5746
191 Ga0068865_100002154 3300006881 Bacteria 11601
192 Ga0068865_100035172 3300006881 Bacteria 3366
193 Ga0075436_100013319 3300006914 Bacteria 5633
194 Ga0075436_100070490 3300006914 Bacteria 2416
195 Ga0097620_100008304 3300006931 Bacteria 10520
196 Ga0097620_100060507 3300006931 Bacteria 3816
197 Ga0075435_100008942 3300007076 Bacteria 7219
198 Ga0075435_100053740 3300007076 Bacteria 3249
199 Ga0105250_10018077 3300009092 Bacteria 2859
200 Ga0105250_10024606 3300009092 Bacteria 2426
201 Ga0105245_10002048 3300009098 Bacteria 18300
202 Ga0105245_10028471 3300009098 Bacteria 4929
203 Ga0105247_10001811 3300009101 Bacteria 14993
204 Ga0105247_10005206 3300009101 Bacteria 8222
205 Ga0105247_10060103 3300009101 Bacteria 2355
206 Ga0114129_10031070 3300009147 Bacteria 7554
207 Ga0105243_10002552 3300009148 Bacteria 15215
208 Ga0105243_10135370 3300009148 Bacteria 2095
209 Ga0105241_10057475 3300009174 Bacteria 2984
210 Ga0105241_10110891 3300009174 Bacteria 2195
211 Ga0105242_10001021 3300009176 Bacteria 22015
212 Ga0105248_10004705 3300009177 Bacteria 15098
213 Ga0105248_10008152 3300009177 Bacteria 11506
214 Ga0105248_10058679 3300009177 Bacteria 4322
215 Ga0105237_10001600 3300009545 Bacteria 29433
216 Ga0105249_10000223 3300009553 Bacteria 64879
217 Ga0105249_10000977 3300009553 Bacteria 25334
218 Ga0105249_10286806 3300009553 Bacteria 1646
219 Ga0105239_10003140 3300010375 Bacteria 20503
220 Ga0105239_10075770 3300010375 Bacteria 3699
221 Ga0105246_10248673 3300011119 Bacteria 1410
222 Ga0157369_10001338 3300013105 Bacteria 30437
223 Ga0157369_10133839 3300013105 Bacteria 2626
224 Ga0157374_10136617 3300013296 Bacteria 2377
225 Ga0157378_10021574 3300013297 Bacteria 5664
226 Ga0163162_10004880 3300013306 Bacteria 12936
227 Ga0163162_10038529 3300013306 Bacteria 4770
228 Ga0157372_10012920 3300013307 Bacteria 8900
229 Ga0157372_10101953 3300013307 Bacteria 3278
230 Ga0157375_10001069 3300013308 Bacteria 23698
231 Ga0157375_10069233 3300013308 Bacteria 3534
232 Ga0157375_10091595 3300013308 Bacteria 3102
233 Ga0163163_10036468 3300014325 Bacteria 4777
234 Ga0163163_10226620 3300014325 Bacteria 1918
235 Ga0157380_10000535 3300014326 Bacteria 23353
236 Ga0157379_10049535 3300014968 Bacteria 3751
237 Ga0157379_10218033 3300014968 Bacteria 1728
238 Ga0157376_10354410 3300014969 Bacteria 1405
239 Ga0163161_10001057 3300017792 Bacteria 20877
240 Ga0206353_10073283 3300020082 Bacteria 1815
241 Ga0213876_10006722 3300021384 Bacteria 6278
242 Ga0213876_10013978 3300021384 Bacteria 4254
243 Ga0213876_10021776 3300021384 Bacteria 3391
244 Ga0213875_10056025 3300021388 Bacteria 1846
245 Ga0224572_1014555 3300024225 Bacteria 1503
246 Ga0209673_1011387 3300025273 Bacteria 3672
247 Ga0209051_1000915 3300025303 Bacteria 29327
248 Ga0209051_1001195 3300025303 Bacteria 23470
249 Ga0209051_1002804 3300025303 Bacteria 12028
250 Ga0209051_1034510 3300025303 Bacteria 1895
251 Ga0207692_10016070 3300025898 Bacteria 3305
252 Ga0207692_10016187 3300025898 Bacteria 3296
253 Ga0207692_10051645 3300025898 Bacteria 2085
254 Ga0207692_10080546 3300025898 Bacteria 1740
255 Ga0207642_10000265 3300025899 Bacteria 15742
256 Ga0207710_10000978 3300025900 Bacteria 15009
257 Ga0207710_10027897 3300025900 Bacteria 2449
258 Ga0207688_10000510 3300025901 Bacteria 18743
259 Ga0207688_10003926 3300025901 Bacteria 8109
260 Ga0207680_10008385 3300025903 Bacteria 5069
261 Ga0207685_10005116 3300025905 Bacteria 3423
262 Ga0207685_10010517 3300025905 Bacteria 2737
263 Ga0207685_10021443 3300025905 Bacteria 2165
264 Ga0207699_10000265 3300025906 Bacteria 28753
265 Ga0207699_10003028 3300025906 Bacteria 7987
266 Ga0207699_10007650 3300025906 Bacteria 5291
267 Ga0207699_10017348 3300025906 Bacteria 3786
268 Ga0207699_10042440 3300025906 Bacteria 2635
269 Ga0207699_10359366 3300025906 Bacteria 1029
270 Ga0207645_10014321 3300025907 Bacteria 5311
271 Ga0207645_10089181 3300025907 Bacteria 1983
272 Ga0207684_10000794 3300025910 Bacteria 36572
273 Ga0207684_10002656 3300025910 Bacteria 17890
274 Ga0207684_10003644 3300025910 Bacteria 14966
275 Ga0207684_10422627 3300025910 Bacteria 1145
276 Ga0207707_10243593 3300025912 Bacteria 1563
277 Ga0207671_10010290 3300025914 Bacteria 7730
278 Ga0207693_10002276 3300025915 Bacteria 16695
279 Ga0207693_10002519 3300025915 Bacteria 15921
280 Ga0207693_10006356 3300025915 Bacteria 9790
281 Ga0207693_10006886 3300025915 Bacteria 9390
282 Ga0207693_10050063 3300025915 Bacteria 3281
283 Ga0207693_10063981 3300025915 Bacteria 2882
284 Ga0207693_10122446 3300025915 Bacteria 2043
285 Ga0207663_10007780 3300025916 Bacteria 5582
286 Ga0207663_10023291 3300025916 Bacteria 3551
287 Ga0207663_10119773 3300025916 Bacteria 1800
288 Ga0207657_10068750 3300025919 Bacteria 3008
289 Ga0207657_10136140 3300025919 Bacteria 2010
290 Ga0207646_10003025 3300025922 Bacteria 19363
291 Ga0207646_10008153 3300025922 Bacteria 10540
292 Ga0207646_10230497 3300025922 Bacteria 1673
293 Ga0207646_10287701 3300025922 Bacteria 1485
294 Ga0207681_10011692 3300025923 Bacteria 5395
295 Ga0207681_10074187 3300025923 Bacteria 2383
296 Ga0207659_10218881 3300025926 Bacteria 1530
297 Ga0207687_10003994 3300025927 Bacteria 9889
298 Ga0207687_10015740 3300025927 Bacteria 4964
299 Ga0207700_10000508 3300025928 Bacteria 22842
300 Ga0207700_10003489 3300025928 Bacteria 9163
301 Ga0207700_10020620 3300025928 Bacteria 4481
302 Ga0207700_10031487 3300025928 Bacteria 3769
303 Ga0207700_10086253 3300025928 Bacteria 2466
304 Ga0207700_10100560 3300025928 Bacteria 2305
305 Ga0207664_10000557 3300025929 Bacteria 26152
306 Ga0207664_10002126 3300025929 Bacteria 13048
307 Ga0207664_10018737 3300025929 Bacteria 5104
308 Ga0207664_10022538 3300025929 Bacteria 4706
309 Ga0207664_10037766 3300025929 Bacteria 3741
310 Ga0207664_10044826 3300025929 Bacteria 3465
311 Ga0207664_10062645 3300025929 Bacteria 2970
312 Ga0207664_10101544 3300025929 Bacteria 2377
313 Ga0207664_10149966 3300025929 Bacteria 1980
314 Ga0207644_10034935 3300025931 Bacteria 3519
315 Ga0207644_10098609 3300025931 Bacteria 2191
316 Ga0207690_10000804 3300025932 Bacteria 20157
317 Ga0207690_10009353 3300025932 Bacteria 5820
318 Ga0207706_10005788 3300025933 Bacteria 11499
319 Ga0207706_10057701 3300025933 Bacteria 3420
320 Ga0207686_10081963 3300025934 Bacteria 2108
321 Ga0207709_10059379 3300025935 Bacteria 2380
322 Ga0207709_10170396 3300025935 Bacteria 1527
323 Ga0207670_10046258 3300025936 Bacteria 2890
324 Ga0207669_10001626 3300025937 Bacteria 9559
325 Ga0207704_10001088 3300025938 Bacteria 12065
326 Ga0207665_10000457 3300025939 Bacteria 28144
327 Ga0207665_10002698 3300025939 Bacteria 11898
328 Ga0207665_10024938 3300025939 Bacteria 3944
329 Ga0207665_10031529 3300025939 Bacteria 3507
330 Ga0207711_10002878 3300025941 Bacteria 15083
331 Ga0207711_10006473 3300025941 Bacteria 9857
332 Ga0207711_10098992 3300025941 Bacteria 2577
333 Ga0207689_10142675 3300025942 Bacteria 1973
334 Ga0207667_10074577 3300025949 Bacteria 3524
335 Ga0207667_10494434 3300025949 Bacteria 1241
336 Ga0207712_10000183 3300025961 Bacteria 64691
337 Ga0207712_10016381 3300025961 Bacteria 4798
338 Ga0207668_10005410 3300025972 Bacteria 7521
339 Ga0207668_10005815 3300025972 Bacteria 7266
340 Ga0207668_10022205 3300025972 Bacteria 4059
341 Ga0207640_10005268 3300025981 Bacteria 7041
342 Ga0207640_10338777 3300025981 Bacteria 1204
343 Ga0207658_10002038 3300025986 Bacteria 15087
344 Ga0207658_10010419 3300025986 Bacteria 6314
345 Ga0207658_10027480 3300025986 Bacteria 3998
346 Ga0207658_10069469 3300025986 Bacteria 2661
347 Ga0207658_10092563 3300025986 Bacteria 2349
348 Ga0207703_10003757 3300026035 Bacteria 12630
349 Ga0207703_10018721 3300026035 Bacteria 5409
350 Ga0207639_10007568 3300026041 Bacteria 7408
351 Ga0207678_10019661 3300026067 Bacteria 5937
352 Ga0207678_10033916 3300026067 Bacteria 4446
353 Ga0207678_10060592 3300026067 Bacteria 3255
354 Ga0207678_10072335 3300026067 Bacteria 2955
355 Ga0207708_10010880 3300026075 Bacteria 6767
356 Ga0207708_10037494 3300026075 Bacteria 3693
357 Ga0207708_10118380 3300026075 Bacteria 2062
358 Ga0207702_10197287 3300026078 Bacteria 1864
359 Ga0207641_10000164 3300026088 Bacteria 93616
360 Ga0207641_10004062 3300026088 Bacteria 12768
361 Ga0207641_10067942 3300026088 Bacteria 3055
362 Ga0207648_10008901 3300026089 Bacteria 9664
363 Ga0207648_10039066 3300026089 Bacteria 4173
364 Ga0207676_10310162 3300026095 Bacteria 1444
365 Ga0207674_10023630 3300026116 Bacteria 6581
366 Ga0207675_100000735 3300026118 Bacteria 32473
367 Ga0207675_100043909 3300026118 Bacteria 4175
368 Ga0207675_100046021 3300026118 Bacteria 4076
369 Ga0207683_10003492 3300026121 Bacteria 13717
370 Ga0207683_10029822 3300026121 Bacteria 4723
371 Ga0207683_10235231 3300026121 Bacteria 1671
372 Ga0207698_10197193 3300026142 Bacteria 1800
373 Ga0268266_10007294 3300028379 Bacteria 9998
374 Ga0268266_10043937 3300028379 Bacteria 3819
375 Ga0268266_10165270 3300028379 Bacteria 2004
376 Ga0268265_10000012 3300028380 Bacteria 343132
377 Ga0268265_10016078 3300028380 Bacteria 5134
378 Ga0268265_10068422 3300028380 Bacteria 2753
379 Ga0268265_10093601 3300028380 Bacteria 2408
380 Ga0268264_10002220 3300028381 Bacteria 17222
381 Ga0268264_10002837 3300028381 Bacteria 15120
382 Ga0265338_10006589 3300028800 Bacteria 14725
383 Ga0265338_10113554 3300028800 Bacteria 2176
384 Ga0265327_10000253 3300031251 Bacteria 106101
385 Ga0265327_10005089 3300031251 Bacteria 11192
386 Ga0307413_10088537 3300031824 Bacteria 2009
387 Ga0307410_10042450 3300031852 Bacteria 3006
388 Ga0307407_10033107 3300031903 Bacteria 2817
389 Ga0307409_100014255 3300031995 Bacteria 5160
390 Ga0307409_100287633 3300031995 Bacteria 1523
391 Ga0307411_10005213 3300032005 Bacteria 6363
392 Ga0373958_0003699 3300034819 Bacteria 2225
393 Ga0373938_0028155 3300034957 Bacteria 1187
394 Ga0373926_0007557 3300035083 Bacteria 3619
395 Ga0373926_0020016 3300035083 Bacteria 2310
396 Ga0373926_0028500 3300035083 Bacteria 1960
397 Ga0373934_0006291 3300035086 Bacteria 4401
398 Ga0373944_0024703 3300035089 Bacteria 1764
399 Ga0373949_0015351 3300035090 Bacteria 1710
400 Ga0373936_0001008 3300035113 Bacteria 10064
401 Ga0373941_0013580 3300035115 Bacteria 2156
402 Ga0373945_0046934 3300035116 Bacteria 1578
403 Ga0373945_0066495 3300035116 Bacteria 1355
404 Ga0373953_0000029 3300035117 Bacteria 39155
405 Ga0373953_0007048 3300035117 Bacteria 3742
406 Ga0373954_0001513 3300035118 Bacteria 9458
407 Ga0373954_0067243 3300035118 Bacteria 1697
408 Ga0373956_0001824 3300035119 Bacteria 8796
409 Ga0373956_0044552 3300035119 Bacteria 1977
410 Ga0373957_0000265 3300035120 Bacteria 13147
411 Ga0373957_0000549 3300035120 Bacteria 9532
412 Ga0373957_0010584 3300035120 Bacteria 3054
413 Ga0373960_0002072 3300035121 Bacteria 4512
414 Ga0373943_0027860 3300035170 Bacteria 2658
415 Ga0373955_0000019 3300035172 Bacteria 64700
416 Ga0373955_0059506 3300035172 Bacteria 2104
417 Ga0373955_0091928 3300035172 Bacteria 1730
418 Ga0373924_0000550 3300035410 Bacteria 11520
419 Ga0373924_0000714 3300035410 Bacteria 10358
420 Ga0373924_0044499 3300035410 Bacteria 1824
421 Ga0373931_0015983 3300035691 Bacteria 3688
422 Ga0373931_0113321 3300035691 Bacteria 1541
423 Ga0373935_0000760 3300035692 Bacteria 17156
424 Ga0373935_0008336 3300035692 Bacteria 6200
425 Ga0373935_0096995 3300035692 Bacteria 1938
426 Ga0373933_0000027 3300035724 Bacteria 90038
427 Ga0373933_0000743 3300035724 Bacteria 19910
428 Ga0373933_0002967 3300035724 Bacteria 9459
429 Ga0373933_0005791 3300035724 Bacteria 6721
430 Ga0373933_0079733 3300035724 Bacteria 2005
431 Ga0373933_0219326 3300035724 Bacteria 1220
432 Ga0373947_0000011 3300035725 Bacteria 160778
433 Ga0373937_0000147 3300036401 Bacteria 68258
434 Ga0373937_0008463 3300036401 Bacteria 8941
435 Ga0373937_0010863 3300036401 Bacteria 7972
436 Ga0373937_0060764 3300036401 Bacteria 3472
437 Ga0373937_0176375 3300036401 Bacteria 2006
438 Ga0316584_0055319 3300036712 Bacteria 2971
439 Ga0373925_0016037 3300037068 Bacteria 5423
440 Ga0436364_0257076 3300037853 Bacteria 2668
441 Ga0436364_0275228 3300037853 Bacteria 9631
442 Ga0436364_0467668 3300037853 Bacteria 5143
443 Ga0436364_0586846 3300037853 Bacteria 2388
444 Ga0436365_0802105 3300039437 Bacteria 13700
445 Ga0436365_0878752 3300039437 Bacteria 18186
446 Ga0436365_1041061 3300039437 Bacteria 87934
447 Ga0436365_1781330 3300039437 Bacteria 14008
448 Ga0436363_0763127 3300039450 Bacteria 4004
449 Ga0439466_0001056 3300041411 Bacteria 10622
450 Ga0439466_0003851 3300041411 Bacteria 5789
451 Ga0439465_0000181 3300041413 Bacteria 16193
452 Ga0439465_0000671 3300041413 Bacteria 10446
453 Ga0439465_0007570 3300041413 Bacteria 3447
454 Ga0451789_1046045 3300041443 Bacteria 1611
455 Ga0439431_0000973 3300041997 Bacteria 6218
456 Ga0439431_0015197 3300041997 Bacteria 1790
457 Ga0439442_002122 3300042002 Bacteria 3898
458 Ga0439445_0004489 3300042004 Bacteria 3163
459 Ga0439445_0008372 3300042004 Bacteria 2418
460 Ga0439434_0004267 3300042435 Bacteria 4178
461 Ga0439434_0013227 3300042435 Bacteria 2448
462 Ga0439459_0001441 3300042438 Bacteria 3507
463 Ga0466972_0006817 3300044658 Bacteria 5733
464 Ga0466972_0021368 3300044658 Bacteria 3226
465 Ga0466972_0131829 3300044658 Bacteria 1177
466 Ga0466965_0003873 3300044683 Bacteria 6611
467 Ga0466965_0017263 3300044683 Bacteria 3448
468 Ga0466966_0011746 3300044684 Bacteria 5806
469 Ga0466966_0036239 3300044684 Bacteria 3186
470 Ga0466966_0038858 3300044684 Bacteria 3065
471 Ga0466961_0019831 3300044693 Bacteria 4326
472 Ga0466961_0066161 3300044693 Bacteria 2296
473 Ga0466963_0021871 3300044694 Bacteria 4042
474 Ga0466963_0024694 3300044694 Bacteria 3827
475 Ga0466964_0016700 3300044706 Bacteria 2804
476 Ga0466964_0052948 3300044706 Bacteria 1670
477 Ga0466971_0004415 3300044719 Bacteria 6070
478 Ga0466971_0008526 3300044719 Bacteria 4471
479 Ga0466968_0000600 3300044735 Bacteria 12278
480 Ga0466968_0004823 3300044735 Bacteria 5048
481 Ga0466968_0005509 3300044735 Bacteria 4740
482 Ga0466970_0005182 3300044765 Bacteria 6445
483 Ga0466970_0017859 3300044765 Bacteria 3669
484 Ga0466957_0006411 3300044842 Bacteria 6646
485 Ga0466957_0030961 3300044842 Bacteria 3196
486 Ga0466957_0123104 3300044842 Bacteria 1655
487 Ga0466960_0000192 3300044901 Bacteria 21063
488 Ga0466960_0000377 3300044901 Bacteria 15211
489 Ga0466960_0006191 3300044901 Bacteria 4791
490 Ga0466960_0030250 3300044901 Bacteria 2491
491 Ga0466960_0053361 3300044901 Bacteria 1959
492 Ga0466959_0000865 3300045049 Bacteria 17867
493 Ga0466959_0031944 3300045049 Bacteria 3897
494 Ga0466959_0048631 3300045049 Bacteria 3116
495 Ga0466959_0104713 3300045049 Bacteria 2023
496 Ga0466958_0007105 3300045836 Bacteria 6132
497 Ga0466958_0009021 3300045836 Bacteria 5538
498 Ga0466958_0068825 3300045836 Bacteria 2164
499 Ga0466967_0000402 3300045976 Bacteria 20322
500 Ga0466967_0006840 3300045976 Bacteria 8134
501 Ga0466967_0008059 3300045976 Bacteria 7680
502 Ga0466967_0018601 3300045976 Bacteria 5559
503 Ga0466967_0061469 3300045976 Bacteria 3332
504 Ga0466967_0176278 3300045976 Bacteria 2014
505 Ga0466967_0201533 3300045976 Bacteria 1885
506 Ga0466967_0352293 3300045976 Bacteria 1425
507 Ga0495592_0000019 3300046454 Bacteria 140749
508 Ga0495592_0034634 3300046454 Bacteria 3805
509 Ga0495592_0085131 3300046454 Bacteria 2279
510 Ga0495603_0029858 3300046455 Bacteria 3286
511 Ga0495629_0008983 3300046459 Bacteria 7335
512 Ga0495629_0009495 3300046459 Bacteria 7113
513 Ga0495629_0178202 3300046459 Bacteria 1473
514 Ga0495629_0434028 3300046459 Bacteria 890
515 Ga0495638_0000956 3300046460 Bacteria 29287
516 Ga0495641_0026147 3300046461 Bacteria 2852
517 Ga0495641_0029287 3300046461 Bacteria 2654
518 Ga0495651_0000012 3300046462 Bacteria 138280
519 Ga0495651_0015040 3300046462 Bacteria 5981
520 Ga0495651_0030433 3300046462 Bacteria 4209
521 Ga0495651_0072601 3300046462 Bacteria 2613
522 Ga0495653_0006940 3300046463 Bacteria 9299
523 Ga0495653_0012214 3300046463 Bacteria 7006
524 Ga0495653_0088674 3300046463 Bacteria 2269
525 Ga0495582_0001916 3300046473 Bacteria 11701
526 Ga0495582_0017468 3300046473 Bacteria 3925
527 Ga0495639_0014575 3300046475 Bacteria 3405
528 Ga0495639_0099765 3300046475 Bacteria 1370
529 Ga0495639_0116913 3300046475 Bacteria 1269
530 Ga0495662_0002768 3300046476 Bacteria 8870
531 Ga0495664_0014482 3300046477 Unclassified 4471
532 Ga0495664_0017826 3300046477 Bacteria 4060
533 Ga0495594_0107194 3300046499 Bacteria 1574
534 Ga0495606_0019704 3300046507 Bacteria 5005
535 Ga0495608_0000048 3300046511 Bacteria 97364
536 Ga0495608_0015396 3300046511 Bacteria 5304
537 Ga0495618_0021635 3300046514 Bacteria 3965
538 Ga0495618_0082233 3300046514 Bacteria 2057
539 Ga0495628_0000053 3300046516 Bacteria 91080
540 Ga0495628_0072798 3300046516 Bacteria 2678
541 Ga0495628_0174589 3300046516 Bacteria 1628
542 Ga0495630_0146499 3300046517 Bacteria 1796
543 Ga0495666_0026551 3300046526 Bacteria 2854
544 Ga0495652_0000230 3300046529 Bacteria 65344
545 Ga0495652_0060905 3300046529 Unclassified 3187
546 Ga0495652_0063424 3300046529 Bacteria 3111
547 Ga0495652_0127357 3300046529 Bacteria 2021
548 Ga0495665_0006664 3300046531 Bacteria 6231
549 Ga0495665_0010794 3300046531 Bacteria 4943
550 Ga0495640_0024780 3300046533 Bacteria 4360
551 Ga0495640_0034285 3300046533 Bacteria 3600
552 Ga0495640_0096776 3300046533 Bacteria 1941
553 Ga0495586_0043216 3300046535 Bacteria 2427
554 Ga0495587_0000027 3300046536 Bacteria 140741
555 Ga0495587_0010009 3300046536 Bacteria 6055
556 Ga0495587_0029168 3300046536 Bacteria 3351
557 Ga0495587_0067399 3300046536 Bacteria 2086
558 Ga0495587_0096144 3300046536 Bacteria 1708
559 Ga0495645_0008025 3300046543 Bacteria 7351
560 Ga0495645_0086681 3300046543 Bacteria 2240
561 Ga0495667_0000089 3300046559 Bacteria 66700
562 Ga0495667_0017884 3300046559 Bacteria 4788
563 Ga0495667_0018600 3300046559 Bacteria 4691
564 Ga0495667_0041867 3300046559 Bacteria 3036
565 Ga0495667_0231993 3300046559 Bacteria 1177
566 Ga0495634_0052391 3300046642 Bacteria 2735
567 Ga0495634_0053527 3300046642 Bacteria 2703
568 Ga0495611_0080032 3300046648 Bacteria 1501
569 Ga0495635_0035058 3300046663 Bacteria 3479
570 Ga0495635_0048939 3300046663 Bacteria 2914
571 Ga0495635_0049871 3300046663 Bacteria 2885
572 Ga0495635_0067988 3300046663 Bacteria 2443
573 Ga0495657_0000025 3300046675 Bacteria 140749
574 Ga0495657_0008224 3300046675 Bacteria 7995
575 Ga0495657_0028111 3300046675 Bacteria 3959
576 Ga0495657_0101076 3300046675 Bacteria 1837
577 Ga0495599_0000026 3300046678 Bacteria 117515
578 Ga0495599_0074101 3300046678 Bacteria 2125
579 Ga0495599_0164100 3300046678 Bacteria 1372
580 Ga0495623_0011992 3300046679 Bacteria 5615
581 Ga0495623_0028069 3300046679 Bacteria 3623
582 Ga0495623_0032332 3300046679 Bacteria 3363
583 Ga0495623_0040526 3300046679 Bacteria 2974
584 Ga0495646_0022585 3300046680 Bacteria 3967
585 Ga0495646_0026319 3300046680 Bacteria 3653
586 Ga0495647_0026350 3300046681 Bacteria 2129
587 Ga0495658_0096129 3300046683 Bacteria 1761
588 Ga0495658_0126445 3300046683 Bacteria 1551
589 Ga0495613_0048939 3300046689 Bacteria 3120
590 Ga0495613_0062172 3300046689 Bacteria 2733
591 Ga0495624_0008725 3300046690 Bacteria 7058
592 Ga0495649_0130995 3300046694 Bacteria 1323
593 Ga0495600_0009310 3300046809 Bacteria 6066
594 Ga0495600_0013054 3300046809 Bacteria 5212
595 Ga0495581_0013860 3300047315 Bacteria 4672
596 Ga0495581_0028203 3300047315 Bacteria 3254
597 Ga0495581_0050380 3300047315 Bacteria 2405
598 Ga0495604_0000029 3300047317 Bacteria 140740
599 Ga0495604_0018562 3300047317 Bacteria 5572
600 Ga0495604_0020427 3300047317 Bacteria 5289
601 Ga0495604_0027841 3300047317 Bacteria 4494
602 Ga0495604_0081446 3300047317 Bacteria 2423
603 Ga0495674_0051405 3300047319 Bacteria 3633
604 Ga0495674_0097698 3300047319 Bacteria 2501
605 Ga0495674_0115174 3300047319 Bacteria 2275
606 Ga0495674_0355294 3300047319 Bacteria 1189
607 Ga0495672_0004299 3300047320 Bacteria 11736
608 Ga0495680_0000011 3300047322 Bacteria 140733
609 Ga0495680_0020836 3300047322 Bacteria 5503
610 Ga0495680_0021928 3300047322 Bacteria 5337
611 Ga0495680_0103383 3300047322 Bacteria 2120
612 Ga0495680_0132111 3300047322 Bacteria 1833
613 Ga0495675_0002129 3300047444 Bacteria 11802
614 Ga0495675_0006159 3300047444 Bacteria 7342
615 Ga0495675_0030412 3300047444 Bacteria 3446
616 Ga0495673_0032003 3300047469 Bacteria 2457
617 Ga0495684_0018241 3300047471 Bacteria 5407
618 Ga0495684_0052550 3300047471 Bacteria 3109
619 Ga0495684_0121943 3300047471 Bacteria 1962
620 Ga0495686_0002494 3300047472 Bacteria 17289
621 Ga0495686_0105132 3300047472 Bacteria 1699
622 Ga0495593_0002460 3300047673 Bacteria 11139
623 Ga0495593_0004529 3300047673 Bacteria 8256
624 Ga0495602_0000033 3300048088 Bacteria 140750
625 Ga0495602_0005132 3300048088 Bacteria 13716
626 Ga0495602_0015171 3300048088 Bacteria 7787
627 Ga0495602_0019513 3300048088 Bacteria 6725
628 Ga0495602_0069304 3300048088 Bacteria 3023
629 Ga0495602_0088182 3300048088 Bacteria 2583
630 Ga0496100_0000176 3300048903 Bacteria 35625
631 Ga0496100_0000368 3300048903 Bacteria 21913
632 Ga0496100_0004795 3300048903 Bacteria 7222
633 Ga0496100_0113541 3300048903 Bacteria 1886
634 Ga0496101_0000071 3300048904 Bacteria 119709
635 Ga0496101_0008296 3300048904 Bacteria 6787
636 Ga0496101_0023810 3300048904 Bacteria 4234
637 Ga0496101_0026443 3300048904 Bacteria 4035
638 Ga0496101_0089526 3300048904 Bacteria 2287
639 Ga0496102_0000026 3300048905 Bacteria 227176
640 Ga0496102_0003987 3300048905 Bacteria 12502
641 Ga0496102_0006326 3300048905 Bacteria 10098
642 Ga0496102_0006364 3300048905 Bacteria 10069
643 Ga0496102_0143583 3300048905 Bacteria 2239
644 Ga0496102_0148723 3300048905 Bacteria 2199
645 Ga0496102_0193821 3300048905 Bacteria 1915
646 Ga0496102_0509231 3300048905 Bacteria 1126
647 Ga0496103_0000023 3300048906 Bacteria 227174
648 Ga0496103_0001569 3300048906 Bacteria 15110
649 Ga0496103_0002015 3300048906 Bacteria 13086
650 Ga0496103_0083433 3300048906 Bacteria 2012
651 Ga0496104_0001055 3300048907 Bacteria 23503
652 Ga0496104_0001269 3300048907 Bacteria 21767
653 Ga0496104_0002751 3300048907 Bacteria 15144
654 Ga0496104_0086725 3300048907 Bacteria 2988
655 Ga0496105_0003056 3300048908 Bacteria 12299
656 Ga0496105_0169524 3300048908 Bacteria 1790
657 Ga0496105_0284819 3300048908 Bacteria 1331
658 Ga0496106_0002448 3300048909 Bacteria 13834
659 Ga0496106_0005596 3300048909 Bacteria 9302
660 Ga0496106_0131997 3300048909 Bacteria 1959
661 Ga0496106_0180579 3300048909 Bacteria 1675
662 Ga0496106_0323153 3300048909 Bacteria 1239
663 Ga0496107_0001141 3300048910 Bacteria 16081
664 Ga0496107_0010192 3300048910 Bacteria 6519
665 Ga0496107_0031130 3300048910 Bacteria 3805
666 Ga0496107_0032822 3300048910 Bacteria 3712
667 Ga0496107_0049200 3300048910 Bacteria 3037
668 Ga0496107_0273805 3300048910 Bacteria 1256
669 Ga0496108_0002331 3300048911 Bacteria 15211
670 Ga0496108_0008845 3300048911 Bacteria 8160
671 Ga0496108_0034414 3300048911 Bacteria 4210
672 Ga0496108_0057523 3300048911 Bacteria 3267
673 Ga0496108_0151340 3300048911 Bacteria 2002
674 Ga0496109_0006775 3300048912 Bacteria 9649
675 Ga0496109_0009599 3300048912 Bacteria 8252
676 Ga0496109_0196010 3300048912 Bacteria 1898
677 Ga0496110_0121939 3300048913 Bacteria 2349
678 Ga0496110_0239826 3300048913 Bacteria 1650
679 Ga0496111_0096414 3300048914 Bacteria 2171
680 Ga0496112_0047977 3300048915 Bacteria 4189
681 Ga0496112_0053062 3300048915 Bacteria 3980
682 Ga0496112_0094316 3300048915 Bacteria 2963
683 Ga0496112_0408214 3300048915 Bacteria 1298
684 Ga0496113_0005807 3300048916 Bacteria 7744
685 Ga0496113_0045551 3300048916 Bacteria 3253
686 Ga0496113_0135838 3300048916 Bacteria 1932
687 Ga0496114_0001200 3300048917 Bacteria 19603
688 Ga0496114_0001416 3300048917 Bacteria 18203
689 Ga0496114_0047181 3300048917 Bacteria 3582
690 Ga0496114_0206197 3300048917 Bacteria 1723
691 Ga0496114_0258066 3300048917 Bacteria 1534
692 Ga0496115_0000351 3300048918 Bacteria 38720
693 Ga0496115_0026265 3300048918 Bacteria 4543
694 Ga0496115_0026676 3300048918 Bacteria 4511
695 Ga0496115_0427422 3300048918 Bacteria 1072
696 Ga0496116_0000018 3300048919 Bacteria 545877
697 Ga0496116_0014006 3300048919 Bacteria 6423
698 Ga0496117_0000015 3300048920 Bacteria 583316
699 Ga0496117_0006653 3300048920 Bacteria 11583
700 Ga0496117_0044676 3300048920 Bacteria 3207
701 Ga0496118_0000012 3300048921 Bacteria 583316
702 Ga0496118_0000295 3300048921 Bacteria 86668
703 Ga0496118_0005225 3300048921 Bacteria 14852
704 Ga0496119_0000238 3300048922 Bacteria 77684
705 Ga0496119_0027216 3300048922 Bacteria 3936
706 Ga0496120_0000352 3300048923 Bacteria 75803
707 Ga0496120_0174143 3300048923 Bacteria 1062
708 Ga0496121_0000062 3300048924 Bacteria 274819
709 Ga0496121_0006304 3300048924 Bacteria 14821
710 Ga0496122_0114273 3300048925 Bacteria 1761
711 Ga0496123_0018873 3300048926 Bacteria 5460
712 Ga0496125_0033792 3300048928 Bacteria 4518
713 Ga0496126_0000227 3300048929 Bacteria 122133
714 Ga0496126_0003537 3300048929 Bacteria 19650
715 Ga0496126_0019816 3300048929 Bacteria 6616
716 Ga0496126_0064645 3300048929 Bacteria 3276
717 Ga0496126_0162410 3300048929 Bacteria 1908
718 Ga0501032_0000888 3300049569 Bacteria 24229
719 Ga0501032_0012592 3300049569 Bacteria 6039
720 Ga0501033_0056891 3300049570 Bacteria 2890
721 Ga0501034_0008627 3300049571 Bacteria 10754
722 Ga0501034_0009084 3300049571 Bacteria 10439
723 Ga0501034_0016271 3300049571 Bacteria 7634
724 Ga0501034_0041216 3300049571 Bacteria 4672
725 Ga0501034_0385610 3300049571 Bacteria 1326
726 Ga0501036_0005804 3300049572 Bacteria 10004
727 Ga0501036_0006203 3300049572 Bacteria 9701
728 Ga0501036_0174448 3300049572 Bacteria 1810
729 Ga0501037_0000357 3300049573 Bacteria 38443
730 Ga0501037_0004324 3300049573 Bacteria 10306
731 Ga0501038_0004574 3300049574 Bacteria 12874
732 Ga0501038_0037880 3300049574 Bacteria 4225
733 Ga0501038_0213195 3300049574 Bacteria 1544
734 Ga0501039_0000574 3300049575 Bacteria 26556
735 Ga0501043_0000276 3300049579 Bacteria 46306
736 Ga0501043_0005127 3300049579 Bacteria 10604
737 Ga0501043_0060127 3300049579 Bacteria 2982
738 Ga0501043_0153131 3300049579 Bacteria 1804
739 Ga0501046_0067766 3300049580 Bacteria 2778
740 Ga0501046_0178963 3300049580 Bacteria 1587
741 Ga0501046_0219055 3300049580 Bacteria 1410
742 Ga0501047_0018844 3300049581 Bacteria 6621
743 Ga0501047_0070043 3300049581 Bacteria 3376
744 Ga0501047_0186235 3300049581 Bacteria 1941
745 Ga0501048_0001664 3300049582 Bacteria 16925
746 Ga0501069_0205661 3300049585 Bacteria 1141
747 Ga0501070_0016317 3300049586 Bacteria 6237
748 Ga0501070_0110110 3300049586 Bacteria 2276
749 Ga0501073_0063546 3300049589 Bacteria 2575
750 Ga0501073_0095808 3300049589 Bacteria 2061
751 Ga0501080_0094522 3300049742 Bacteria 2776
752 Ga0501083_0055040 3300049744 Bacteria 2669
753 Ga0501035_0005095 3300049822 Bacteria 12443
754 Ga0501035_0084764 3300049822 Bacteria 2794
755 Ga0501044_0006249 3300049823 Bacteria 13166
756 Ga0501044_0027478 3300049823 Bacteria 6012
757 Ga0501044_0050634 3300049823 Bacteria 4284
758 Ga0501044_0066912 3300049823 Bacteria 3662
759 Ga0501044_0185754 3300049823 Bacteria 2044
760 Ga0501044_0356212 3300049823 Bacteria 1382
761 nmdc:mga03683_46491_c1 3300050489 Bacteria 1799
762 nmdc:mga03n38_25366_c1 3300050490 Bacteria 2433
763 nmdc:mga03n38_8811_c1 3300050490 Bacteria 3639
764 nmdc:mga00v17_126655_c1 3300050491 Bacteria 1630
765 nmdc:mga00v17_16244_c1 3300050491 Bacteria 4195
766 nmdc:mga00v17_240726_c1 3300050491 Bacteria 1173
767 nmdc:mga00v17_27500_c1 3300050491 Bacteria 3321
768 nmdc:mga00v17_48346_c1 3300050491 Bacteria 2578
769 nmdc:mga00v17_73742_c1 3300050491 Bacteria 2120
770 nmdc:mga0yw44_14316_c1 3300050492 Bacteria 4209
771 nmdc:mga0yw44_315421_c1 3300050492 Bacteria 1049
772 nmdc:mga0yw44_78115_c1 3300050492 Bacteria 2069
773 nmdc:mga07m45_16949_c1 3300050496 Bacteria 3905
774 nmdc:mga07m45_21175_c1 3300050496 Bacteria 3537
775 nmdc:mga07m45_2336_c1 3300050496 Bacteria 8891
776 nmdc:mga07m45_6888_c1 3300050496 Bacteria 1651
777 nmdc:mga05p37_46428_c1 3300050507 Bacteria 5341
778 nmdc:mga0qj67_108849_c1 3300050509 Bacteria 2236
779 nmdc:mga0qj67_8759_c1 3300050509 Bacteria 7508
780 nmdc:mga06r32_130143_c1 3300050510 Bacteria 2488
781 nmdc:mga0n895_39273_c1 3300050512 Bacteria 4592
782 nmdc:mga0n895_68037_c1 3300050512 Bacteria 3528
783 nmdc:mga08x19_3592_c1 3300050514 Bacteria 9227
784 nmdc:mga0a205_66053_c1 3300050515 Bacteria 3495
785 nmdc:mga0sz30_1773_c1 3300050516 Bacteria 7659
786 nmdc:mga0sz30_2736_c1 3300050516 Bacteria 5867
787 nmdc:mga0sz30_37886_c1 3300050516 Bacteria 2019
788 nmdc:mga0sz30_49153_c1 3300050516 Bacteria 1786
789 nmdc:mga0sz30_5748_c1 3300050516 Bacteria 4567
790 Ga0495601_0003453 3300053077 Bacteria 9060
791 Ga0495601_0015018 3300053077 Bacteria 4677
792 Ga0495612_0002225 3300053078 Bacteria 7976
793 Ga0495655_0038702 3300053083 Bacteria 1205
794 Ga0495595_0000998 3300053084 Bacteria 10932
795 Ga0495595_0002982 3300053084 Bacteria 6685
796 Ga0495595_0019055 3300053084 Bacteria 2973
797 Ga0495619_0008087 3300053085 Bacteria 6656
798 Ga0495619_0023053 3300053085 Bacteria 3987
799 Ga0500643_019143 3300053087 Bacteria 2260
800 Ga0500616_0002196 3300053153 Bacteria 16795
801 Ga0500616_0107672 3300053153 Bacteria 1351
802 Ga0500645_000152 3300053730 Bacteria 53929
803 Ga0501084_0250937 3300054114 Bacteria 1494
804 Ga0466962_0001670 3300061719 Bacteria 10409
805 Ga0466962_0047643 3300061719 Bacteria 2048
806 Ga0466962_0114489 3300061719 Bacteria 1299
807 2644488552 2643221687 Bacteria 6500351
808 2644639791 2643221715 Bacteria 6671032
809 2676494361 2675903060 Bacteria 10051191
810 2738703392 2738541274 Bacteria 6909446
811 2739329149 2738543028 Bacteria 6917070
812 2842136327 2842134933 Bacteria 5847019
813 2856742111 2856741275 Bacteria 8096094
814 2873321865 2873314349 Bacteria 8512634
815 2884695210 2884693830 Bacteria 11273186
816 2891401531 2891395885 Bacteria 9251614
817 2891555145 2891554331 Bacteria 8812224
818 2891566776 2891562705 Bacteria 8039471
819 2895432462 2895427314 Bacteria 13147766
820 2895446082 2895442618 Bacteria 11027144
821 2902795519 2902792274 Bacteria 7270173
822 2902800249 2902799365 Bacteria 5419524
823 2902811083 2902810491 Bacteria 6794147
824 2902842736 2902837492 Bacteria 6697721
825 2929218263 2929212328 Bacteria 7708288
826 2939583925 2939582691 Bacteria 7088898
827 8053948998 8053945823 Bacteria 8962862
828 8055071533 8055066027 Bacteria 9479577
829 8055174860 8055172936 Bacteria 9305943
830 8056061506 8056060235 Bacteria 7259403
831 Ga0075369_10000542
832 JGI24744J21845_10000843
833 JGI24742J22300_10007086
834 JGI24751J29686_10009233
835 Ga0055540_1000751
836 Ga0070658_10369315
837 Ga0070676_10001758
838 Ga0070676_10076873
839 Ga0070683_100330357
840 Ga0070690_100007386
841 Ga0070670_100121966
842 Ga0068869_100102475
843 Ga0070666_10001180
844 Ga0070682_100004076
845 Ga0068868_100002553
846 Ga0068868_100023036
847 Ga0070660_100024308
848 Ga0070689_100001468
849 Ga0070691_10001233
850 Ga0070692_10071240
851 Ga0070668_100001731
852 Ga0070668_100008810
853 Ga0070668_100215602
854 Ga0070669_100005294
855 Ga0070671_100003966
856 Ga0070671_100059295
857 Ga0070671_100137648
858 Ga0070671_100149833
859 Ga0070674_100001547
860 Ga0070688_100016198
861 Ga0070659_100000157
862 Ga0070659_100007108
863 Ga0070667_100002788
864 Ga0070667_100012517
865 Ga0070667_100026501
866 Ga0070709_10000585
867 Ga0070709_10021563
868 Ga0070709_10028065
869 Ga0070714_100000623
870 Ga0070714_100006030
871 Ga0070714_100010693
872 Ga0070714_100015312
873 Ga0070714_100058888
874 Ga0070714_100078995
875 Ga0070714_100100001
876 Ga0070714_100279046
877 Ga0070713_100011669
878 Ga0070713_100036078
879 Ga0070713_100050524
880 Ga0070713_100301679
881 Ga0070713_100410236
882 Ga0070710_10000425
883 Ga0070710_10003324
884 Ga0070710_10008156
885 Ga0070710_10012804
886 Ga0070710_10151561
887 Ga0070701_10028008
888 Ga0070711_100001076
889 Ga0070711_100003424
890 Ga0070711_100023223
891 Ga0070705_100002157
892 Ga0070705_100243802
893 Ga0070700_100010716
894 Ga0070694_100072875
895 Ga0070708_100004109
896 Ga0070708_100014318
897 Ga0070708_100034887
898 Ga0070708_100039109
899 Ga0070708_100119587
900 Ga0070708_100281316
901 Ga0070663_100020361
902 Ga0070663_100057343
903 Ga0070678_100000661
904 Ga0070678_100076050
905 Ga0070678_100091875
906 Ga0070662_100128404
907 Ga0068867_100003005
908 Ga0068867_100432461
909 Ga0070706_100002953
910 Ga0070706_100003936
911 Ga0070706_100004325
912 Ga0070706_100007743
913 Ga0070706_100009304
914 Ga0070707_100000788
915 Ga0070707_100004079
916 Ga0070707_100033657
917 Ga0070707_100115978
918 Ga0070698_100000080
919 Ga0070698_100002105
920 Ga0070698_100004969
921 Ga0070698_100007313
922 Ga0070698_100059333
923 Ga0070699_100024618
924 Ga0070679_100114263
925 Ga0070684_100033725
926 Ga0070697_100012470
927 Ga0068853_100005376
928 Ga0068853_100352433
929 Ga0070695_100013477
930 Ga0070695_100043470
931 Ga0070696_100007819
932 Ga0070696_100046982
933 Ga0070696_100077561
934 Ga0070693_100005084
935 Ga0070665_100009474
936 Ga0070665_100072015
937 Ga0070704_100000337
938 Ga0070704_100108483
939 Ga0068855_100127637
940 Ga0068855_100189360
941 Ga0068857_100153615
942 Ga0068854_100004018
943 Ga0068854_100091842
944 Ga0068854_100210699
945 Ga0070702_100000269
946 Ga0070702_100175791
947 Ga0068852_100277312
948 Ga0068859_100008304
949 Ga0068859_100060506
950 Ga0068864_100296325
951 Ga0068866_10000952
952 Ga0068861_100000769
953 Ga0068861_100028894
954 Ga0068861_100052856
955 Ga0068863_100004130
956 Ga0068863_100007926
957 Ga0068863_100547921
958 Ga0068858_100030282
959 Ga0068858_100096681
960 Ga0068858_100109697
961 Ga0068858_100285880
962 Ga0068860_100000986
963 Ga0068860_100004025
964 Ga0068862_100000024
965 Ga0068862_100276785
966 Ga0068862_100284984
967 Ga0081455_10011728
968 Ga0081455_10041186
969 Ga0070717_10004963
970 Ga0070717_10010850
971 Ga0070717_10028100
972 Ga0070717_10040741
973 Ga0070717_10048033
974 Ga0070717_10310201
975 Ga0075365_10013609
976 Ga0075365_10065472
977 Ga0075365_10087617
978 Ga0075365_10107905
979 Ga0075365_10154526
980 Ga0075363_100000956
981 Ga0075363_100004063
982 Ga0075364_10006975
983 Ga0075364_10009189
984 Ga0075364_10017701
985 Ga0075364_10022608
986 Ga0070715_10000998
987 Ga0070715_10002776
988 Ga0070715_10008985
989 Ga0070716_100000358
990 Ga0070716_100003074
991 Ga0070716_100003659
992 Ga0070712_100006379
993 Ga0070712_100011811
994 Ga0070712_100147988
995 Ga0070712_100225079
996 Ga0075362_10068365
997 Ga0075367_10011068
998 Ga0075369_10001209
999 Ga0075369_10002619
1000 Ga0075369_10003179
1001 Ga0075369_10004619
1002 Ga0075369_10005746
1003 Ga0075369_10051963
1004 Ga0075369_10098097
1005 Ga0097621_100125163
1006 Ga0097621_100305105
1007 Ga0075370_10017532
1008 Ga0075370_10018885
1009 Ga0075370_10100666
1010 Ga0068871_100027012
1011 Ga0068871_100116803
1012 Ga0068871_100251728
1013 Ga0075428_100003675
1014 Ga0075430_100001881
1015 Ga0075430_100060950
1016 Ga0075431_100119129
1017 Ga0075433_10064256
1018 Ga0075433_10074231
1019 Ga0075434_100002503
1020 Ga0075434_100025854
1021 Ga0068865_100002154
1022 Ga0068865_100035172
1023 Ga0075436_100013319
1024 Ga0075436_100070490
1025 Ga0097620_100008304
1026 Ga0097620_100060507
1027 Ga0075435_100008942
1028 Ga0075435_100053740
1029 Ga0105250_10018077
1030 Ga0105250_10024606
1031 Ga0105245_10002048
1032 Ga0105245_10028471
1033 Ga0105247_10001811
1034 Ga0105247_10005206
1035 Ga0105247_10060103
1036 Ga0114129_10031070
1037 Ga0105243_10002552
1038 Ga0105243_10135370
1039 Ga0105241_10057475
1040 Ga0105241_10110891
1041 Ga0105242_10001021
1042 Ga0105248_10004705
1043 Ga0105248_10008152
1044 Ga0105248_10058679
1045 Ga0105237_10001600
1046 Ga0105249_10000223
1047 Ga0105249_10000977
1048 Ga0105249_10286806
1049 Ga0105239_10003140
1050 Ga0105239_10075770
1051 Ga0105246_10248673
1052 Ga0157369_10001338
1053 Ga0157369_10133839
1054 Ga0157374_10136617
1055 Ga0157378_10021574
1056 Ga0163162_10004880
1057 Ga0163162_10038529
1058 Ga0157372_10012920
1059 Ga0157372_10101953
1060 Ga0157375_10001069
1061 Ga0157375_10069233
1062 Ga0157375_10091595
1063 Ga0163163_10036468
1064 Ga0163163_10226620
1065 Ga0157380_10000535
1066 Ga0157379_10049535
1067 Ga0157379_10218033
1068 Ga0157376_10354410
1069 Ga0163161_10001057
1070 Ga0206353_10073283
1071 Ga0213876_10006722
1072 Ga0213876_10013978
1073 Ga0213876_10021776
1074 Ga0213875_10056025
1075 Ga0224572_1014555
1076 Ga0209673_1011387
1077 Ga0209051_1000915
1078 Ga0209051_1001195
1079 Ga0209051_1002804
1080 Ga0209051_1034510
1081 Ga0207692_10016070
1082 Ga0207692_10016187
1083 Ga0207692_10051645
1084 Ga0207692_10080546
1085 Ga0207642_10000265
1086 Ga0207710_10000978
1087 Ga0207710_10027897
1088 Ga0207688_10000510
1089 Ga0207688_10003926
1090 Ga0207680_10008385
1091 Ga0207685_10005116
1092 Ga0207685_10010517
1093 Ga0207685_10021443
1094 Ga0207699_10000265
1095 Ga0207699_10003028
1096 Ga0207699_10007650
1097 Ga0207699_10017348
1098 Ga0207699_10042440
1099 Ga0207699_10359366
1100 Ga0207645_10014321
1101 Ga0207645_10089181
1102 Ga0207684_10000794
1103 Ga0207684_10002656
1104 Ga0207684_10003644
1105 Ga0207684_10422627
1106 Ga0207707_10243593
1107 Ga0207671_10010290
1108 Ga0207693_10002276
1109 Ga0207693_10002519
1110 Ga0207693_10006356
1111 Ga0207693_10006886
1112 Ga0207693_10050063
1113 Ga0207693_10063981
1114 Ga0207693_10122446
1115 Ga0207663_10007780
1116 Ga0207663_10023291
1117 Ga0207663_10119773
1118 Ga0207657_10068750
1119 Ga0207657_10136140
1120 Ga0207646_10003025
1121 Ga0207646_10008153
1122 Ga0207646_10230497
1123 Ga0207646_10287701
1124 Ga0207681_10011692
1125 Ga0207681_10074187
1126 Ga0207659_10218881
1127 Ga0207687_10003994
1128 Ga0207687_10015740
1129 Ga0207700_10000508
1130 Ga0207700_10003489
1131 Ga0207700_10020620
1132 Ga0207700_10031487
1133 Ga0207700_10086253
1134 Ga0207700_10100560
1135 Ga0207664_10000557
1136 Ga0207664_10002126
1137 Ga0207664_10018737
1138 Ga0207664_10022538
1139 Ga0207664_10037766
1140 Ga0207664_10044826
1141 Ga0207664_10062645
1142 Ga0207664_10101544
1143 Ga0207664_10149966
1144 Ga0207644_10034935
1145 Ga0207644_10098609
1146 Ga0207690_10000804
1147 Ga0207690_10009353
1148 Ga0207706_10005788
1149 Ga0207706_10057701
1150 Ga0207686_10081963
1151 Ga0207709_10059379
1152 Ga0207709_10170396
1153 Ga0207670_10046258
1154 Ga0207669_10001626
1155 Ga0207704_10001088
1156 Ga0207665_10000457
1157 Ga0207665_10002698
1158 Ga0207665_10024938
1159 Ga0207665_10031529
1160 Ga0207711_10002878
1161 Ga0207711_10006473
1162 Ga0207711_10098992
1163 Ga0207689_10142675
1164 Ga0207667_10074577
1165 Ga0207667_10494434
1166 Ga0207712_10000183
1167 Ga0207712_10016381
1168 Ga0207668_10005410
1169 Ga0207668_10005815
1170 Ga0207668_10022205
1171 Ga0207640_10005268
1172 Ga0207640_10338777
1173 Ga0207658_10002038
1174 Ga0207658_10010419
1175 Ga0207658_10027480
1176 Ga0207658_10069469
1177 Ga0207658_10092563
1178 Ga0207703_10003757
1179 Ga0207703_10018721
1180 Ga0207639_10007568
1181 Ga0207678_10019661
1182 Ga0207678_10033916
1183 Ga0207678_10060592
1184 Ga0207678_10072335
1185 Ga0207708_10010880
1186 Ga0207708_10037494
1187 Ga0207708_10118380
1188 Ga0207702_10197287
1189 Ga0207641_10000164
1190 Ga0207641_10004062
1191 Ga0207641_10067942
1192 Ga0207648_10008901
1193 Ga0207648_10039066
1194 Ga0207676_10310162
1195 Ga0207674_10023630
1196 Ga0207675_100000735
1197 Ga0207675_100043909
1198 Ga0207675_100046021
1199 Ga0207683_10003492
1200 Ga0207683_10029822
1201 Ga0207683_10235231
1202 Ga0207698_10197193
1203 Ga0268266_10007294
1204 Ga0268266_10043937
1205 Ga0268266_10165270
1206 Ga0268265_10000012
1207 Ga0268265_10016078
1208 Ga0268265_10068422
1209 Ga0268265_10093601
1210 Ga0268264_10002220
1211 Ga0268264_10002837
1212 Ga0265338_10006589
1213 Ga0265338_10113554
1214 Ga0265327_10000253
1215 Ga0265327_10005089
1216 Ga0307413_10088537
1217 Ga0307410_10042450
1218 Ga0307407_10033107
1219 Ga0307409_100014255
1220 Ga0307409_100287633
1221 Ga0307411_10005213
1222 Ga0373958_0003699
1223 Ga0373938_0028155
1224 Ga0373926_0007557
1225 Ga0373926_0020016
1226 Ga0373926_0028500
1227 Ga0373934_0006291
1228 Ga0373944_0024703
1229 Ga0373949_0015351
1230 Ga0373936_0001008
1231 Ga0373941_0013580
1232 Ga0373945_0046934
1233 Ga0373945_0066495
1234 Ga0373953_0000029
1235 Ga0373953_0007048
1236 Ga0373954_0001513
1237 Ga0373954_0067243
1238 Ga0373956_0001824
1239 Ga0373956_0044552
1240 Ga0373957_0000265
1241 Ga0373957_0000549
1242 Ga0373957_0010584
1243 Ga0373960_0002072
1244 Ga0373943_0027860
1245 Ga0373955_0000019
1246 Ga0373955_0059506
1247 Ga0373955_0091928
1248 Ga0373924_0000550
1249 Ga0373924_0000714
1250 Ga0373924_0044499
1251 Ga0373931_0015983
1252 Ga0373931_0113321
1253 Ga0373935_0000760
1254 Ga0373935_0008336
1255 Ga0373935_0096995
1256 Ga0373933_0000027
1257 Ga0373933_0000743
1258 Ga0373933_0002967
1259 Ga0373933_0005791
1260 Ga0373933_0079733
1261 Ga0373933_0219326
1262 Ga0373947_0000011
1263 Ga0373937_0000147
1264 Ga0373937_0008463
1265 Ga0373937_0010863
1266 Ga0373937_0060764
1267 Ga0373937_0176375
1268 Ga0316584_0055319
1269 Ga0373925_0016037
1270 Ga0436364_0257076
1271 Ga0436364_0275228
1272 Ga0436364_0467668
1273 Ga0436364_0586846
1274 Ga0436365_0802105
1275 Ga0436365_0878752
1276 Ga0436365_1041061
1277 Ga0436365_1781330
1278 Ga0436363_0763127
1279 Ga0439466_0001056
1280 Ga0439466_0003851
1281 Ga0439465_0000181
1282 Ga0439465_0000671
1283 Ga0439465_0007570
1284 Ga0451789_1046045
1285 Ga0439431_0000973
1286 Ga0439431_0015197
1287 Ga0439442_002122
1288 Ga0439445_0004489
1289 Ga0439445_0008372
1290 Ga0439434_0004267
1291 Ga0439434_0013227
1292 Ga0439459_0001441
1293 Ga0466972_0006817
1294 Ga0466972_0021368
1295 Ga0466972_0131829
1296 Ga0466965_0003873
1297 Ga0466965_0017263
1298 Ga0466966_0011746
1299 Ga0466966_0036239
1300 Ga0466966_0038858
1301 Ga0466961_0019831
1302 Ga0466961_0066161
1303 Ga0466963_0021871
1304 Ga0466963_0024694
1305 Ga0466964_0016700
1306 Ga0466964_0052948
1307 Ga0466971_0004415
1308 Ga0466971_0008526
1309 Ga0466968_0000600
1310 Ga0466968_0004823
1311 Ga0466968_0005509
1312 Ga0466970_0005182
1313 Ga0466970_0017859
1314 Ga0466957_0006411
1315 Ga0466957_0030961
1316 Ga0466957_0123104
1317 Ga0466960_0000192
1318 Ga0466960_0000377
1319 Ga0466960_0006191
1320 Ga0466960_0030250
1321 Ga0466960_0053361
1322 Ga0466959_0000865
1323 Ga0466959_0031944
1324 Ga0466959_0048631
1325 Ga0466959_0104713
1326 Ga0466958_0007105
1327 Ga0466958_0009021
1328 Ga0466958_0068825
1329 Ga0466967_0000402
1330 Ga0466967_0006840
1331 Ga0466967_0008059
1332 Ga0466967_0018601
1333 Ga0466967_0061469
1334 Ga0466967_0176278
1335 Ga0466967_0201533
1336 Ga0466967_0352293
1337 Ga0495592_0000019
1338 Ga0495592_0034634
1339 Ga0495592_0085131
1340 Ga0495603_0029858
1341 Ga0495629_0008983
1342 Ga0495629_0009495
1343 Ga0495629_0178202
1344 Ga0495629_0434028
1345 Ga0495638_0000956
1346 Ga0495641_0026147
1347 Ga0495641_0029287
1348 Ga0495651_0000012
1349 Ga0495651_0015040
1350 Ga0495651_0030433
1351 Ga0495651_0072601
1352 Ga0495653_0006940
1353 Ga0495653_0012214
1354 Ga0495653_0088674
1355 Ga0495582_0001916
1356 Ga0495582_0017468
1357 Ga0495639_0014575
1358 Ga0495639_0099765
1359 Ga0495639_0116913
1360 Ga0495662_0002768
1361 Ga0495664_0014482
1362 Ga0495664_0017826
1363 Ga0495594_0107194
1364 Ga0495606_0019704
1365 Ga0495608_0000048
1366 Ga0495608_0015396
1367 Ga0495618_0021635
1368 Ga0495618_0082233
1369 Ga0495628_0000053
1370 Ga0495628_0072798
1371 Ga0495628_0174589
1372 Ga0495630_0146499
1373 Ga0495666_0026551
1374 Ga0495652_0000230
1375 Ga0495652_0060905
1376 Ga0495652_0063424
1377 Ga0495652_0127357
1378 Ga0495665_0006664
1379 Ga0495665_0010794
1380 Ga0495640_0024780
1381 Ga0495640_0034285
1382 Ga0495640_0096776
1383 Ga0495586_0043216
1384 Ga0495587_0000027
1385 Ga0495587_0010009
1386 Ga0495587_0029168
1387 Ga0495587_0067399
1388 Ga0495587_0096144
1389 Ga0495645_0008025
1390 Ga0495645_0086681
1391 Ga0495667_0000089
1392 Ga0495667_0017884
1393 Ga0495667_0018600
1394 Ga0495667_0041867
1395 Ga0495667_0231993
1396 Ga0495634_0052391
1397 Ga0495634_0053527
1398 Ga0495611_0080032
1399 Ga0495635_0035058
1400 Ga0495635_0048939
1401 Ga0495635_0049871
1402 Ga0495635_0067988
1403 Ga0495657_0000025
1404 Ga0495657_0008224
1405 Ga0495657_0028111
1406 Ga0495657_0101076
1407 Ga0495599_0000026
1408 Ga0495599_0074101
1409 Ga0495599_0164100
1410 Ga0495623_0011992
1411 Ga0495623_0028069
1412 Ga0495623_0032332
1413 Ga0495623_0040526
1414 Ga0495646_0022585
1415 Ga0495646_0026319
1416 Ga0495647_0026350
1417 Ga0495658_0096129
1418 Ga0495658_0126445
1419 Ga0495613_0048939
1420 Ga0495613_0062172
1421 Ga0495624_0008725
1422 Ga0495649_0130995
1423 Ga0495600_0009310
1424 Ga0495600_0013054
1425 Ga0495581_0013860
1426 Ga0495581_0028203
1427 Ga0495581_0050380
1428 Ga0495604_0000029
1429 Ga0495604_0018562
1430 Ga0495604_0020427
1431 Ga0495604_0027841
1432 Ga0495604_0081446
1433 Ga0495674_0051405
1434 Ga0495674_0097698
1435 Ga0495674_0115174
1436 Ga0495674_0355294
1437 Ga0495672_0004299
1438 Ga0495680_0000011
1439 Ga0495680_0020836
1440 Ga0495680_0021928
1441 Ga0495680_0103383
1442 Ga0495680_0132111
1443 Ga0495675_0002129
1444 Ga0495675_0006159
1445 Ga0495675_0030412
1446 Ga0495673_0032003
1447 Ga0495684_0018241
1448 Ga0495684_0052550
1449 Ga0495684_0121943
1450 Ga0495686_0002494
1451 Ga0495686_0105132
1452 Ga0495593_0002460
1453 Ga0495593_0004529
1454 Ga0495602_0000033
1455 Ga0495602_0005132
1456 Ga0495602_0015171
1457 Ga0495602_0019513
1458 Ga0495602_0069304
1459 Ga0495602_0088182
1460 Ga0496100_0000176
1461 Ga0496100_0000368
1462 Ga0496100_0004795
1463 Ga0496100_0113541
1464 Ga0496101_0000071
1465 Ga0496101_0008296
1466 Ga0496101_0023810
1467 Ga0496101_0026443
1468 Ga0496101_0089526
1469 Ga0496102_0000026
1470 Ga0496102_0003987
1471 Ga0496102_0006326
1472 Ga0496102_0006364
1473 Ga0496102_0143583
1474 Ga0496102_0148723
1475 Ga0496102_0193821
1476 Ga0496102_0509231
1477 Ga0496103_0000023
1478 Ga0496103_0001569
1479 Ga0496103_0002015
1480 Ga0496103_0083433
1481 Ga0496104_0001055
1482 Ga0496104_0001269
1483 Ga0496104_0002751
1484 Ga0496104_0086725
1485 Ga0496105_0003056
1486 Ga0496105_0169524
1487 Ga0496105_0284819
1488 Ga0496106_0002448
1489 Ga0496106_0005596
1490 Ga0496106_0131997
1491 Ga0496106_0180579
1492 Ga0496106_0323153
1493 Ga0496107_0001141
1494 Ga0496107_0010192
1495 Ga0496107_0031130
1496 Ga0496107_0032822
1497 Ga0496107_0049200
1498 Ga0496107_0273805
1499 Ga0496108_0002331
1500 Ga0496108_0008845
1501 Ga0496108_0034414
1502 Ga0496108_0057523
1503 Ga0496108_0151340
1504 Ga0496109_0006775
1505 Ga0496109_0009599
1506 Ga0496109_0196010
1507 Ga0496110_0121939
1508 Ga0496110_0239826
1509 Ga0496111_0096414
1510 Ga0496112_0047977
1511 Ga0496112_0053062
1512 Ga0496112_0094316
1513 Ga0496112_0408214
1514 Ga0496113_0005807
1515 Ga0496113_0045551
1516 Ga0496113_0135838
1517 Ga0496114_0001200
1518 Ga0496114_0001416
1519 Ga0496114_0047181
1520 Ga0496114_0206197
1521 Ga0496114_0258066
1522 Ga0496115_0000351
1523 Ga0496115_0026265
1524 Ga0496115_0026676
1525 Ga0496115_0427422
1526 Ga0496116_0000018
1527 Ga0496116_0014006
1528 Ga0496117_0000015
1529 Ga0496117_0006653
1530 Ga0496117_0044676
1531 Ga0496118_0000012
1532 Ga0496118_0000295
1533 Ga0496118_0005225
1534 Ga0496119_0000238
1535 Ga0496119_0027216
1536 Ga0496120_0000352
1537 Ga0496120_0174143
1538 Ga0496121_0000062
1539 Ga0496121_0006304
1540 Ga0496122_0114273
1541 Ga0496123_0018873
1542 Ga0496125_0033792
1543 Ga0496126_0000227
1544 Ga0496126_0003537
1545 Ga0496126_0019816
1546 Ga0496126_0064645
1547 Ga0496126_0162410
1548 Ga0501032_0000888
1549 Ga0501032_0012592
1550 Ga0501033_0056891
1551 Ga0501034_0008627
1552 Ga0501034_0009084
1553 Ga0501034_0016271
1554 Ga0501034_0041216
1555 Ga0501034_0385610
1556 Ga0501036_0005804
1557 Ga0501036_0006203
1558 Ga0501036_0174448
1559 Ga0501037_0000357
1560 Ga0501037_0004324
1561 Ga0501038_0004574
1562 Ga0501038_0037880
1563 Ga0501038_0213195
1564 Ga0501039_0000574
1565 Ga0501043_0000276
1566 Ga0501043_0005127
1567 Ga0501043_0060127
1568 Ga0501043_0153131
1569 Ga0501046_0067766
1570 Ga0501046_0178963
1571 Ga0501046_0219055
1572 Ga0501047_0018844
1573 Ga0501047_0070043
1574 Ga0501047_0186235
1575 Ga0501048_0001664
1576 Ga0501069_0205661
1577 Ga0501070_0016317
1578 Ga0501070_0110110
1579 Ga0501073_0063546
1580 Ga0501073_0095808
1581 Ga0501080_0094522
1582 Ga0501083_0055040
1583 Ga0501035_0005095
1584 Ga0501035_0084764
1585 Ga0501044_0006249
1586 Ga0501044_0027478
1587 Ga0501044_0050634
1588 Ga0501044_0066912
1589 Ga0501044_0185754
1590 Ga0501044_0356212
1591 nmdc:mga03683_46491_c1
1592 nmdc:mga03n38_25366_c1
1593 nmdc:mga03n38_8811_c1
1594 nmdc:mga00v17_126655_c1
1595 nmdc:mga00v17_16244_c1
1596 nmdc:mga00v17_240726_c1
1597 nmdc:mga00v17_27500_c1
1598 nmdc:mga00v17_48346_c1
1599 nmdc:mga00v17_73742_c1
1600 nmdc:mga0yw44_14316_c1
1601 nmdc:mga0yw44_315421_c1
1602 nmdc:mga0yw44_78115_c1
1603 nmdc:mga07m45_16949_c1
1604 nmdc:mga07m45_21175_c1
1605 nmdc:mga07m45_2336_c1
1606 nmdc:mga07m45_6888_c1
1607 nmdc:mga05p37_46428_c1
1608 nmdc:mga0qj67_108849_c1
1609 nmdc:mga0qj67_8759_c1
1610 nmdc:mga06r32_130143_c1
1611 nmdc:mga0n895_39273_c1
1612 nmdc:mga0n895_68037_c1
1613 nmdc:mga08x19_3592_c1
1614 nmdc:mga0a205_66053_c1
1615 nmdc:mga0sz30_1773_c1
1616 nmdc:mga0sz30_2736_c1
1617 nmdc:mga0sz30_37886_c1
1618 nmdc:mga0sz30_49153_c1
1619 nmdc:mga0sz30_5748_c1
1620 Ga0495601_0003453
1621 Ga0495601_0015018
1622 Ga0495612_0002225
1623 Ga0495655_0038702
1624 Ga0495595_0000998
1625 Ga0495595_0002982
1626 Ga0495595_0019055
1627 Ga0495619_0008087
1628 Ga0495619_0023053
1629 Ga0500643_019143
1630 Ga0500616_0002196
1631 Ga0500616_0107672
1632 Ga0500645_000152
1633 Ga0501084_0250937
1634 Ga0466962_0001670
1635 Ga0466962_0047643
1636 Ga0466962_0114489
1637 2644488552
1638 2644639791
1639 2676494361
1640 2738703392
1641 2739329149
1642 2842136327
1643 2856742111
1644 2873321865
1645 2884695210
1646 2891401531
1647 2891555145
1648 2891566776
1649 2895432462
1650 2895446082
1651 2902795519
1652 2902800249
1653 2902811083
1654 2902842736
1655 2929218263
1656 2939583925
1657 8053948998
1658 8055071533
1659 8055174860
1660 8056061506

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01944

SpoIIM

Stage II sporulation protein M

118

292

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2a-assembly1.cif.gz_i cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.6809 21 80
5xxb-assembly1.cif.gz_g large subunit of toxoplasma gondii ribosome 0.5388 21 77
7xge-assembly3.cif.gz_E crystal structure of mcl-1 in complex with computationally designed inhibitor protein 0.4557 154 274
7u8r-assembly1.cif.gz_o structure of porcine kidney v-atpase with sidk, rotary state 3 0.4109 152 276
6vqc-assembly1.cif.gz_g mammalian v-atpase from rat brain membrane-embedded vo region rotational state 1 (from focused refinement) 0.4033 142 277
ID Description Score Start End Superfamily
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.878 1 105 1.20.120.330
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.863 1 105 1.20.120.330
af_A0A1D6FII0_204_293_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.6933 14 79 1.10.287.10
4jhfC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.6846 1 78 1.20.58.200
4jhfC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.6389 1 78 1.20.58.200
ID Description Score Start End GO Terms
AF-A0A655AJG2-F1-model_v4 Transmembrane protein 0.9184 165 330 GO:0016020
AF-A0A535BIG9-F1-model_v4 Stage II sporulation protein M 0.9134 161 315 GO:0016020
AF-A0A6A7MV29-F1-model_v4 deleted 0.9091 177 330
AF-A0A6N9YEL9-F1-model_v4 deleted 0.9055 161 293
AF-A0A536B3H6-F1-model_v4 Stage II sporulation protein M 0.9045 166 308 GO:0016020

Map