F482644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 362 | 1660 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300006186|Ga0075369_10000542|Ga0075369_100005426 |
| Length | 341 |
| Sequence | VPGPVLARIYGVDVDAFVLAHRATWDRLEALVKRRRRLTGAEVDELVDLYQRVSTHLSMVRTSSTDAVLIGRLSGLVARARSVVTGAHAPLWSEFTRFWTVSFPVVAWRSRRWWLGSAIAFFAVTALIAVWVAGNPEVQAAIGTPSEIDELVNHDFASYYSEHPAASFGLQVWVNNAWVAAQCIAFAVLLGLPIPYVLFQNAANLGLTAGLMFDAGKGDVFLGLITPHGLLELTAVFLAAAAGMRLGWMVVSPGDRPRVQVLAEQGRAVVSVAGGLVAVLLVCGLIEAVVTPSPLPTAARIGIGFAAEVAFLAYVFHFGRKAERAGETGDLEDAPDVVPTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 206 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 339 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 340 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 341 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 342 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 343 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 344 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 345 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 346 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 347 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 348 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 349 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 350 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 351 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 352 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 353 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 354 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 355 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 356 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 357 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 358 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 359 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 360 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 361 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 362 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.99 |
| Metatranscriptomes | 0.12 |
| Isolates | 2.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.63 |
| Nodule | 0.12 |
| Rhizoplane | 8.07 |
| Rhizosphere | 78.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075369_10000542 | 3300006186 | Bacteria | 11919 |
| 2 | JGI24744J21845_10000843 | 3300002077 | Bacteria | 5789 |
| 3 | JGI24742J22300_10007086 | 3300002244 | Bacteria | 1848 |
| 4 | JGI24751J29686_10009233 | 3300002459 | Bacteria | 2025 |
| 5 | Ga0055540_1000751 | 3300003792 | Bacteria | 22029 |
| 6 | Ga0070658_10369315 | 3300005327 | Bacteria | 1230 |
| 7 | Ga0070676_10001758 | 3300005328 | Bacteria | 11015 |
| 8 | Ga0070676_10076873 | 3300005328 | Bacteria | 2017 |
| 9 | Ga0070683_100330357 | 3300005329 | Bacteria | 1451 |
| 10 | Ga0070690_100007386 | 3300005330 | Bacteria | 6295 |
| 11 | Ga0070670_100121966 | 3300005331 | Bacteria | 2248 |
| 12 | Ga0068869_100102475 | 3300005334 | Bacteria | 2167 |
| 13 | Ga0070666_10001180 | 3300005335 | Bacteria | 15847 |
| 14 | Ga0070682_100004076 | 3300005337 | Bacteria | 8117 |
| 15 | Ga0068868_100002553 | 3300005338 | Bacteria | 12660 |
| 16 | Ga0068868_100023036 | 3300005338 | Bacteria | 4710 |
| 17 | Ga0070660_100024308 | 3300005339 | Bacteria | 4495 |
| 18 | Ga0070689_100001468 | 3300005340 | Bacteria | 15046 |
| 19 | Ga0070691_10001233 | 3300005341 | Bacteria | 10771 |
| 20 | Ga0070692_10071240 | 3300005345 | Bacteria | 1852 |
| 21 | Ga0070668_100001731 | 3300005347 | Bacteria | 15868 |
| 22 | Ga0070668_100008810 | 3300005347 | Bacteria | 7496 |
| 23 | Ga0070668_100215602 | 3300005347 | Bacteria | 1581 |
| 24 | Ga0070669_100005294 | 3300005353 | Bacteria | 9315 |
| 25 | Ga0070671_100003966 | 3300005355 | Bacteria | 11654 |
| 26 | Ga0070671_100059295 | 3300005355 | Bacteria | 3185 |
| 27 | Ga0070671_100137648 | 3300005355 | Bacteria | 2059 |
| 28 | Ga0070671_100149833 | 3300005355 | Bacteria | 1970 |
| 29 | Ga0070674_100001547 | 3300005356 | Bacteria | 12315 |
| 30 | Ga0070688_100016198 | 3300005365 | Bacteria | 4257 |
| 31 | Ga0070659_100000157 | 3300005366 | Bacteria | 52408 |
| 32 | Ga0070659_100007108 | 3300005366 | Bacteria | 8118 |
| 33 | Ga0070667_100002788 | 3300005367 | Bacteria | 15092 |
| 34 | Ga0070667_100012517 | 3300005367 | Bacteria | 7017 |
| 35 | Ga0070667_100026501 | 3300005367 | Bacteria | 4823 |
| 36 | Ga0070709_10000585 | 3300005434 | Bacteria | 21344 |
| 37 | Ga0070709_10021563 | 3300005434 | Bacteria | 3754 |
| 38 | Ga0070709_10028065 | 3300005434 | Bacteria | 3354 |
| 39 | Ga0070714_100000623 | 3300005435 | Bacteria | 25206 |
| 40 | Ga0070714_100006030 | 3300005435 | Bacteria | 9306 |
| 41 | Ga0070714_100010693 | 3300005435 | Bacteria | 7262 |
| 42 | Ga0070714_100015312 | 3300005435 | Bacteria | 6170 |
| 43 | Ga0070714_100058888 | 3300005435 | Bacteria | 3292 |
| 44 | Ga0070714_100078995 | 3300005435 | Bacteria | 2860 |
| 45 | Ga0070714_100100001 | 3300005435 | Bacteria | 2553 |
| 46 | Ga0070714_100279046 | 3300005435 | Bacteria | 1552 |
| 47 | Ga0070713_100011669 | 3300005436 | Bacteria | 6411 |
| 48 | Ga0070713_100036078 | 3300005436 | Bacteria | 3987 |
| 49 | Ga0070713_100050524 | 3300005436 | Bacteria | 3435 |
| 50 | Ga0070713_100301679 | 3300005436 | Bacteria | 1474 |
| 51 | Ga0070713_100410236 | 3300005436 | Bacteria | 1266 |
| 52 | Ga0070710_10000425 | 3300005437 | Bacteria | 19915 |
| 53 | Ga0070710_10003324 | 3300005437 | Bacteria | 7632 |
| 54 | Ga0070710_10008156 | 3300005437 | Bacteria | 5092 |
| 55 | Ga0070710_10012804 | 3300005437 | Bacteria | 4178 |
| 56 | Ga0070710_10151561 | 3300005437 | Bacteria | 1430 |
| 57 | Ga0070701_10028008 | 3300005438 | Bacteria | 2767 |
| 58 | Ga0070711_100001076 | 3300005439 | Bacteria | 14601 |
| 59 | Ga0070711_100003424 | 3300005439 | Bacteria | 9244 |
| 60 | Ga0070711_100023223 | 3300005439 | Bacteria | 4030 |
| 61 | Ga0070705_100002157 | 3300005440 | Bacteria | 10001 |
| 62 | Ga0070705_100243802 | 3300005440 | Bacteria | 1257 |
| 63 | Ga0070700_100010716 | 3300005441 | Bacteria | 5064 |
| 64 | Ga0070694_100072875 | 3300005444 | Bacteria | 2370 |
| 65 | Ga0070708_100004109 | 3300005445 | Bacteria | 11420 |
| 66 | Ga0070708_100014318 | 3300005445 | Bacteria | 6522 |
| 67 | Ga0070708_100034887 | 3300005445 | Bacteria | 4379 |
| 68 | Ga0070708_100039109 | 3300005445 | Bacteria | 4148 |
| 69 | Ga0070708_100119587 | 3300005445 | Bacteria | 2429 |
| 70 | Ga0070708_100281316 | 3300005445 | Bacteria | 1566 |
| 71 | Ga0070663_100020361 | 3300005455 | Bacteria | 4391 |
| 72 | Ga0070663_100057343 | 3300005455 | Bacteria | 2794 |
| 73 | Ga0070678_100000661 | 3300005456 | Bacteria | 16894 |
| 74 | Ga0070678_100076050 | 3300005456 | Bacteria | 2528 |
| 75 | Ga0070678_100091875 | 3300005456 | Bacteria | 2330 |
| 76 | Ga0070662_100128404 | 3300005457 | Bacteria | 1951 |
| 77 | Ga0068867_100003005 | 3300005459 | Bacteria | 11884 |
| 78 | Ga0068867_100432461 | 3300005459 | Bacteria | 1117 |
| 79 | Ga0070706_100002953 | 3300005467 | Bacteria | 16877 |
| 80 | Ga0070706_100003936 | 3300005467 | Bacteria | 14469 |
| 81 | Ga0070706_100004325 | 3300005467 | Bacteria | 13751 |
| 82 | Ga0070706_100007743 | 3300005467 | Bacteria | 10043 |
| 83 | Ga0070706_100009304 | 3300005467 | Bacteria | 9155 |
| 84 | Ga0070707_100000788 | 3300005468 | Bacteria | 31321 |
| 85 | Ga0070707_100004079 | 3300005468 | Bacteria | 13712 |
| 86 | Ga0070707_100033657 | 3300005468 | Bacteria | 4886 |
| 87 | Ga0070707_100115978 | 3300005468 | Bacteria | 2599 |
| 88 | Ga0070698_100000080 | 3300005471 | Bacteria | 73829 |
| 89 | Ga0070698_100002105 | 3300005471 | Bacteria | 22106 |
| 90 | Ga0070698_100004969 | 3300005471 | Bacteria | 14570 |
| 91 | Ga0070698_100007313 | 3300005471 | Bacteria | 11952 |
| 92 | Ga0070698_100059333 | 3300005471 | Bacteria | 3864 |
| 93 | Ga0070699_100024618 | 3300005518 | Bacteria | 5189 |
| 94 | Ga0070679_100114263 | 3300005530 | Bacteria | 2685 |
| 95 | Ga0070684_100033725 | 3300005535 | Bacteria | 4374 |
| 96 | Ga0070697_100012470 | 3300005536 | Bacteria | 6660 |
| 97 | Ga0068853_100005376 | 3300005539 | Bacteria | 10027 |
| 98 | Ga0068853_100352433 | 3300005539 | Bacteria | 1369 |
| 99 | Ga0070695_100013477 | 3300005545 | Bacteria | 4915 |
| 100 | Ga0070695_100043470 | 3300005545 | Bacteria | 2857 |
| 101 | Ga0070696_100007819 | 3300005546 | Bacteria | 7139 |
| 102 | Ga0070696_100046982 | 3300005546 | Bacteria | 2995 |
| 103 | Ga0070696_100077561 | 3300005546 | Bacteria | 2348 |
| 104 | Ga0070693_100005084 | 3300005547 | Bacteria | 6285 |
| 105 | Ga0070665_100009474 | 3300005548 | Bacteria | 9854 |
| 106 | Ga0070665_100072015 | 3300005548 | Bacteria | 3464 |
| 107 | Ga0070704_100000337 | 3300005549 | Bacteria | 21281 |
| 108 | Ga0070704_100108483 | 3300005549 | Bacteria | 2108 |
| 109 | Ga0068855_100127637 | 3300005563 | Bacteria | 2907 |
| 110 | Ga0068855_100189360 | 3300005563 | Bacteria | 2322 |
| 111 | Ga0068857_100153615 | 3300005577 | Bacteria | 2086 |
| 112 | Ga0068854_100004018 | 3300005578 | Bacteria | 9231 |
| 113 | Ga0068854_100091842 | 3300005578 | Bacteria | 2260 |
| 114 | Ga0068854_100210699 | 3300005578 | Bacteria | 1532 |
| 115 | Ga0070702_100000269 | 3300005615 | Bacteria | 17716 |
| 116 | Ga0070702_100175791 | 3300005615 | Bacteria | 1396 |
| 117 | Ga0068852_100277312 | 3300005616 | Bacteria | 1615 |
| 118 | Ga0068859_100008304 | 3300005617 | Bacteria | 10520 |
| 119 | Ga0068859_100060506 | 3300005617 | Bacteria | 3816 |
| 120 | Ga0068864_100296325 | 3300005618 | Bacteria | 1513 |
| 121 | Ga0068866_10000952 | 3300005718 | Bacteria | 12734 |
| 122 | Ga0068861_100000769 | 3300005719 | Bacteria | 19249 |
| 123 | Ga0068861_100028894 | 3300005719 | Bacteria | 4049 |
| 124 | Ga0068861_100052856 | 3300005719 | Bacteria | 3089 |
| 125 | Ga0068863_100004130 | 3300005841 | Bacteria | 14357 |
| 126 | Ga0068863_100007926 | 3300005841 | Bacteria | 10382 |
| 127 | Ga0068863_100547921 | 3300005841 | Bacteria | 1142 |
| 128 | Ga0068858_100030282 | 3300005842 | Bacteria | 5025 |
| 129 | Ga0068858_100096681 | 3300005842 | Bacteria | 2752 |
| 130 | Ga0068858_100109697 | 3300005842 | Bacteria | 2576 |
| 131 | Ga0068858_100285880 | 3300005842 | Bacteria | 1571 |
| 132 | Ga0068860_100000986 | 3300005843 | Bacteria | 31453 |
| 133 | Ga0068860_100004025 | 3300005843 | Bacteria | 15092 |
| 134 | Ga0068862_100000024 | 3300005844 | Bacteria | 197686 |
| 135 | Ga0068862_100276785 | 3300005844 | Bacteria | 1537 |
| 136 | Ga0068862_100284984 | 3300005844 | Bacteria | 1515 |
| 137 | Ga0081455_10011728 | 3300005937 | Bacteria | 8786 |
| 138 | Ga0081455_10041186 | 3300005937 | Bacteria | 4065 |
| 139 | Ga0070717_10004963 | 3300006028 | Bacteria | 9680 |
| 140 | Ga0070717_10010850 | 3300006028 | Bacteria | 6896 |
| 141 | Ga0070717_10028100 | 3300006028 | Bacteria | 4499 |
| 142 | Ga0070717_10040741 | 3300006028 | Bacteria | 3785 |
| 143 | Ga0070717_10048033 | 3300006028 | Bacteria | 3499 |
| 144 | Ga0070717_10310201 | 3300006028 | Bacteria | 1404 |
| 145 | Ga0075365_10013609 | 3300006038 | Bacteria | 4874 |
| 146 | Ga0075365_10065472 | 3300006038 | Bacteria | 2436 |
| 147 | Ga0075365_10087617 | 3300006038 | Bacteria | 2117 |
| 148 | Ga0075365_10107905 | 3300006038 | Bacteria | 1912 |
| 149 | Ga0075365_10154526 | 3300006038 | Bacteria | 1597 |
| 150 | Ga0075363_100000956 | 3300006048 | Bacteria | 10259 |
| 151 | Ga0075363_100004063 | 3300006048 | Bacteria | 6335 |
| 152 | Ga0075364_10006975 | 3300006051 | Bacteria | 6674 |
| 153 | Ga0075364_10009189 | 3300006051 | Bacteria | 5921 |
| 154 | Ga0075364_10017701 | 3300006051 | Bacteria | 4456 |
| 155 | Ga0075364_10022608 | 3300006051 | Bacteria | 3973 |
| 156 | Ga0070715_10000998 | 3300006163 | Bacteria | 7935 |
| 157 | Ga0070715_10002776 | 3300006163 | Bacteria | 5445 |
| 158 | Ga0070715_10008985 | 3300006163 | Bacteria | 3507 |
| 159 | Ga0070716_100000358 | 3300006173 | Bacteria | 18707 |
| 160 | Ga0070716_100003074 | 3300006173 | Bacteria | 7790 |
| 161 | Ga0070716_100003659 | 3300006173 | Bacteria | 7273 |
| 162 | Ga0070712_100006379 | 3300006175 | Bacteria | 7317 |
| 163 | Ga0070712_100011811 | 3300006175 | Bacteria | 5550 |
| 164 | Ga0070712_100147988 | 3300006175 | Bacteria | 1799 |
| 165 | Ga0070712_100225079 | 3300006175 | Bacteria | 1487 |
| 166 | Ga0075362_10068365 | 3300006177 | Bacteria | 1618 |
| 167 | Ga0075367_10011068 | 3300006178 | Bacteria | 4757 |
| 168 | Ga0075369_10001209 | 3300006186 | Bacteria | 8756 |
| 169 | Ga0075369_10002619 | 3300006186 | Bacteria | 6442 |
| 170 | Ga0075369_10003179 | 3300006186 | Bacteria | 5956 |
| 171 | Ga0075369_10004619 | 3300006186 | Bacteria | 5108 |
| 172 | Ga0075369_10005746 | 3300006186 | Bacteria | 4656 |
| 173 | Ga0075369_10051963 | 3300006186 | Bacteria | 1776 |
| 174 | Ga0075369_10098097 | 3300006186 | Bacteria | 1313 |
| 175 | Ga0097621_100125163 | 3300006237 | Bacteria | 2183 |
| 176 | Ga0097621_100305105 | 3300006237 | Bacteria | 1407 |
| 177 | Ga0075370_10017532 | 3300006353 | Bacteria | 3870 |
| 178 | Ga0075370_10018885 | 3300006353 | Bacteria | 3744 |
| 179 | Ga0075370_10100666 | 3300006353 | Bacteria | 1672 |
| 180 | Ga0068871_100027012 | 3300006358 | Bacteria | 4485 |
| 181 | Ga0068871_100116803 | 3300006358 | Bacteria | 2250 |
| 182 | Ga0068871_100251728 | 3300006358 | Bacteria | 1539 |
| 183 | Ga0075428_100003675 | 3300006844 | Bacteria | 16830 |
| 184 | Ga0075430_100001881 | 3300006846 | Bacteria | 17188 |
| 185 | Ga0075430_100060950 | 3300006846 | Bacteria | 3171 |
| 186 | Ga0075431_100119129 | 3300006847 | Bacteria | 2724 |
| 187 | Ga0075433_10064256 | 3300006852 | Bacteria | 3217 |
| 188 | Ga0075433_10074231 | 3300006852 | Bacteria | 2993 |
| 189 | Ga0075434_100002503 | 3300006871 | Bacteria | 16204 |
| 190 | Ga0075434_100025854 | 3300006871 | Bacteria | 5746 |
| 191 | Ga0068865_100002154 | 3300006881 | Bacteria | 11601 |
| 192 | Ga0068865_100035172 | 3300006881 | Bacteria | 3366 |
| 193 | Ga0075436_100013319 | 3300006914 | Bacteria | 5633 |
| 194 | Ga0075436_100070490 | 3300006914 | Bacteria | 2416 |
| 195 | Ga0097620_100008304 | 3300006931 | Bacteria | 10520 |
| 196 | Ga0097620_100060507 | 3300006931 | Bacteria | 3816 |
| 197 | Ga0075435_100008942 | 3300007076 | Bacteria | 7219 |
| 198 | Ga0075435_100053740 | 3300007076 | Bacteria | 3249 |
| 199 | Ga0105250_10018077 | 3300009092 | Bacteria | 2859 |
| 200 | Ga0105250_10024606 | 3300009092 | Bacteria | 2426 |
| 201 | Ga0105245_10002048 | 3300009098 | Bacteria | 18300 |
| 202 | Ga0105245_10028471 | 3300009098 | Bacteria | 4929 |
| 203 | Ga0105247_10001811 | 3300009101 | Bacteria | 14993 |
| 204 | Ga0105247_10005206 | 3300009101 | Bacteria | 8222 |
| 205 | Ga0105247_10060103 | 3300009101 | Bacteria | 2355 |
| 206 | Ga0114129_10031070 | 3300009147 | Bacteria | 7554 |
| 207 | Ga0105243_10002552 | 3300009148 | Bacteria | 15215 |
| 208 | Ga0105243_10135370 | 3300009148 | Bacteria | 2095 |
| 209 | Ga0105241_10057475 | 3300009174 | Bacteria | 2984 |
| 210 | Ga0105241_10110891 | 3300009174 | Bacteria | 2195 |
| 211 | Ga0105242_10001021 | 3300009176 | Bacteria | 22015 |
| 212 | Ga0105248_10004705 | 3300009177 | Bacteria | 15098 |
| 213 | Ga0105248_10008152 | 3300009177 | Bacteria | 11506 |
| 214 | Ga0105248_10058679 | 3300009177 | Bacteria | 4322 |
| 215 | Ga0105237_10001600 | 3300009545 | Bacteria | 29433 |
| 216 | Ga0105249_10000223 | 3300009553 | Bacteria | 64879 |
| 217 | Ga0105249_10000977 | 3300009553 | Bacteria | 25334 |
| 218 | Ga0105249_10286806 | 3300009553 | Bacteria | 1646 |
| 219 | Ga0105239_10003140 | 3300010375 | Bacteria | 20503 |
| 220 | Ga0105239_10075770 | 3300010375 | Bacteria | 3699 |
| 221 | Ga0105246_10248673 | 3300011119 | Bacteria | 1410 |
| 222 | Ga0157369_10001338 | 3300013105 | Bacteria | 30437 |
| 223 | Ga0157369_10133839 | 3300013105 | Bacteria | 2626 |
| 224 | Ga0157374_10136617 | 3300013296 | Bacteria | 2377 |
| 225 | Ga0157378_10021574 | 3300013297 | Bacteria | 5664 |
| 226 | Ga0163162_10004880 | 3300013306 | Bacteria | 12936 |
| 227 | Ga0163162_10038529 | 3300013306 | Bacteria | 4770 |
| 228 | Ga0157372_10012920 | 3300013307 | Bacteria | 8900 |
| 229 | Ga0157372_10101953 | 3300013307 | Bacteria | 3278 |
| 230 | Ga0157375_10001069 | 3300013308 | Bacteria | 23698 |
| 231 | Ga0157375_10069233 | 3300013308 | Bacteria | 3534 |
| 232 | Ga0157375_10091595 | 3300013308 | Bacteria | 3102 |
| 233 | Ga0163163_10036468 | 3300014325 | Bacteria | 4777 |
| 234 | Ga0163163_10226620 | 3300014325 | Bacteria | 1918 |
| 235 | Ga0157380_10000535 | 3300014326 | Bacteria | 23353 |
| 236 | Ga0157379_10049535 | 3300014968 | Bacteria | 3751 |
| 237 | Ga0157379_10218033 | 3300014968 | Bacteria | 1728 |
| 238 | Ga0157376_10354410 | 3300014969 | Bacteria | 1405 |
| 239 | Ga0163161_10001057 | 3300017792 | Bacteria | 20877 |
| 240 | Ga0206353_10073283 | 3300020082 | Bacteria | 1815 |
| 241 | Ga0213876_10006722 | 3300021384 | Bacteria | 6278 |
| 242 | Ga0213876_10013978 | 3300021384 | Bacteria | 4254 |
| 243 | Ga0213876_10021776 | 3300021384 | Bacteria | 3391 |
| 244 | Ga0213875_10056025 | 3300021388 | Bacteria | 1846 |
| 245 | Ga0224572_1014555 | 3300024225 | Bacteria | 1503 |
| 246 | Ga0209673_1011387 | 3300025273 | Bacteria | 3672 |
| 247 | Ga0209051_1000915 | 3300025303 | Bacteria | 29327 |
| 248 | Ga0209051_1001195 | 3300025303 | Bacteria | 23470 |
| 249 | Ga0209051_1002804 | 3300025303 | Bacteria | 12028 |
| 250 | Ga0209051_1034510 | 3300025303 | Bacteria | 1895 |
| 251 | Ga0207692_10016070 | 3300025898 | Bacteria | 3305 |
| 252 | Ga0207692_10016187 | 3300025898 | Bacteria | 3296 |
| 253 | Ga0207692_10051645 | 3300025898 | Bacteria | 2085 |
| 254 | Ga0207692_10080546 | 3300025898 | Bacteria | 1740 |
| 255 | Ga0207642_10000265 | 3300025899 | Bacteria | 15742 |
| 256 | Ga0207710_10000978 | 3300025900 | Bacteria | 15009 |
| 257 | Ga0207710_10027897 | 3300025900 | Bacteria | 2449 |
| 258 | Ga0207688_10000510 | 3300025901 | Bacteria | 18743 |
| 259 | Ga0207688_10003926 | 3300025901 | Bacteria | 8109 |
| 260 | Ga0207680_10008385 | 3300025903 | Bacteria | 5069 |
| 261 | Ga0207685_10005116 | 3300025905 | Bacteria | 3423 |
| 262 | Ga0207685_10010517 | 3300025905 | Bacteria | 2737 |
| 263 | Ga0207685_10021443 | 3300025905 | Bacteria | 2165 |
| 264 | Ga0207699_10000265 | 3300025906 | Bacteria | 28753 |
| 265 | Ga0207699_10003028 | 3300025906 | Bacteria | 7987 |
| 266 | Ga0207699_10007650 | 3300025906 | Bacteria | 5291 |
| 267 | Ga0207699_10017348 | 3300025906 | Bacteria | 3786 |
| 268 | Ga0207699_10042440 | 3300025906 | Bacteria | 2635 |
| 269 | Ga0207699_10359366 | 3300025906 | Bacteria | 1029 |
| 270 | Ga0207645_10014321 | 3300025907 | Bacteria | 5311 |
| 271 | Ga0207645_10089181 | 3300025907 | Bacteria | 1983 |
| 272 | Ga0207684_10000794 | 3300025910 | Bacteria | 36572 |
| 273 | Ga0207684_10002656 | 3300025910 | Bacteria | 17890 |
| 274 | Ga0207684_10003644 | 3300025910 | Bacteria | 14966 |
| 275 | Ga0207684_10422627 | 3300025910 | Bacteria | 1145 |
| 276 | Ga0207707_10243593 | 3300025912 | Bacteria | 1563 |
| 277 | Ga0207671_10010290 | 3300025914 | Bacteria | 7730 |
| 278 | Ga0207693_10002276 | 3300025915 | Bacteria | 16695 |
| 279 | Ga0207693_10002519 | 3300025915 | Bacteria | 15921 |
| 280 | Ga0207693_10006356 | 3300025915 | Bacteria | 9790 |
| 281 | Ga0207693_10006886 | 3300025915 | Bacteria | 9390 |
| 282 | Ga0207693_10050063 | 3300025915 | Bacteria | 3281 |
| 283 | Ga0207693_10063981 | 3300025915 | Bacteria | 2882 |
| 284 | Ga0207693_10122446 | 3300025915 | Bacteria | 2043 |
| 285 | Ga0207663_10007780 | 3300025916 | Bacteria | 5582 |
| 286 | Ga0207663_10023291 | 3300025916 | Bacteria | 3551 |
| 287 | Ga0207663_10119773 | 3300025916 | Bacteria | 1800 |
| 288 | Ga0207657_10068750 | 3300025919 | Bacteria | 3008 |
| 289 | Ga0207657_10136140 | 3300025919 | Bacteria | 2010 |
| 290 | Ga0207646_10003025 | 3300025922 | Bacteria | 19363 |
| 291 | Ga0207646_10008153 | 3300025922 | Bacteria | 10540 |
| 292 | Ga0207646_10230497 | 3300025922 | Bacteria | 1673 |
| 293 | Ga0207646_10287701 | 3300025922 | Bacteria | 1485 |
| 294 | Ga0207681_10011692 | 3300025923 | Bacteria | 5395 |
| 295 | Ga0207681_10074187 | 3300025923 | Bacteria | 2383 |
| 296 | Ga0207659_10218881 | 3300025926 | Bacteria | 1530 |
| 297 | Ga0207687_10003994 | 3300025927 | Bacteria | 9889 |
| 298 | Ga0207687_10015740 | 3300025927 | Bacteria | 4964 |
| 299 | Ga0207700_10000508 | 3300025928 | Bacteria | 22842 |
| 300 | Ga0207700_10003489 | 3300025928 | Bacteria | 9163 |
| 301 | Ga0207700_10020620 | 3300025928 | Bacteria | 4481 |
| 302 | Ga0207700_10031487 | 3300025928 | Bacteria | 3769 |
| 303 | Ga0207700_10086253 | 3300025928 | Bacteria | 2466 |
| 304 | Ga0207700_10100560 | 3300025928 | Bacteria | 2305 |
| 305 | Ga0207664_10000557 | 3300025929 | Bacteria | 26152 |
| 306 | Ga0207664_10002126 | 3300025929 | Bacteria | 13048 |
| 307 | Ga0207664_10018737 | 3300025929 | Bacteria | 5104 |
| 308 | Ga0207664_10022538 | 3300025929 | Bacteria | 4706 |
| 309 | Ga0207664_10037766 | 3300025929 | Bacteria | 3741 |
| 310 | Ga0207664_10044826 | 3300025929 | Bacteria | 3465 |
| 311 | Ga0207664_10062645 | 3300025929 | Bacteria | 2970 |
| 312 | Ga0207664_10101544 | 3300025929 | Bacteria | 2377 |
| 313 | Ga0207664_10149966 | 3300025929 | Bacteria | 1980 |
| 314 | Ga0207644_10034935 | 3300025931 | Bacteria | 3519 |
| 315 | Ga0207644_10098609 | 3300025931 | Bacteria | 2191 |
| 316 | Ga0207690_10000804 | 3300025932 | Bacteria | 20157 |
| 317 | Ga0207690_10009353 | 3300025932 | Bacteria | 5820 |
| 318 | Ga0207706_10005788 | 3300025933 | Bacteria | 11499 |
| 319 | Ga0207706_10057701 | 3300025933 | Bacteria | 3420 |
| 320 | Ga0207686_10081963 | 3300025934 | Bacteria | 2108 |
| 321 | Ga0207709_10059379 | 3300025935 | Bacteria | 2380 |
| 322 | Ga0207709_10170396 | 3300025935 | Bacteria | 1527 |
| 323 | Ga0207670_10046258 | 3300025936 | Bacteria | 2890 |
| 324 | Ga0207669_10001626 | 3300025937 | Bacteria | 9559 |
| 325 | Ga0207704_10001088 | 3300025938 | Bacteria | 12065 |
| 326 | Ga0207665_10000457 | 3300025939 | Bacteria | 28144 |
| 327 | Ga0207665_10002698 | 3300025939 | Bacteria | 11898 |
| 328 | Ga0207665_10024938 | 3300025939 | Bacteria | 3944 |
| 329 | Ga0207665_10031529 | 3300025939 | Bacteria | 3507 |
| 330 | Ga0207711_10002878 | 3300025941 | Bacteria | 15083 |
| 331 | Ga0207711_10006473 | 3300025941 | Bacteria | 9857 |
| 332 | Ga0207711_10098992 | 3300025941 | Bacteria | 2577 |
| 333 | Ga0207689_10142675 | 3300025942 | Bacteria | 1973 |
| 334 | Ga0207667_10074577 | 3300025949 | Bacteria | 3524 |
| 335 | Ga0207667_10494434 | 3300025949 | Bacteria | 1241 |
| 336 | Ga0207712_10000183 | 3300025961 | Bacteria | 64691 |
| 337 | Ga0207712_10016381 | 3300025961 | Bacteria | 4798 |
| 338 | Ga0207668_10005410 | 3300025972 | Bacteria | 7521 |
| 339 | Ga0207668_10005815 | 3300025972 | Bacteria | 7266 |
| 340 | Ga0207668_10022205 | 3300025972 | Bacteria | 4059 |
| 341 | Ga0207640_10005268 | 3300025981 | Bacteria | 7041 |
| 342 | Ga0207640_10338777 | 3300025981 | Bacteria | 1204 |
| 343 | Ga0207658_10002038 | 3300025986 | Bacteria | 15087 |
| 344 | Ga0207658_10010419 | 3300025986 | Bacteria | 6314 |
| 345 | Ga0207658_10027480 | 3300025986 | Bacteria | 3998 |
| 346 | Ga0207658_10069469 | 3300025986 | Bacteria | 2661 |
| 347 | Ga0207658_10092563 | 3300025986 | Bacteria | 2349 |
| 348 | Ga0207703_10003757 | 3300026035 | Bacteria | 12630 |
| 349 | Ga0207703_10018721 | 3300026035 | Bacteria | 5409 |
| 350 | Ga0207639_10007568 | 3300026041 | Bacteria | 7408 |
| 351 | Ga0207678_10019661 | 3300026067 | Bacteria | 5937 |
| 352 | Ga0207678_10033916 | 3300026067 | Bacteria | 4446 |
| 353 | Ga0207678_10060592 | 3300026067 | Bacteria | 3255 |
| 354 | Ga0207678_10072335 | 3300026067 | Bacteria | 2955 |
| 355 | Ga0207708_10010880 | 3300026075 | Bacteria | 6767 |
| 356 | Ga0207708_10037494 | 3300026075 | Bacteria | 3693 |
| 357 | Ga0207708_10118380 | 3300026075 | Bacteria | 2062 |
| 358 | Ga0207702_10197287 | 3300026078 | Bacteria | 1864 |
| 359 | Ga0207641_10000164 | 3300026088 | Bacteria | 93616 |
| 360 | Ga0207641_10004062 | 3300026088 | Bacteria | 12768 |
| 361 | Ga0207641_10067942 | 3300026088 | Bacteria | 3055 |
| 362 | Ga0207648_10008901 | 3300026089 | Bacteria | 9664 |
| 363 | Ga0207648_10039066 | 3300026089 | Bacteria | 4173 |
| 364 | Ga0207676_10310162 | 3300026095 | Bacteria | 1444 |
| 365 | Ga0207674_10023630 | 3300026116 | Bacteria | 6581 |
| 366 | Ga0207675_100000735 | 3300026118 | Bacteria | 32473 |
| 367 | Ga0207675_100043909 | 3300026118 | Bacteria | 4175 |
| 368 | Ga0207675_100046021 | 3300026118 | Bacteria | 4076 |
| 369 | Ga0207683_10003492 | 3300026121 | Bacteria | 13717 |
| 370 | Ga0207683_10029822 | 3300026121 | Bacteria | 4723 |
| 371 | Ga0207683_10235231 | 3300026121 | Bacteria | 1671 |
| 372 | Ga0207698_10197193 | 3300026142 | Bacteria | 1800 |
| 373 | Ga0268266_10007294 | 3300028379 | Bacteria | 9998 |
| 374 | Ga0268266_10043937 | 3300028379 | Bacteria | 3819 |
| 375 | Ga0268266_10165270 | 3300028379 | Bacteria | 2004 |
| 376 | Ga0268265_10000012 | 3300028380 | Bacteria | 343132 |
| 377 | Ga0268265_10016078 | 3300028380 | Bacteria | 5134 |
| 378 | Ga0268265_10068422 | 3300028380 | Bacteria | 2753 |
| 379 | Ga0268265_10093601 | 3300028380 | Bacteria | 2408 |
| 380 | Ga0268264_10002220 | 3300028381 | Bacteria | 17222 |
| 381 | Ga0268264_10002837 | 3300028381 | Bacteria | 15120 |
| 382 | Ga0265338_10006589 | 3300028800 | Bacteria | 14725 |
| 383 | Ga0265338_10113554 | 3300028800 | Bacteria | 2176 |
| 384 | Ga0265327_10000253 | 3300031251 | Bacteria | 106101 |
| 385 | Ga0265327_10005089 | 3300031251 | Bacteria | 11192 |
| 386 | Ga0307413_10088537 | 3300031824 | Bacteria | 2009 |
| 387 | Ga0307410_10042450 | 3300031852 | Bacteria | 3006 |
| 388 | Ga0307407_10033107 | 3300031903 | Bacteria | 2817 |
| 389 | Ga0307409_100014255 | 3300031995 | Bacteria | 5160 |
| 390 | Ga0307409_100287633 | 3300031995 | Bacteria | 1523 |
| 391 | Ga0307411_10005213 | 3300032005 | Bacteria | 6363 |
| 392 | Ga0373958_0003699 | 3300034819 | Bacteria | 2225 |
| 393 | Ga0373938_0028155 | 3300034957 | Bacteria | 1187 |
| 394 | Ga0373926_0007557 | 3300035083 | Bacteria | 3619 |
| 395 | Ga0373926_0020016 | 3300035083 | Bacteria | 2310 |
| 396 | Ga0373926_0028500 | 3300035083 | Bacteria | 1960 |
| 397 | Ga0373934_0006291 | 3300035086 | Bacteria | 4401 |
| 398 | Ga0373944_0024703 | 3300035089 | Bacteria | 1764 |
| 399 | Ga0373949_0015351 | 3300035090 | Bacteria | 1710 |
| 400 | Ga0373936_0001008 | 3300035113 | Bacteria | 10064 |
| 401 | Ga0373941_0013580 | 3300035115 | Bacteria | 2156 |
| 402 | Ga0373945_0046934 | 3300035116 | Bacteria | 1578 |
| 403 | Ga0373945_0066495 | 3300035116 | Bacteria | 1355 |
| 404 | Ga0373953_0000029 | 3300035117 | Bacteria | 39155 |
| 405 | Ga0373953_0007048 | 3300035117 | Bacteria | 3742 |
| 406 | Ga0373954_0001513 | 3300035118 | Bacteria | 9458 |
| 407 | Ga0373954_0067243 | 3300035118 | Bacteria | 1697 |
| 408 | Ga0373956_0001824 | 3300035119 | Bacteria | 8796 |
| 409 | Ga0373956_0044552 | 3300035119 | Bacteria | 1977 |
| 410 | Ga0373957_0000265 | 3300035120 | Bacteria | 13147 |
| 411 | Ga0373957_0000549 | 3300035120 | Bacteria | 9532 |
| 412 | Ga0373957_0010584 | 3300035120 | Bacteria | 3054 |
| 413 | Ga0373960_0002072 | 3300035121 | Bacteria | 4512 |
| 414 | Ga0373943_0027860 | 3300035170 | Bacteria | 2658 |
| 415 | Ga0373955_0000019 | 3300035172 | Bacteria | 64700 |
| 416 | Ga0373955_0059506 | 3300035172 | Bacteria | 2104 |
| 417 | Ga0373955_0091928 | 3300035172 | Bacteria | 1730 |
| 418 | Ga0373924_0000550 | 3300035410 | Bacteria | 11520 |
| 419 | Ga0373924_0000714 | 3300035410 | Bacteria | 10358 |
| 420 | Ga0373924_0044499 | 3300035410 | Bacteria | 1824 |
| 421 | Ga0373931_0015983 | 3300035691 | Bacteria | 3688 |
| 422 | Ga0373931_0113321 | 3300035691 | Bacteria | 1541 |
| 423 | Ga0373935_0000760 | 3300035692 | Bacteria | 17156 |
| 424 | Ga0373935_0008336 | 3300035692 | Bacteria | 6200 |
| 425 | Ga0373935_0096995 | 3300035692 | Bacteria | 1938 |
| 426 | Ga0373933_0000027 | 3300035724 | Bacteria | 90038 |
| 427 | Ga0373933_0000743 | 3300035724 | Bacteria | 19910 |
| 428 | Ga0373933_0002967 | 3300035724 | Bacteria | 9459 |
| 429 | Ga0373933_0005791 | 3300035724 | Bacteria | 6721 |
| 430 | Ga0373933_0079733 | 3300035724 | Bacteria | 2005 |
| 431 | Ga0373933_0219326 | 3300035724 | Bacteria | 1220 |
| 432 | Ga0373947_0000011 | 3300035725 | Bacteria | 160778 |
| 433 | Ga0373937_0000147 | 3300036401 | Bacteria | 68258 |
| 434 | Ga0373937_0008463 | 3300036401 | Bacteria | 8941 |
| 435 | Ga0373937_0010863 | 3300036401 | Bacteria | 7972 |
| 436 | Ga0373937_0060764 | 3300036401 | Bacteria | 3472 |
| 437 | Ga0373937_0176375 | 3300036401 | Bacteria | 2006 |
| 438 | Ga0316584_0055319 | 3300036712 | Bacteria | 2971 |
| 439 | Ga0373925_0016037 | 3300037068 | Bacteria | 5423 |
| 440 | Ga0436364_0257076 | 3300037853 | Bacteria | 2668 |
| 441 | Ga0436364_0275228 | 3300037853 | Bacteria | 9631 |
| 442 | Ga0436364_0467668 | 3300037853 | Bacteria | 5143 |
| 443 | Ga0436364_0586846 | 3300037853 | Bacteria | 2388 |
| 444 | Ga0436365_0802105 | 3300039437 | Bacteria | 13700 |
| 445 | Ga0436365_0878752 | 3300039437 | Bacteria | 18186 |
| 446 | Ga0436365_1041061 | 3300039437 | Bacteria | 87934 |
| 447 | Ga0436365_1781330 | 3300039437 | Bacteria | 14008 |
| 448 | Ga0436363_0763127 | 3300039450 | Bacteria | 4004 |
| 449 | Ga0439466_0001056 | 3300041411 | Bacteria | 10622 |
| 450 | Ga0439466_0003851 | 3300041411 | Bacteria | 5789 |
| 451 | Ga0439465_0000181 | 3300041413 | Bacteria | 16193 |
| 452 | Ga0439465_0000671 | 3300041413 | Bacteria | 10446 |
| 453 | Ga0439465_0007570 | 3300041413 | Bacteria | 3447 |
| 454 | Ga0451789_1046045 | 3300041443 | Bacteria | 1611 |
| 455 | Ga0439431_0000973 | 3300041997 | Bacteria | 6218 |
| 456 | Ga0439431_0015197 | 3300041997 | Bacteria | 1790 |
| 457 | Ga0439442_002122 | 3300042002 | Bacteria | 3898 |
| 458 | Ga0439445_0004489 | 3300042004 | Bacteria | 3163 |
| 459 | Ga0439445_0008372 | 3300042004 | Bacteria | 2418 |
| 460 | Ga0439434_0004267 | 3300042435 | Bacteria | 4178 |
| 461 | Ga0439434_0013227 | 3300042435 | Bacteria | 2448 |
| 462 | Ga0439459_0001441 | 3300042438 | Bacteria | 3507 |
| 463 | Ga0466972_0006817 | 3300044658 | Bacteria | 5733 |
| 464 | Ga0466972_0021368 | 3300044658 | Bacteria | 3226 |
| 465 | Ga0466972_0131829 | 3300044658 | Bacteria | 1177 |
| 466 | Ga0466965_0003873 | 3300044683 | Bacteria | 6611 |
| 467 | Ga0466965_0017263 | 3300044683 | Bacteria | 3448 |
| 468 | Ga0466966_0011746 | 3300044684 | Bacteria | 5806 |
| 469 | Ga0466966_0036239 | 3300044684 | Bacteria | 3186 |
| 470 | Ga0466966_0038858 | 3300044684 | Bacteria | 3065 |
| 471 | Ga0466961_0019831 | 3300044693 | Bacteria | 4326 |
| 472 | Ga0466961_0066161 | 3300044693 | Bacteria | 2296 |
| 473 | Ga0466963_0021871 | 3300044694 | Bacteria | 4042 |
| 474 | Ga0466963_0024694 | 3300044694 | Bacteria | 3827 |
| 475 | Ga0466964_0016700 | 3300044706 | Bacteria | 2804 |
| 476 | Ga0466964_0052948 | 3300044706 | Bacteria | 1670 |
| 477 | Ga0466971_0004415 | 3300044719 | Bacteria | 6070 |
| 478 | Ga0466971_0008526 | 3300044719 | Bacteria | 4471 |
| 479 | Ga0466968_0000600 | 3300044735 | Bacteria | 12278 |
| 480 | Ga0466968_0004823 | 3300044735 | Bacteria | 5048 |
| 481 | Ga0466968_0005509 | 3300044735 | Bacteria | 4740 |
| 482 | Ga0466970_0005182 | 3300044765 | Bacteria | 6445 |
| 483 | Ga0466970_0017859 | 3300044765 | Bacteria | 3669 |
| 484 | Ga0466957_0006411 | 3300044842 | Bacteria | 6646 |
| 485 | Ga0466957_0030961 | 3300044842 | Bacteria | 3196 |
| 486 | Ga0466957_0123104 | 3300044842 | Bacteria | 1655 |
| 487 | Ga0466960_0000192 | 3300044901 | Bacteria | 21063 |
| 488 | Ga0466960_0000377 | 3300044901 | Bacteria | 15211 |
| 489 | Ga0466960_0006191 | 3300044901 | Bacteria | 4791 |
| 490 | Ga0466960_0030250 | 3300044901 | Bacteria | 2491 |
| 491 | Ga0466960_0053361 | 3300044901 | Bacteria | 1959 |
| 492 | Ga0466959_0000865 | 3300045049 | Bacteria | 17867 |
| 493 | Ga0466959_0031944 | 3300045049 | Bacteria | 3897 |
| 494 | Ga0466959_0048631 | 3300045049 | Bacteria | 3116 |
| 495 | Ga0466959_0104713 | 3300045049 | Bacteria | 2023 |
| 496 | Ga0466958_0007105 | 3300045836 | Bacteria | 6132 |
| 497 | Ga0466958_0009021 | 3300045836 | Bacteria | 5538 |
| 498 | Ga0466958_0068825 | 3300045836 | Bacteria | 2164 |
| 499 | Ga0466967_0000402 | 3300045976 | Bacteria | 20322 |
| 500 | Ga0466967_0006840 | 3300045976 | Bacteria | 8134 |
| 501 | Ga0466967_0008059 | 3300045976 | Bacteria | 7680 |
| 502 | Ga0466967_0018601 | 3300045976 | Bacteria | 5559 |
| 503 | Ga0466967_0061469 | 3300045976 | Bacteria | 3332 |
| 504 | Ga0466967_0176278 | 3300045976 | Bacteria | 2014 |
| 505 | Ga0466967_0201533 | 3300045976 | Bacteria | 1885 |
| 506 | Ga0466967_0352293 | 3300045976 | Bacteria | 1425 |
| 507 | Ga0495592_0000019 | 3300046454 | Bacteria | 140749 |
| 508 | Ga0495592_0034634 | 3300046454 | Bacteria | 3805 |
| 509 | Ga0495592_0085131 | 3300046454 | Bacteria | 2279 |
| 510 | Ga0495603_0029858 | 3300046455 | Bacteria | 3286 |
| 511 | Ga0495629_0008983 | 3300046459 | Bacteria | 7335 |
| 512 | Ga0495629_0009495 | 3300046459 | Bacteria | 7113 |
| 513 | Ga0495629_0178202 | 3300046459 | Bacteria | 1473 |
| 514 | Ga0495629_0434028 | 3300046459 | Bacteria | 890 |
| 515 | Ga0495638_0000956 | 3300046460 | Bacteria | 29287 |
| 516 | Ga0495641_0026147 | 3300046461 | Bacteria | 2852 |
| 517 | Ga0495641_0029287 | 3300046461 | Bacteria | 2654 |
| 518 | Ga0495651_0000012 | 3300046462 | Bacteria | 138280 |
| 519 | Ga0495651_0015040 | 3300046462 | Bacteria | 5981 |
| 520 | Ga0495651_0030433 | 3300046462 | Bacteria | 4209 |
| 521 | Ga0495651_0072601 | 3300046462 | Bacteria | 2613 |
| 522 | Ga0495653_0006940 | 3300046463 | Bacteria | 9299 |
| 523 | Ga0495653_0012214 | 3300046463 | Bacteria | 7006 |
| 524 | Ga0495653_0088674 | 3300046463 | Bacteria | 2269 |
| 525 | Ga0495582_0001916 | 3300046473 | Bacteria | 11701 |
| 526 | Ga0495582_0017468 | 3300046473 | Bacteria | 3925 |
| 527 | Ga0495639_0014575 | 3300046475 | Bacteria | 3405 |
| 528 | Ga0495639_0099765 | 3300046475 | Bacteria | 1370 |
| 529 | Ga0495639_0116913 | 3300046475 | Bacteria | 1269 |
| 530 | Ga0495662_0002768 | 3300046476 | Bacteria | 8870 |
| 531 | Ga0495664_0014482 | 3300046477 | Unclassified | 4471 |
| 532 | Ga0495664_0017826 | 3300046477 | Bacteria | 4060 |
| 533 | Ga0495594_0107194 | 3300046499 | Bacteria | 1574 |
| 534 | Ga0495606_0019704 | 3300046507 | Bacteria | 5005 |
| 535 | Ga0495608_0000048 | 3300046511 | Bacteria | 97364 |
| 536 | Ga0495608_0015396 | 3300046511 | Bacteria | 5304 |
| 537 | Ga0495618_0021635 | 3300046514 | Bacteria | 3965 |
| 538 | Ga0495618_0082233 | 3300046514 | Bacteria | 2057 |
| 539 | Ga0495628_0000053 | 3300046516 | Bacteria | 91080 |
| 540 | Ga0495628_0072798 | 3300046516 | Bacteria | 2678 |
| 541 | Ga0495628_0174589 | 3300046516 | Bacteria | 1628 |
| 542 | Ga0495630_0146499 | 3300046517 | Bacteria | 1796 |
| 543 | Ga0495666_0026551 | 3300046526 | Bacteria | 2854 |
| 544 | Ga0495652_0000230 | 3300046529 | Bacteria | 65344 |
| 545 | Ga0495652_0060905 | 3300046529 | Unclassified | 3187 |
| 546 | Ga0495652_0063424 | 3300046529 | Bacteria | 3111 |
| 547 | Ga0495652_0127357 | 3300046529 | Bacteria | 2021 |
| 548 | Ga0495665_0006664 | 3300046531 | Bacteria | 6231 |
| 549 | Ga0495665_0010794 | 3300046531 | Bacteria | 4943 |
| 550 | Ga0495640_0024780 | 3300046533 | Bacteria | 4360 |
| 551 | Ga0495640_0034285 | 3300046533 | Bacteria | 3600 |
| 552 | Ga0495640_0096776 | 3300046533 | Bacteria | 1941 |
| 553 | Ga0495586_0043216 | 3300046535 | Bacteria | 2427 |
| 554 | Ga0495587_0000027 | 3300046536 | Bacteria | 140741 |
| 555 | Ga0495587_0010009 | 3300046536 | Bacteria | 6055 |
| 556 | Ga0495587_0029168 | 3300046536 | Bacteria | 3351 |
| 557 | Ga0495587_0067399 | 3300046536 | Bacteria | 2086 |
| 558 | Ga0495587_0096144 | 3300046536 | Bacteria | 1708 |
| 559 | Ga0495645_0008025 | 3300046543 | Bacteria | 7351 |
| 560 | Ga0495645_0086681 | 3300046543 | Bacteria | 2240 |
| 561 | Ga0495667_0000089 | 3300046559 | Bacteria | 66700 |
| 562 | Ga0495667_0017884 | 3300046559 | Bacteria | 4788 |
| 563 | Ga0495667_0018600 | 3300046559 | Bacteria | 4691 |
| 564 | Ga0495667_0041867 | 3300046559 | Bacteria | 3036 |
| 565 | Ga0495667_0231993 | 3300046559 | Bacteria | 1177 |
| 566 | Ga0495634_0052391 | 3300046642 | Bacteria | 2735 |
| 567 | Ga0495634_0053527 | 3300046642 | Bacteria | 2703 |
| 568 | Ga0495611_0080032 | 3300046648 | Bacteria | 1501 |
| 569 | Ga0495635_0035058 | 3300046663 | Bacteria | 3479 |
| 570 | Ga0495635_0048939 | 3300046663 | Bacteria | 2914 |
| 571 | Ga0495635_0049871 | 3300046663 | Bacteria | 2885 |
| 572 | Ga0495635_0067988 | 3300046663 | Bacteria | 2443 |
| 573 | Ga0495657_0000025 | 3300046675 | Bacteria | 140749 |
| 574 | Ga0495657_0008224 | 3300046675 | Bacteria | 7995 |
| 575 | Ga0495657_0028111 | 3300046675 | Bacteria | 3959 |
| 576 | Ga0495657_0101076 | 3300046675 | Bacteria | 1837 |
| 577 | Ga0495599_0000026 | 3300046678 | Bacteria | 117515 |
| 578 | Ga0495599_0074101 | 3300046678 | Bacteria | 2125 |
| 579 | Ga0495599_0164100 | 3300046678 | Bacteria | 1372 |
| 580 | Ga0495623_0011992 | 3300046679 | Bacteria | 5615 |
| 581 | Ga0495623_0028069 | 3300046679 | Bacteria | 3623 |
| 582 | Ga0495623_0032332 | 3300046679 | Bacteria | 3363 |
| 583 | Ga0495623_0040526 | 3300046679 | Bacteria | 2974 |
| 584 | Ga0495646_0022585 | 3300046680 | Bacteria | 3967 |
| 585 | Ga0495646_0026319 | 3300046680 | Bacteria | 3653 |
| 586 | Ga0495647_0026350 | 3300046681 | Bacteria | 2129 |
| 587 | Ga0495658_0096129 | 3300046683 | Bacteria | 1761 |
| 588 | Ga0495658_0126445 | 3300046683 | Bacteria | 1551 |
| 589 | Ga0495613_0048939 | 3300046689 | Bacteria | 3120 |
| 590 | Ga0495613_0062172 | 3300046689 | Bacteria | 2733 |
| 591 | Ga0495624_0008725 | 3300046690 | Bacteria | 7058 |
| 592 | Ga0495649_0130995 | 3300046694 | Bacteria | 1323 |
| 593 | Ga0495600_0009310 | 3300046809 | Bacteria | 6066 |
| 594 | Ga0495600_0013054 | 3300046809 | Bacteria | 5212 |
| 595 | Ga0495581_0013860 | 3300047315 | Bacteria | 4672 |
| 596 | Ga0495581_0028203 | 3300047315 | Bacteria | 3254 |
| 597 | Ga0495581_0050380 | 3300047315 | Bacteria | 2405 |
| 598 | Ga0495604_0000029 | 3300047317 | Bacteria | 140740 |
| 599 | Ga0495604_0018562 | 3300047317 | Bacteria | 5572 |
| 600 | Ga0495604_0020427 | 3300047317 | Bacteria | 5289 |
| 601 | Ga0495604_0027841 | 3300047317 | Bacteria | 4494 |
| 602 | Ga0495604_0081446 | 3300047317 | Bacteria | 2423 |
| 603 | Ga0495674_0051405 | 3300047319 | Bacteria | 3633 |
| 604 | Ga0495674_0097698 | 3300047319 | Bacteria | 2501 |
| 605 | Ga0495674_0115174 | 3300047319 | Bacteria | 2275 |
| 606 | Ga0495674_0355294 | 3300047319 | Bacteria | 1189 |
| 607 | Ga0495672_0004299 | 3300047320 | Bacteria | 11736 |
| 608 | Ga0495680_0000011 | 3300047322 | Bacteria | 140733 |
| 609 | Ga0495680_0020836 | 3300047322 | Bacteria | 5503 |
| 610 | Ga0495680_0021928 | 3300047322 | Bacteria | 5337 |
| 611 | Ga0495680_0103383 | 3300047322 | Bacteria | 2120 |
| 612 | Ga0495680_0132111 | 3300047322 | Bacteria | 1833 |
| 613 | Ga0495675_0002129 | 3300047444 | Bacteria | 11802 |
| 614 | Ga0495675_0006159 | 3300047444 | Bacteria | 7342 |
| 615 | Ga0495675_0030412 | 3300047444 | Bacteria | 3446 |
| 616 | Ga0495673_0032003 | 3300047469 | Bacteria | 2457 |
| 617 | Ga0495684_0018241 | 3300047471 | Bacteria | 5407 |
| 618 | Ga0495684_0052550 | 3300047471 | Bacteria | 3109 |
| 619 | Ga0495684_0121943 | 3300047471 | Bacteria | 1962 |
| 620 | Ga0495686_0002494 | 3300047472 | Bacteria | 17289 |
| 621 | Ga0495686_0105132 | 3300047472 | Bacteria | 1699 |
| 622 | Ga0495593_0002460 | 3300047673 | Bacteria | 11139 |
| 623 | Ga0495593_0004529 | 3300047673 | Bacteria | 8256 |
| 624 | Ga0495602_0000033 | 3300048088 | Bacteria | 140750 |
| 625 | Ga0495602_0005132 | 3300048088 | Bacteria | 13716 |
| 626 | Ga0495602_0015171 | 3300048088 | Bacteria | 7787 |
| 627 | Ga0495602_0019513 | 3300048088 | Bacteria | 6725 |
| 628 | Ga0495602_0069304 | 3300048088 | Bacteria | 3023 |
| 629 | Ga0495602_0088182 | 3300048088 | Bacteria | 2583 |
| 630 | Ga0496100_0000176 | 3300048903 | Bacteria | 35625 |
| 631 | Ga0496100_0000368 | 3300048903 | Bacteria | 21913 |
| 632 | Ga0496100_0004795 | 3300048903 | Bacteria | 7222 |
| 633 | Ga0496100_0113541 | 3300048903 | Bacteria | 1886 |
| 634 | Ga0496101_0000071 | 3300048904 | Bacteria | 119709 |
| 635 | Ga0496101_0008296 | 3300048904 | Bacteria | 6787 |
| 636 | Ga0496101_0023810 | 3300048904 | Bacteria | 4234 |
| 637 | Ga0496101_0026443 | 3300048904 | Bacteria | 4035 |
| 638 | Ga0496101_0089526 | 3300048904 | Bacteria | 2287 |
| 639 | Ga0496102_0000026 | 3300048905 | Bacteria | 227176 |
| 640 | Ga0496102_0003987 | 3300048905 | Bacteria | 12502 |
| 641 | Ga0496102_0006326 | 3300048905 | Bacteria | 10098 |
| 642 | Ga0496102_0006364 | 3300048905 | Bacteria | 10069 |
| 643 | Ga0496102_0143583 | 3300048905 | Bacteria | 2239 |
| 644 | Ga0496102_0148723 | 3300048905 | Bacteria | 2199 |
| 645 | Ga0496102_0193821 | 3300048905 | Bacteria | 1915 |
| 646 | Ga0496102_0509231 | 3300048905 | Bacteria | 1126 |
| 647 | Ga0496103_0000023 | 3300048906 | Bacteria | 227174 |
| 648 | Ga0496103_0001569 | 3300048906 | Bacteria | 15110 |
| 649 | Ga0496103_0002015 | 3300048906 | Bacteria | 13086 |
| 650 | Ga0496103_0083433 | 3300048906 | Bacteria | 2012 |
| 651 | Ga0496104_0001055 | 3300048907 | Bacteria | 23503 |
| 652 | Ga0496104_0001269 | 3300048907 | Bacteria | 21767 |
| 653 | Ga0496104_0002751 | 3300048907 | Bacteria | 15144 |
| 654 | Ga0496104_0086725 | 3300048907 | Bacteria | 2988 |
| 655 | Ga0496105_0003056 | 3300048908 | Bacteria | 12299 |
| 656 | Ga0496105_0169524 | 3300048908 | Bacteria | 1790 |
| 657 | Ga0496105_0284819 | 3300048908 | Bacteria | 1331 |
| 658 | Ga0496106_0002448 | 3300048909 | Bacteria | 13834 |
| 659 | Ga0496106_0005596 | 3300048909 | Bacteria | 9302 |
| 660 | Ga0496106_0131997 | 3300048909 | Bacteria | 1959 |
| 661 | Ga0496106_0180579 | 3300048909 | Bacteria | 1675 |
| 662 | Ga0496106_0323153 | 3300048909 | Bacteria | 1239 |
| 663 | Ga0496107_0001141 | 3300048910 | Bacteria | 16081 |
| 664 | Ga0496107_0010192 | 3300048910 | Bacteria | 6519 |
| 665 | Ga0496107_0031130 | 3300048910 | Bacteria | 3805 |
| 666 | Ga0496107_0032822 | 3300048910 | Bacteria | 3712 |
| 667 | Ga0496107_0049200 | 3300048910 | Bacteria | 3037 |
| 668 | Ga0496107_0273805 | 3300048910 | Bacteria | 1256 |
| 669 | Ga0496108_0002331 | 3300048911 | Bacteria | 15211 |
| 670 | Ga0496108_0008845 | 3300048911 | Bacteria | 8160 |
| 671 | Ga0496108_0034414 | 3300048911 | Bacteria | 4210 |
| 672 | Ga0496108_0057523 | 3300048911 | Bacteria | 3267 |
| 673 | Ga0496108_0151340 | 3300048911 | Bacteria | 2002 |
| 674 | Ga0496109_0006775 | 3300048912 | Bacteria | 9649 |
| 675 | Ga0496109_0009599 | 3300048912 | Bacteria | 8252 |
| 676 | Ga0496109_0196010 | 3300048912 | Bacteria | 1898 |
| 677 | Ga0496110_0121939 | 3300048913 | Bacteria | 2349 |
| 678 | Ga0496110_0239826 | 3300048913 | Bacteria | 1650 |
| 679 | Ga0496111_0096414 | 3300048914 | Bacteria | 2171 |
| 680 | Ga0496112_0047977 | 3300048915 | Bacteria | 4189 |
| 681 | Ga0496112_0053062 | 3300048915 | Bacteria | 3980 |
| 682 | Ga0496112_0094316 | 3300048915 | Bacteria | 2963 |
| 683 | Ga0496112_0408214 | 3300048915 | Bacteria | 1298 |
| 684 | Ga0496113_0005807 | 3300048916 | Bacteria | 7744 |
| 685 | Ga0496113_0045551 | 3300048916 | Bacteria | 3253 |
| 686 | Ga0496113_0135838 | 3300048916 | Bacteria | 1932 |
| 687 | Ga0496114_0001200 | 3300048917 | Bacteria | 19603 |
| 688 | Ga0496114_0001416 | 3300048917 | Bacteria | 18203 |
| 689 | Ga0496114_0047181 | 3300048917 | Bacteria | 3582 |
| 690 | Ga0496114_0206197 | 3300048917 | Bacteria | 1723 |
| 691 | Ga0496114_0258066 | 3300048917 | Bacteria | 1534 |
| 692 | Ga0496115_0000351 | 3300048918 | Bacteria | 38720 |
| 693 | Ga0496115_0026265 | 3300048918 | Bacteria | 4543 |
| 694 | Ga0496115_0026676 | 3300048918 | Bacteria | 4511 |
| 695 | Ga0496115_0427422 | 3300048918 | Bacteria | 1072 |
| 696 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 697 | Ga0496116_0014006 | 3300048919 | Bacteria | 6423 |
| 698 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 699 | Ga0496117_0006653 | 3300048920 | Bacteria | 11583 |
| 700 | Ga0496117_0044676 | 3300048920 | Bacteria | 3207 |
| 701 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 702 | Ga0496118_0000295 | 3300048921 | Bacteria | 86668 |
| 703 | Ga0496118_0005225 | 3300048921 | Bacteria | 14852 |
| 704 | Ga0496119_0000238 | 3300048922 | Bacteria | 77684 |
| 705 | Ga0496119_0027216 | 3300048922 | Bacteria | 3936 |
| 706 | Ga0496120_0000352 | 3300048923 | Bacteria | 75803 |
| 707 | Ga0496120_0174143 | 3300048923 | Bacteria | 1062 |
| 708 | Ga0496121_0000062 | 3300048924 | Bacteria | 274819 |
| 709 | Ga0496121_0006304 | 3300048924 | Bacteria | 14821 |
| 710 | Ga0496122_0114273 | 3300048925 | Bacteria | 1761 |
| 711 | Ga0496123_0018873 | 3300048926 | Bacteria | 5460 |
| 712 | Ga0496125_0033792 | 3300048928 | Bacteria | 4518 |
| 713 | Ga0496126_0000227 | 3300048929 | Bacteria | 122133 |
| 714 | Ga0496126_0003537 | 3300048929 | Bacteria | 19650 |
| 715 | Ga0496126_0019816 | 3300048929 | Bacteria | 6616 |
| 716 | Ga0496126_0064645 | 3300048929 | Bacteria | 3276 |
| 717 | Ga0496126_0162410 | 3300048929 | Bacteria | 1908 |
| 718 | Ga0501032_0000888 | 3300049569 | Bacteria | 24229 |
| 719 | Ga0501032_0012592 | 3300049569 | Bacteria | 6039 |
| 720 | Ga0501033_0056891 | 3300049570 | Bacteria | 2890 |
| 721 | Ga0501034_0008627 | 3300049571 | Bacteria | 10754 |
| 722 | Ga0501034_0009084 | 3300049571 | Bacteria | 10439 |
| 723 | Ga0501034_0016271 | 3300049571 | Bacteria | 7634 |
| 724 | Ga0501034_0041216 | 3300049571 | Bacteria | 4672 |
| 725 | Ga0501034_0385610 | 3300049571 | Bacteria | 1326 |
| 726 | Ga0501036_0005804 | 3300049572 | Bacteria | 10004 |
| 727 | Ga0501036_0006203 | 3300049572 | Bacteria | 9701 |
| 728 | Ga0501036_0174448 | 3300049572 | Bacteria | 1810 |
| 729 | Ga0501037_0000357 | 3300049573 | Bacteria | 38443 |
| 730 | Ga0501037_0004324 | 3300049573 | Bacteria | 10306 |
| 731 | Ga0501038_0004574 | 3300049574 | Bacteria | 12874 |
| 732 | Ga0501038_0037880 | 3300049574 | Bacteria | 4225 |
| 733 | Ga0501038_0213195 | 3300049574 | Bacteria | 1544 |
| 734 | Ga0501039_0000574 | 3300049575 | Bacteria | 26556 |
| 735 | Ga0501043_0000276 | 3300049579 | Bacteria | 46306 |
| 736 | Ga0501043_0005127 | 3300049579 | Bacteria | 10604 |
| 737 | Ga0501043_0060127 | 3300049579 | Bacteria | 2982 |
| 738 | Ga0501043_0153131 | 3300049579 | Bacteria | 1804 |
| 739 | Ga0501046_0067766 | 3300049580 | Bacteria | 2778 |
| 740 | Ga0501046_0178963 | 3300049580 | Bacteria | 1587 |
| 741 | Ga0501046_0219055 | 3300049580 | Bacteria | 1410 |
| 742 | Ga0501047_0018844 | 3300049581 | Bacteria | 6621 |
| 743 | Ga0501047_0070043 | 3300049581 | Bacteria | 3376 |
| 744 | Ga0501047_0186235 | 3300049581 | Bacteria | 1941 |
| 745 | Ga0501048_0001664 | 3300049582 | Bacteria | 16925 |
| 746 | Ga0501069_0205661 | 3300049585 | Bacteria | 1141 |
| 747 | Ga0501070_0016317 | 3300049586 | Bacteria | 6237 |
| 748 | Ga0501070_0110110 | 3300049586 | Bacteria | 2276 |
| 749 | Ga0501073_0063546 | 3300049589 | Bacteria | 2575 |
| 750 | Ga0501073_0095808 | 3300049589 | Bacteria | 2061 |
| 751 | Ga0501080_0094522 | 3300049742 | Bacteria | 2776 |
| 752 | Ga0501083_0055040 | 3300049744 | Bacteria | 2669 |
| 753 | Ga0501035_0005095 | 3300049822 | Bacteria | 12443 |
| 754 | Ga0501035_0084764 | 3300049822 | Bacteria | 2794 |
| 755 | Ga0501044_0006249 | 3300049823 | Bacteria | 13166 |
| 756 | Ga0501044_0027478 | 3300049823 | Bacteria | 6012 |
| 757 | Ga0501044_0050634 | 3300049823 | Bacteria | 4284 |
| 758 | Ga0501044_0066912 | 3300049823 | Bacteria | 3662 |
| 759 | Ga0501044_0185754 | 3300049823 | Bacteria | 2044 |
| 760 | Ga0501044_0356212 | 3300049823 | Bacteria | 1382 |
| 761 | nmdc:mga03683_46491_c1 | 3300050489 | Bacteria | 1799 |
| 762 | nmdc:mga03n38_25366_c1 | 3300050490 | Bacteria | 2433 |
| 763 | nmdc:mga03n38_8811_c1 | 3300050490 | Bacteria | 3639 |
| 764 | nmdc:mga00v17_126655_c1 | 3300050491 | Bacteria | 1630 |
| 765 | nmdc:mga00v17_16244_c1 | 3300050491 | Bacteria | 4195 |
| 766 | nmdc:mga00v17_240726_c1 | 3300050491 | Bacteria | 1173 |
| 767 | nmdc:mga00v17_27500_c1 | 3300050491 | Bacteria | 3321 |
| 768 | nmdc:mga00v17_48346_c1 | 3300050491 | Bacteria | 2578 |
| 769 | nmdc:mga00v17_73742_c1 | 3300050491 | Bacteria | 2120 |
| 770 | nmdc:mga0yw44_14316_c1 | 3300050492 | Bacteria | 4209 |
| 771 | nmdc:mga0yw44_315421_c1 | 3300050492 | Bacteria | 1049 |
| 772 | nmdc:mga0yw44_78115_c1 | 3300050492 | Bacteria | 2069 |
| 773 | nmdc:mga07m45_16949_c1 | 3300050496 | Bacteria | 3905 |
| 774 | nmdc:mga07m45_21175_c1 | 3300050496 | Bacteria | 3537 |
| 775 | nmdc:mga07m45_2336_c1 | 3300050496 | Bacteria | 8891 |
| 776 | nmdc:mga07m45_6888_c1 | 3300050496 | Bacteria | 1651 |
| 777 | nmdc:mga05p37_46428_c1 | 3300050507 | Bacteria | 5341 |
| 778 | nmdc:mga0qj67_108849_c1 | 3300050509 | Bacteria | 2236 |
| 779 | nmdc:mga0qj67_8759_c1 | 3300050509 | Bacteria | 7508 |
| 780 | nmdc:mga06r32_130143_c1 | 3300050510 | Bacteria | 2488 |
| 781 | nmdc:mga0n895_39273_c1 | 3300050512 | Bacteria | 4592 |
| 782 | nmdc:mga0n895_68037_c1 | 3300050512 | Bacteria | 3528 |
| 783 | nmdc:mga08x19_3592_c1 | 3300050514 | Bacteria | 9227 |
| 784 | nmdc:mga0a205_66053_c1 | 3300050515 | Bacteria | 3495 |
| 785 | nmdc:mga0sz30_1773_c1 | 3300050516 | Bacteria | 7659 |
| 786 | nmdc:mga0sz30_2736_c1 | 3300050516 | Bacteria | 5867 |
| 787 | nmdc:mga0sz30_37886_c1 | 3300050516 | Bacteria | 2019 |
| 788 | nmdc:mga0sz30_49153_c1 | 3300050516 | Bacteria | 1786 |
| 789 | nmdc:mga0sz30_5748_c1 | 3300050516 | Bacteria | 4567 |
| 790 | Ga0495601_0003453 | 3300053077 | Bacteria | 9060 |
| 791 | Ga0495601_0015018 | 3300053077 | Bacteria | 4677 |
| 792 | Ga0495612_0002225 | 3300053078 | Bacteria | 7976 |
| 793 | Ga0495655_0038702 | 3300053083 | Bacteria | 1205 |
| 794 | Ga0495595_0000998 | 3300053084 | Bacteria | 10932 |
| 795 | Ga0495595_0002982 | 3300053084 | Bacteria | 6685 |
| 796 | Ga0495595_0019055 | 3300053084 | Bacteria | 2973 |
| 797 | Ga0495619_0008087 | 3300053085 | Bacteria | 6656 |
| 798 | Ga0495619_0023053 | 3300053085 | Bacteria | 3987 |
| 799 | Ga0500643_019143 | 3300053087 | Bacteria | 2260 |
| 800 | Ga0500616_0002196 | 3300053153 | Bacteria | 16795 |
| 801 | Ga0500616_0107672 | 3300053153 | Bacteria | 1351 |
| 802 | Ga0500645_000152 | 3300053730 | Bacteria | 53929 |
| 803 | Ga0501084_0250937 | 3300054114 | Bacteria | 1494 |
| 804 | Ga0466962_0001670 | 3300061719 | Bacteria | 10409 |
| 805 | Ga0466962_0047643 | 3300061719 | Bacteria | 2048 |
| 806 | Ga0466962_0114489 | 3300061719 | Bacteria | 1299 |
| 807 | 2644488552 | 2643221687 | Bacteria | 6500351 |
| 808 | 2644639791 | 2643221715 | Bacteria | 6671032 |
| 809 | 2676494361 | 2675903060 | Bacteria | 10051191 |
| 810 | 2738703392 | 2738541274 | Bacteria | 6909446 |
| 811 | 2739329149 | 2738543028 | Bacteria | 6917070 |
| 812 | 2842136327 | 2842134933 | Bacteria | 5847019 |
| 813 | 2856742111 | 2856741275 | Bacteria | 8096094 |
| 814 | 2873321865 | 2873314349 | Bacteria | 8512634 |
| 815 | 2884695210 | 2884693830 | Bacteria | 11273186 |
| 816 | 2891401531 | 2891395885 | Bacteria | 9251614 |
| 817 | 2891555145 | 2891554331 | Bacteria | 8812224 |
| 818 | 2891566776 | 2891562705 | Bacteria | 8039471 |
| 819 | 2895432462 | 2895427314 | Bacteria | 13147766 |
| 820 | 2895446082 | 2895442618 | Bacteria | 11027144 |
| 821 | 2902795519 | 2902792274 | Bacteria | 7270173 |
| 822 | 2902800249 | 2902799365 | Bacteria | 5419524 |
| 823 | 2902811083 | 2902810491 | Bacteria | 6794147 |
| 824 | 2902842736 | 2902837492 | Bacteria | 6697721 |
| 825 | 2929218263 | 2929212328 | Bacteria | 7708288 |
| 826 | 2939583925 | 2939582691 | Bacteria | 7088898 |
| 827 | 8053948998 | 8053945823 | Bacteria | 8962862 |
| 828 | 8055071533 | 8055066027 | Bacteria | 9479577 |
| 829 | 8055174860 | 8055172936 | Bacteria | 9305943 |
| 830 | 8056061506 | 8056060235 | Bacteria | 7259403 |
| 831 | Ga0075369_10000542 | |||
| 832 | JGI24744J21845_10000843 | |||
| 833 | JGI24742J22300_10007086 | |||
| 834 | JGI24751J29686_10009233 | |||
| 835 | Ga0055540_1000751 | |||
| 836 | Ga0070658_10369315 | |||
| 837 | Ga0070676_10001758 | |||
| 838 | Ga0070676_10076873 | |||
| 839 | Ga0070683_100330357 | |||
| 840 | Ga0070690_100007386 | |||
| 841 | Ga0070670_100121966 | |||
| 842 | Ga0068869_100102475 | |||
| 843 | Ga0070666_10001180 | |||
| 844 | Ga0070682_100004076 | |||
| 845 | Ga0068868_100002553 | |||
| 846 | Ga0068868_100023036 | |||
| 847 | Ga0070660_100024308 | |||
| 848 | Ga0070689_100001468 | |||
| 849 | Ga0070691_10001233 | |||
| 850 | Ga0070692_10071240 | |||
| 851 | Ga0070668_100001731 | |||
| 852 | Ga0070668_100008810 | |||
| 853 | Ga0070668_100215602 | |||
| 854 | Ga0070669_100005294 | |||
| 855 | Ga0070671_100003966 | |||
| 856 | Ga0070671_100059295 | |||
| 857 | Ga0070671_100137648 | |||
| 858 | Ga0070671_100149833 | |||
| 859 | Ga0070674_100001547 | |||
| 860 | Ga0070688_100016198 | |||
| 861 | Ga0070659_100000157 | |||
| 862 | Ga0070659_100007108 | |||
| 863 | Ga0070667_100002788 | |||
| 864 | Ga0070667_100012517 | |||
| 865 | Ga0070667_100026501 | |||
| 866 | Ga0070709_10000585 | |||
| 867 | Ga0070709_10021563 | |||
| 868 | Ga0070709_10028065 | |||
| 869 | Ga0070714_100000623 | |||
| 870 | Ga0070714_100006030 | |||
| 871 | Ga0070714_100010693 | |||
| 872 | Ga0070714_100015312 | |||
| 873 | Ga0070714_100058888 | |||
| 874 | Ga0070714_100078995 | |||
| 875 | Ga0070714_100100001 | |||
| 876 | Ga0070714_100279046 | |||
| 877 | Ga0070713_100011669 | |||
| 878 | Ga0070713_100036078 | |||
| 879 | Ga0070713_100050524 | |||
| 880 | Ga0070713_100301679 | |||
| 881 | Ga0070713_100410236 | |||
| 882 | Ga0070710_10000425 | |||
| 883 | Ga0070710_10003324 | |||
| 884 | Ga0070710_10008156 | |||
| 885 | Ga0070710_10012804 | |||
| 886 | Ga0070710_10151561 | |||
| 887 | Ga0070701_10028008 | |||
| 888 | Ga0070711_100001076 | |||
| 889 | Ga0070711_100003424 | |||
| 890 | Ga0070711_100023223 | |||
| 891 | Ga0070705_100002157 | |||
| 892 | Ga0070705_100243802 | |||
| 893 | Ga0070700_100010716 | |||
| 894 | Ga0070694_100072875 | |||
| 895 | Ga0070708_100004109 | |||
| 896 | Ga0070708_100014318 | |||
| 897 | Ga0070708_100034887 | |||
| 898 | Ga0070708_100039109 | |||
| 899 | Ga0070708_100119587 | |||
| 900 | Ga0070708_100281316 | |||
| 901 | Ga0070663_100020361 | |||
| 902 | Ga0070663_100057343 | |||
| 903 | Ga0070678_100000661 | |||
| 904 | Ga0070678_100076050 | |||
| 905 | Ga0070678_100091875 | |||
| 906 | Ga0070662_100128404 | |||
| 907 | Ga0068867_100003005 | |||
| 908 | Ga0068867_100432461 | |||
| 909 | Ga0070706_100002953 | |||
| 910 | Ga0070706_100003936 | |||
| 911 | Ga0070706_100004325 | |||
| 912 | Ga0070706_100007743 | |||
| 913 | Ga0070706_100009304 | |||
| 914 | Ga0070707_100000788 | |||
| 915 | Ga0070707_100004079 | |||
| 916 | Ga0070707_100033657 | |||
| 917 | Ga0070707_100115978 | |||
| 918 | Ga0070698_100000080 | |||
| 919 | Ga0070698_100002105 | |||
| 920 | Ga0070698_100004969 | |||
| 921 | Ga0070698_100007313 | |||
| 922 | Ga0070698_100059333 | |||
| 923 | Ga0070699_100024618 | |||
| 924 | Ga0070679_100114263 | |||
| 925 | Ga0070684_100033725 | |||
| 926 | Ga0070697_100012470 | |||
| 927 | Ga0068853_100005376 | |||
| 928 | Ga0068853_100352433 | |||
| 929 | Ga0070695_100013477 | |||
| 930 | Ga0070695_100043470 | |||
| 931 | Ga0070696_100007819 | |||
| 932 | Ga0070696_100046982 | |||
| 933 | Ga0070696_100077561 | |||
| 934 | Ga0070693_100005084 | |||
| 935 | Ga0070665_100009474 | |||
| 936 | Ga0070665_100072015 | |||
| 937 | Ga0070704_100000337 | |||
| 938 | Ga0070704_100108483 | |||
| 939 | Ga0068855_100127637 | |||
| 940 | Ga0068855_100189360 | |||
| 941 | Ga0068857_100153615 | |||
| 942 | Ga0068854_100004018 | |||
| 943 | Ga0068854_100091842 | |||
| 944 | Ga0068854_100210699 | |||
| 945 | Ga0070702_100000269 | |||
| 946 | Ga0070702_100175791 | |||
| 947 | Ga0068852_100277312 | |||
| 948 | Ga0068859_100008304 | |||
| 949 | Ga0068859_100060506 | |||
| 950 | Ga0068864_100296325 | |||
| 951 | Ga0068866_10000952 | |||
| 952 | Ga0068861_100000769 | |||
| 953 | Ga0068861_100028894 | |||
| 954 | Ga0068861_100052856 | |||
| 955 | Ga0068863_100004130 | |||
| 956 | Ga0068863_100007926 | |||
| 957 | Ga0068863_100547921 | |||
| 958 | Ga0068858_100030282 | |||
| 959 | Ga0068858_100096681 | |||
| 960 | Ga0068858_100109697 | |||
| 961 | Ga0068858_100285880 | |||
| 962 | Ga0068860_100000986 | |||
| 963 | Ga0068860_100004025 | |||
| 964 | Ga0068862_100000024 | |||
| 965 | Ga0068862_100276785 | |||
| 966 | Ga0068862_100284984 | |||
| 967 | Ga0081455_10011728 | |||
| 968 | Ga0081455_10041186 | |||
| 969 | Ga0070717_10004963 | |||
| 970 | Ga0070717_10010850 | |||
| 971 | Ga0070717_10028100 | |||
| 972 | Ga0070717_10040741 | |||
| 973 | Ga0070717_10048033 | |||
| 974 | Ga0070717_10310201 | |||
| 975 | Ga0075365_10013609 | |||
| 976 | Ga0075365_10065472 | |||
| 977 | Ga0075365_10087617 | |||
| 978 | Ga0075365_10107905 | |||
| 979 | Ga0075365_10154526 | |||
| 980 | Ga0075363_100000956 | |||
| 981 | Ga0075363_100004063 | |||
| 982 | Ga0075364_10006975 | |||
| 983 | Ga0075364_10009189 | |||
| 984 | Ga0075364_10017701 | |||
| 985 | Ga0075364_10022608 | |||
| 986 | Ga0070715_10000998 | |||
| 987 | Ga0070715_10002776 | |||
| 988 | Ga0070715_10008985 | |||
| 989 | Ga0070716_100000358 | |||
| 990 | Ga0070716_100003074 | |||
| 991 | Ga0070716_100003659 | |||
| 992 | Ga0070712_100006379 | |||
| 993 | Ga0070712_100011811 | |||
| 994 | Ga0070712_100147988 | |||
| 995 | Ga0070712_100225079 | |||
| 996 | Ga0075362_10068365 | |||
| 997 | Ga0075367_10011068 | |||
| 998 | Ga0075369_10001209 | |||
| 999 | Ga0075369_10002619 | |||
| 1000 | Ga0075369_10003179 | |||
| 1001 | Ga0075369_10004619 | |||
| 1002 | Ga0075369_10005746 | |||
| 1003 | Ga0075369_10051963 | |||
| 1004 | Ga0075369_10098097 | |||
| 1005 | Ga0097621_100125163 | |||
| 1006 | Ga0097621_100305105 | |||
| 1007 | Ga0075370_10017532 | |||
| 1008 | Ga0075370_10018885 | |||
| 1009 | Ga0075370_10100666 | |||
| 1010 | Ga0068871_100027012 | |||
| 1011 | Ga0068871_100116803 | |||
| 1012 | Ga0068871_100251728 | |||
| 1013 | Ga0075428_100003675 | |||
| 1014 | Ga0075430_100001881 | |||
| 1015 | Ga0075430_100060950 | |||
| 1016 | Ga0075431_100119129 | |||
| 1017 | Ga0075433_10064256 | |||
| 1018 | Ga0075433_10074231 | |||
| 1019 | Ga0075434_100002503 | |||
| 1020 | Ga0075434_100025854 | |||
| 1021 | Ga0068865_100002154 | |||
| 1022 | Ga0068865_100035172 | |||
| 1023 | Ga0075436_100013319 | |||
| 1024 | Ga0075436_100070490 | |||
| 1025 | Ga0097620_100008304 | |||
| 1026 | Ga0097620_100060507 | |||
| 1027 | Ga0075435_100008942 | |||
| 1028 | Ga0075435_100053740 | |||
| 1029 | Ga0105250_10018077 | |||
| 1030 | Ga0105250_10024606 | |||
| 1031 | Ga0105245_10002048 | |||
| 1032 | Ga0105245_10028471 | |||
| 1033 | Ga0105247_10001811 | |||
| 1034 | Ga0105247_10005206 | |||
| 1035 | Ga0105247_10060103 | |||
| 1036 | Ga0114129_10031070 | |||
| 1037 | Ga0105243_10002552 | |||
| 1038 | Ga0105243_10135370 | |||
| 1039 | Ga0105241_10057475 | |||
| 1040 | Ga0105241_10110891 | |||
| 1041 | Ga0105242_10001021 | |||
| 1042 | Ga0105248_10004705 | |||
| 1043 | Ga0105248_10008152 | |||
| 1044 | Ga0105248_10058679 | |||
| 1045 | Ga0105237_10001600 | |||
| 1046 | Ga0105249_10000223 | |||
| 1047 | Ga0105249_10000977 | |||
| 1048 | Ga0105249_10286806 | |||
| 1049 | Ga0105239_10003140 | |||
| 1050 | Ga0105239_10075770 | |||
| 1051 | Ga0105246_10248673 | |||
| 1052 | Ga0157369_10001338 | |||
| 1053 | Ga0157369_10133839 | |||
| 1054 | Ga0157374_10136617 | |||
| 1055 | Ga0157378_10021574 | |||
| 1056 | Ga0163162_10004880 | |||
| 1057 | Ga0163162_10038529 | |||
| 1058 | Ga0157372_10012920 | |||
| 1059 | Ga0157372_10101953 | |||
| 1060 | Ga0157375_10001069 | |||
| 1061 | Ga0157375_10069233 | |||
| 1062 | Ga0157375_10091595 | |||
| 1063 | Ga0163163_10036468 | |||
| 1064 | Ga0163163_10226620 | |||
| 1065 | Ga0157380_10000535 | |||
| 1066 | Ga0157379_10049535 | |||
| 1067 | Ga0157379_10218033 | |||
| 1068 | Ga0157376_10354410 | |||
| 1069 | Ga0163161_10001057 | |||
| 1070 | Ga0206353_10073283 | |||
| 1071 | Ga0213876_10006722 | |||
| 1072 | Ga0213876_10013978 | |||
| 1073 | Ga0213876_10021776 | |||
| 1074 | Ga0213875_10056025 | |||
| 1075 | Ga0224572_1014555 | |||
| 1076 | Ga0209673_1011387 | |||
| 1077 | Ga0209051_1000915 | |||
| 1078 | Ga0209051_1001195 | |||
| 1079 | Ga0209051_1002804 | |||
| 1080 | Ga0209051_1034510 | |||
| 1081 | Ga0207692_10016070 | |||
| 1082 | Ga0207692_10016187 | |||
| 1083 | Ga0207692_10051645 | |||
| 1084 | Ga0207692_10080546 | |||
| 1085 | Ga0207642_10000265 | |||
| 1086 | Ga0207710_10000978 | |||
| 1087 | Ga0207710_10027897 | |||
| 1088 | Ga0207688_10000510 | |||
| 1089 | Ga0207688_10003926 | |||
| 1090 | Ga0207680_10008385 | |||
| 1091 | Ga0207685_10005116 | |||
| 1092 | Ga0207685_10010517 | |||
| 1093 | Ga0207685_10021443 | |||
| 1094 | Ga0207699_10000265 | |||
| 1095 | Ga0207699_10003028 | |||
| 1096 | Ga0207699_10007650 | |||
| 1097 | Ga0207699_10017348 | |||
| 1098 | Ga0207699_10042440 | |||
| 1099 | Ga0207699_10359366 | |||
| 1100 | Ga0207645_10014321 | |||
| 1101 | Ga0207645_10089181 | |||
| 1102 | Ga0207684_10000794 | |||
| 1103 | Ga0207684_10002656 | |||
| 1104 | Ga0207684_10003644 | |||
| 1105 | Ga0207684_10422627 | |||
| 1106 | Ga0207707_10243593 | |||
| 1107 | Ga0207671_10010290 | |||
| 1108 | Ga0207693_10002276 | |||
| 1109 | Ga0207693_10002519 | |||
| 1110 | Ga0207693_10006356 | |||
| 1111 | Ga0207693_10006886 | |||
| 1112 | Ga0207693_10050063 | |||
| 1113 | Ga0207693_10063981 | |||
| 1114 | Ga0207693_10122446 | |||
| 1115 | Ga0207663_10007780 | |||
| 1116 | Ga0207663_10023291 | |||
| 1117 | Ga0207663_10119773 | |||
| 1118 | Ga0207657_10068750 | |||
| 1119 | Ga0207657_10136140 | |||
| 1120 | Ga0207646_10003025 | |||
| 1121 | Ga0207646_10008153 | |||
| 1122 | Ga0207646_10230497 | |||
| 1123 | Ga0207646_10287701 | |||
| 1124 | Ga0207681_10011692 | |||
| 1125 | Ga0207681_10074187 | |||
| 1126 | Ga0207659_10218881 | |||
| 1127 | Ga0207687_10003994 | |||
| 1128 | Ga0207687_10015740 | |||
| 1129 | Ga0207700_10000508 | |||
| 1130 | Ga0207700_10003489 | |||
| 1131 | Ga0207700_10020620 | |||
| 1132 | Ga0207700_10031487 | |||
| 1133 | Ga0207700_10086253 | |||
| 1134 | Ga0207700_10100560 | |||
| 1135 | Ga0207664_10000557 | |||
| 1136 | Ga0207664_10002126 | |||
| 1137 | Ga0207664_10018737 | |||
| 1138 | Ga0207664_10022538 | |||
| 1139 | Ga0207664_10037766 | |||
| 1140 | Ga0207664_10044826 | |||
| 1141 | Ga0207664_10062645 | |||
| 1142 | Ga0207664_10101544 | |||
| 1143 | Ga0207664_10149966 | |||
| 1144 | Ga0207644_10034935 | |||
| 1145 | Ga0207644_10098609 | |||
| 1146 | Ga0207690_10000804 | |||
| 1147 | Ga0207690_10009353 | |||
| 1148 | Ga0207706_10005788 | |||
| 1149 | Ga0207706_10057701 | |||
| 1150 | Ga0207686_10081963 | |||
| 1151 | Ga0207709_10059379 | |||
| 1152 | Ga0207709_10170396 | |||
| 1153 | Ga0207670_10046258 | |||
| 1154 | Ga0207669_10001626 | |||
| 1155 | Ga0207704_10001088 | |||
| 1156 | Ga0207665_10000457 | |||
| 1157 | Ga0207665_10002698 | |||
| 1158 | Ga0207665_10024938 | |||
| 1159 | Ga0207665_10031529 | |||
| 1160 | Ga0207711_10002878 | |||
| 1161 | Ga0207711_10006473 | |||
| 1162 | Ga0207711_10098992 | |||
| 1163 | Ga0207689_10142675 | |||
| 1164 | Ga0207667_10074577 | |||
| 1165 | Ga0207667_10494434 | |||
| 1166 | Ga0207712_10000183 | |||
| 1167 | Ga0207712_10016381 | |||
| 1168 | Ga0207668_10005410 | |||
| 1169 | Ga0207668_10005815 | |||
| 1170 | Ga0207668_10022205 | |||
| 1171 | Ga0207640_10005268 | |||
| 1172 | Ga0207640_10338777 | |||
| 1173 | Ga0207658_10002038 | |||
| 1174 | Ga0207658_10010419 | |||
| 1175 | Ga0207658_10027480 | |||
| 1176 | Ga0207658_10069469 | |||
| 1177 | Ga0207658_10092563 | |||
| 1178 | Ga0207703_10003757 | |||
| 1179 | Ga0207703_10018721 | |||
| 1180 | Ga0207639_10007568 | |||
| 1181 | Ga0207678_10019661 | |||
| 1182 | Ga0207678_10033916 | |||
| 1183 | Ga0207678_10060592 | |||
| 1184 | Ga0207678_10072335 | |||
| 1185 | Ga0207708_10010880 | |||
| 1186 | Ga0207708_10037494 | |||
| 1187 | Ga0207708_10118380 | |||
| 1188 | Ga0207702_10197287 | |||
| 1189 | Ga0207641_10000164 | |||
| 1190 | Ga0207641_10004062 | |||
| 1191 | Ga0207641_10067942 | |||
| 1192 | Ga0207648_10008901 | |||
| 1193 | Ga0207648_10039066 | |||
| 1194 | Ga0207676_10310162 | |||
| 1195 | Ga0207674_10023630 | |||
| 1196 | Ga0207675_100000735 | |||
| 1197 | Ga0207675_100043909 | |||
| 1198 | Ga0207675_100046021 | |||
| 1199 | Ga0207683_10003492 | |||
| 1200 | Ga0207683_10029822 | |||
| 1201 | Ga0207683_10235231 | |||
| 1202 | Ga0207698_10197193 | |||
| 1203 | Ga0268266_10007294 | |||
| 1204 | Ga0268266_10043937 | |||
| 1205 | Ga0268266_10165270 | |||
| 1206 | Ga0268265_10000012 | |||
| 1207 | Ga0268265_10016078 | |||
| 1208 | Ga0268265_10068422 | |||
| 1209 | Ga0268265_10093601 | |||
| 1210 | Ga0268264_10002220 | |||
| 1211 | Ga0268264_10002837 | |||
| 1212 | Ga0265338_10006589 | |||
| 1213 | Ga0265338_10113554 | |||
| 1214 | Ga0265327_10000253 | |||
| 1215 | Ga0265327_10005089 | |||
| 1216 | Ga0307413_10088537 | |||
| 1217 | Ga0307410_10042450 | |||
| 1218 | Ga0307407_10033107 | |||
| 1219 | Ga0307409_100014255 | |||
| 1220 | Ga0307409_100287633 | |||
| 1221 | Ga0307411_10005213 | |||
| 1222 | Ga0373958_0003699 | |||
| 1223 | Ga0373938_0028155 | |||
| 1224 | Ga0373926_0007557 | |||
| 1225 | Ga0373926_0020016 | |||
| 1226 | Ga0373926_0028500 | |||
| 1227 | Ga0373934_0006291 | |||
| 1228 | Ga0373944_0024703 | |||
| 1229 | Ga0373949_0015351 | |||
| 1230 | Ga0373936_0001008 | |||
| 1231 | Ga0373941_0013580 | |||
| 1232 | Ga0373945_0046934 | |||
| 1233 | Ga0373945_0066495 | |||
| 1234 | Ga0373953_0000029 | |||
| 1235 | Ga0373953_0007048 | |||
| 1236 | Ga0373954_0001513 | |||
| 1237 | Ga0373954_0067243 | |||
| 1238 | Ga0373956_0001824 | |||
| 1239 | Ga0373956_0044552 | |||
| 1240 | Ga0373957_0000265 | |||
| 1241 | Ga0373957_0000549 | |||
| 1242 | Ga0373957_0010584 | |||
| 1243 | Ga0373960_0002072 | |||
| 1244 | Ga0373943_0027860 | |||
| 1245 | Ga0373955_0000019 | |||
| 1246 | Ga0373955_0059506 | |||
| 1247 | Ga0373955_0091928 | |||
| 1248 | Ga0373924_0000550 | |||
| 1249 | Ga0373924_0000714 | |||
| 1250 | Ga0373924_0044499 | |||
| 1251 | Ga0373931_0015983 | |||
| 1252 | Ga0373931_0113321 | |||
| 1253 | Ga0373935_0000760 | |||
| 1254 | Ga0373935_0008336 | |||
| 1255 | Ga0373935_0096995 | |||
| 1256 | Ga0373933_0000027 | |||
| 1257 | Ga0373933_0000743 | |||
| 1258 | Ga0373933_0002967 | |||
| 1259 | Ga0373933_0005791 | |||
| 1260 | Ga0373933_0079733 | |||
| 1261 | Ga0373933_0219326 | |||
| 1262 | Ga0373947_0000011 | |||
| 1263 | Ga0373937_0000147 | |||
| 1264 | Ga0373937_0008463 | |||
| 1265 | Ga0373937_0010863 | |||
| 1266 | Ga0373937_0060764 | |||
| 1267 | Ga0373937_0176375 | |||
| 1268 | Ga0316584_0055319 | |||
| 1269 | Ga0373925_0016037 | |||
| 1270 | Ga0436364_0257076 | |||
| 1271 | Ga0436364_0275228 | |||
| 1272 | Ga0436364_0467668 | |||
| 1273 | Ga0436364_0586846 | |||
| 1274 | Ga0436365_0802105 | |||
| 1275 | Ga0436365_0878752 | |||
| 1276 | Ga0436365_1041061 | |||
| 1277 | Ga0436365_1781330 | |||
| 1278 | Ga0436363_0763127 | |||
| 1279 | Ga0439466_0001056 | |||
| 1280 | Ga0439466_0003851 | |||
| 1281 | Ga0439465_0000181 | |||
| 1282 | Ga0439465_0000671 | |||
| 1283 | Ga0439465_0007570 | |||
| 1284 | Ga0451789_1046045 | |||
| 1285 | Ga0439431_0000973 | |||
| 1286 | Ga0439431_0015197 | |||
| 1287 | Ga0439442_002122 | |||
| 1288 | Ga0439445_0004489 | |||
| 1289 | Ga0439445_0008372 | |||
| 1290 | Ga0439434_0004267 | |||
| 1291 | Ga0439434_0013227 | |||
| 1292 | Ga0439459_0001441 | |||
| 1293 | Ga0466972_0006817 | |||
| 1294 | Ga0466972_0021368 | |||
| 1295 | Ga0466972_0131829 | |||
| 1296 | Ga0466965_0003873 | |||
| 1297 | Ga0466965_0017263 | |||
| 1298 | Ga0466966_0011746 | |||
| 1299 | Ga0466966_0036239 | |||
| 1300 | Ga0466966_0038858 | |||
| 1301 | Ga0466961_0019831 | |||
| 1302 | Ga0466961_0066161 | |||
| 1303 | Ga0466963_0021871 | |||
| 1304 | Ga0466963_0024694 | |||
| 1305 | Ga0466964_0016700 | |||
| 1306 | Ga0466964_0052948 | |||
| 1307 | Ga0466971_0004415 | |||
| 1308 | Ga0466971_0008526 | |||
| 1309 | Ga0466968_0000600 | |||
| 1310 | Ga0466968_0004823 | |||
| 1311 | Ga0466968_0005509 | |||
| 1312 | Ga0466970_0005182 | |||
| 1313 | Ga0466970_0017859 | |||
| 1314 | Ga0466957_0006411 | |||
| 1315 | Ga0466957_0030961 | |||
| 1316 | Ga0466957_0123104 | |||
| 1317 | Ga0466960_0000192 | |||
| 1318 | Ga0466960_0000377 | |||
| 1319 | Ga0466960_0006191 | |||
| 1320 | Ga0466960_0030250 | |||
| 1321 | Ga0466960_0053361 | |||
| 1322 | Ga0466959_0000865 | |||
| 1323 | Ga0466959_0031944 | |||
| 1324 | Ga0466959_0048631 | |||
| 1325 | Ga0466959_0104713 | |||
| 1326 | Ga0466958_0007105 | |||
| 1327 | Ga0466958_0009021 | |||
| 1328 | Ga0466958_0068825 | |||
| 1329 | Ga0466967_0000402 | |||
| 1330 | Ga0466967_0006840 | |||
| 1331 | Ga0466967_0008059 | |||
| 1332 | Ga0466967_0018601 | |||
| 1333 | Ga0466967_0061469 | |||
| 1334 | Ga0466967_0176278 | |||
| 1335 | Ga0466967_0201533 | |||
| 1336 | Ga0466967_0352293 | |||
| 1337 | Ga0495592_0000019 | |||
| 1338 | Ga0495592_0034634 | |||
| 1339 | Ga0495592_0085131 | |||
| 1340 | Ga0495603_0029858 | |||
| 1341 | Ga0495629_0008983 | |||
| 1342 | Ga0495629_0009495 | |||
| 1343 | Ga0495629_0178202 | |||
| 1344 | Ga0495629_0434028 | |||
| 1345 | Ga0495638_0000956 | |||
| 1346 | Ga0495641_0026147 | |||
| 1347 | Ga0495641_0029287 | |||
| 1348 | Ga0495651_0000012 | |||
| 1349 | Ga0495651_0015040 | |||
| 1350 | Ga0495651_0030433 | |||
| 1351 | Ga0495651_0072601 | |||
| 1352 | Ga0495653_0006940 | |||
| 1353 | Ga0495653_0012214 | |||
| 1354 | Ga0495653_0088674 | |||
| 1355 | Ga0495582_0001916 | |||
| 1356 | Ga0495582_0017468 | |||
| 1357 | Ga0495639_0014575 | |||
| 1358 | Ga0495639_0099765 | |||
| 1359 | Ga0495639_0116913 | |||
| 1360 | Ga0495662_0002768 | |||
| 1361 | Ga0495664_0014482 | |||
| 1362 | Ga0495664_0017826 | |||
| 1363 | Ga0495594_0107194 | |||
| 1364 | Ga0495606_0019704 | |||
| 1365 | Ga0495608_0000048 | |||
| 1366 | Ga0495608_0015396 | |||
| 1367 | Ga0495618_0021635 | |||
| 1368 | Ga0495618_0082233 | |||
| 1369 | Ga0495628_0000053 | |||
| 1370 | Ga0495628_0072798 | |||
| 1371 | Ga0495628_0174589 | |||
| 1372 | Ga0495630_0146499 | |||
| 1373 | Ga0495666_0026551 | |||
| 1374 | Ga0495652_0000230 | |||
| 1375 | Ga0495652_0060905 | |||
| 1376 | Ga0495652_0063424 | |||
| 1377 | Ga0495652_0127357 | |||
| 1378 | Ga0495665_0006664 | |||
| 1379 | Ga0495665_0010794 | |||
| 1380 | Ga0495640_0024780 | |||
| 1381 | Ga0495640_0034285 | |||
| 1382 | Ga0495640_0096776 | |||
| 1383 | Ga0495586_0043216 | |||
| 1384 | Ga0495587_0000027 | |||
| 1385 | Ga0495587_0010009 | |||
| 1386 | Ga0495587_0029168 | |||
| 1387 | Ga0495587_0067399 | |||
| 1388 | Ga0495587_0096144 | |||
| 1389 | Ga0495645_0008025 | |||
| 1390 | Ga0495645_0086681 | |||
| 1391 | Ga0495667_0000089 | |||
| 1392 | Ga0495667_0017884 | |||
| 1393 | Ga0495667_0018600 | |||
| 1394 | Ga0495667_0041867 | |||
| 1395 | Ga0495667_0231993 | |||
| 1396 | Ga0495634_0052391 | |||
| 1397 | Ga0495634_0053527 | |||
| 1398 | Ga0495611_0080032 | |||
| 1399 | Ga0495635_0035058 | |||
| 1400 | Ga0495635_0048939 | |||
| 1401 | Ga0495635_0049871 | |||
| 1402 | Ga0495635_0067988 | |||
| 1403 | Ga0495657_0000025 | |||
| 1404 | Ga0495657_0008224 | |||
| 1405 | Ga0495657_0028111 | |||
| 1406 | Ga0495657_0101076 | |||
| 1407 | Ga0495599_0000026 | |||
| 1408 | Ga0495599_0074101 | |||
| 1409 | Ga0495599_0164100 | |||
| 1410 | Ga0495623_0011992 | |||
| 1411 | Ga0495623_0028069 | |||
| 1412 | Ga0495623_0032332 | |||
| 1413 | Ga0495623_0040526 | |||
| 1414 | Ga0495646_0022585 | |||
| 1415 | Ga0495646_0026319 | |||
| 1416 | Ga0495647_0026350 | |||
| 1417 | Ga0495658_0096129 | |||
| 1418 | Ga0495658_0126445 | |||
| 1419 | Ga0495613_0048939 | |||
| 1420 | Ga0495613_0062172 | |||
| 1421 | Ga0495624_0008725 | |||
| 1422 | Ga0495649_0130995 | |||
| 1423 | Ga0495600_0009310 | |||
| 1424 | Ga0495600_0013054 | |||
| 1425 | Ga0495581_0013860 | |||
| 1426 | Ga0495581_0028203 | |||
| 1427 | Ga0495581_0050380 | |||
| 1428 | Ga0495604_0000029 | |||
| 1429 | Ga0495604_0018562 | |||
| 1430 | Ga0495604_0020427 | |||
| 1431 | Ga0495604_0027841 | |||
| 1432 | Ga0495604_0081446 | |||
| 1433 | Ga0495674_0051405 | |||
| 1434 | Ga0495674_0097698 | |||
| 1435 | Ga0495674_0115174 | |||
| 1436 | Ga0495674_0355294 | |||
| 1437 | Ga0495672_0004299 | |||
| 1438 | Ga0495680_0000011 | |||
| 1439 | Ga0495680_0020836 | |||
| 1440 | Ga0495680_0021928 | |||
| 1441 | Ga0495680_0103383 | |||
| 1442 | Ga0495680_0132111 | |||
| 1443 | Ga0495675_0002129 | |||
| 1444 | Ga0495675_0006159 | |||
| 1445 | Ga0495675_0030412 | |||
| 1446 | Ga0495673_0032003 | |||
| 1447 | Ga0495684_0018241 | |||
| 1448 | Ga0495684_0052550 | |||
| 1449 | Ga0495684_0121943 | |||
| 1450 | Ga0495686_0002494 | |||
| 1451 | Ga0495686_0105132 | |||
| 1452 | Ga0495593_0002460 | |||
| 1453 | Ga0495593_0004529 | |||
| 1454 | Ga0495602_0000033 | |||
| 1455 | Ga0495602_0005132 | |||
| 1456 | Ga0495602_0015171 | |||
| 1457 | Ga0495602_0019513 | |||
| 1458 | Ga0495602_0069304 | |||
| 1459 | Ga0495602_0088182 | |||
| 1460 | Ga0496100_0000176 | |||
| 1461 | Ga0496100_0000368 | |||
| 1462 | Ga0496100_0004795 | |||
| 1463 | Ga0496100_0113541 | |||
| 1464 | Ga0496101_0000071 | |||
| 1465 | Ga0496101_0008296 | |||
| 1466 | Ga0496101_0023810 | |||
| 1467 | Ga0496101_0026443 | |||
| 1468 | Ga0496101_0089526 | |||
| 1469 | Ga0496102_0000026 | |||
| 1470 | Ga0496102_0003987 | |||
| 1471 | Ga0496102_0006326 | |||
| 1472 | Ga0496102_0006364 | |||
| 1473 | Ga0496102_0143583 | |||
| 1474 | Ga0496102_0148723 | |||
| 1475 | Ga0496102_0193821 | |||
| 1476 | Ga0496102_0509231 | |||
| 1477 | Ga0496103_0000023 | |||
| 1478 | Ga0496103_0001569 | |||
| 1479 | Ga0496103_0002015 | |||
| 1480 | Ga0496103_0083433 | |||
| 1481 | Ga0496104_0001055 | |||
| 1482 | Ga0496104_0001269 | |||
| 1483 | Ga0496104_0002751 | |||
| 1484 | Ga0496104_0086725 | |||
| 1485 | Ga0496105_0003056 | |||
| 1486 | Ga0496105_0169524 | |||
| 1487 | Ga0496105_0284819 | |||
| 1488 | Ga0496106_0002448 | |||
| 1489 | Ga0496106_0005596 | |||
| 1490 | Ga0496106_0131997 | |||
| 1491 | Ga0496106_0180579 | |||
| 1492 | Ga0496106_0323153 | |||
| 1493 | Ga0496107_0001141 | |||
| 1494 | Ga0496107_0010192 | |||
| 1495 | Ga0496107_0031130 | |||
| 1496 | Ga0496107_0032822 | |||
| 1497 | Ga0496107_0049200 | |||
| 1498 | Ga0496107_0273805 | |||
| 1499 | Ga0496108_0002331 | |||
| 1500 | Ga0496108_0008845 | |||
| 1501 | Ga0496108_0034414 | |||
| 1502 | Ga0496108_0057523 | |||
| 1503 | Ga0496108_0151340 | |||
| 1504 | Ga0496109_0006775 | |||
| 1505 | Ga0496109_0009599 | |||
| 1506 | Ga0496109_0196010 | |||
| 1507 | Ga0496110_0121939 | |||
| 1508 | Ga0496110_0239826 | |||
| 1509 | Ga0496111_0096414 | |||
| 1510 | Ga0496112_0047977 | |||
| 1511 | Ga0496112_0053062 | |||
| 1512 | Ga0496112_0094316 | |||
| 1513 | Ga0496112_0408214 | |||
| 1514 | Ga0496113_0005807 | |||
| 1515 | Ga0496113_0045551 | |||
| 1516 | Ga0496113_0135838 | |||
| 1517 | Ga0496114_0001200 | |||
| 1518 | Ga0496114_0001416 | |||
| 1519 | Ga0496114_0047181 | |||
| 1520 | Ga0496114_0206197 | |||
| 1521 | Ga0496114_0258066 | |||
| 1522 | Ga0496115_0000351 | |||
| 1523 | Ga0496115_0026265 | |||
| 1524 | Ga0496115_0026676 | |||
| 1525 | Ga0496115_0427422 | |||
| 1526 | Ga0496116_0000018 | |||
| 1527 | Ga0496116_0014006 | |||
| 1528 | Ga0496117_0000015 | |||
| 1529 | Ga0496117_0006653 | |||
| 1530 | Ga0496117_0044676 | |||
| 1531 | Ga0496118_0000012 | |||
| 1532 | Ga0496118_0000295 | |||
| 1533 | Ga0496118_0005225 | |||
| 1534 | Ga0496119_0000238 | |||
| 1535 | Ga0496119_0027216 | |||
| 1536 | Ga0496120_0000352 | |||
| 1537 | Ga0496120_0174143 | |||
| 1538 | Ga0496121_0000062 | |||
| 1539 | Ga0496121_0006304 | |||
| 1540 | Ga0496122_0114273 | |||
| 1541 | Ga0496123_0018873 | |||
| 1542 | Ga0496125_0033792 | |||
| 1543 | Ga0496126_0000227 | |||
| 1544 | Ga0496126_0003537 | |||
| 1545 | Ga0496126_0019816 | |||
| 1546 | Ga0496126_0064645 | |||
| 1547 | Ga0496126_0162410 | |||
| 1548 | Ga0501032_0000888 | |||
| 1549 | Ga0501032_0012592 | |||
| 1550 | Ga0501033_0056891 | |||
| 1551 | Ga0501034_0008627 | |||
| 1552 | Ga0501034_0009084 | |||
| 1553 | Ga0501034_0016271 | |||
| 1554 | Ga0501034_0041216 | |||
| 1555 | Ga0501034_0385610 | |||
| 1556 | Ga0501036_0005804 | |||
| 1557 | Ga0501036_0006203 | |||
| 1558 | Ga0501036_0174448 | |||
| 1559 | Ga0501037_0000357 | |||
| 1560 | Ga0501037_0004324 | |||
| 1561 | Ga0501038_0004574 | |||
| 1562 | Ga0501038_0037880 | |||
| 1563 | Ga0501038_0213195 | |||
| 1564 | Ga0501039_0000574 | |||
| 1565 | Ga0501043_0000276 | |||
| 1566 | Ga0501043_0005127 | |||
| 1567 | Ga0501043_0060127 | |||
| 1568 | Ga0501043_0153131 | |||
| 1569 | Ga0501046_0067766 | |||
| 1570 | Ga0501046_0178963 | |||
| 1571 | Ga0501046_0219055 | |||
| 1572 | Ga0501047_0018844 | |||
| 1573 | Ga0501047_0070043 | |||
| 1574 | Ga0501047_0186235 | |||
| 1575 | Ga0501048_0001664 | |||
| 1576 | Ga0501069_0205661 | |||
| 1577 | Ga0501070_0016317 | |||
| 1578 | Ga0501070_0110110 | |||
| 1579 | Ga0501073_0063546 | |||
| 1580 | Ga0501073_0095808 | |||
| 1581 | Ga0501080_0094522 | |||
| 1582 | Ga0501083_0055040 | |||
| 1583 | Ga0501035_0005095 | |||
| 1584 | Ga0501035_0084764 | |||
| 1585 | Ga0501044_0006249 | |||
| 1586 | Ga0501044_0027478 | |||
| 1587 | Ga0501044_0050634 | |||
| 1588 | Ga0501044_0066912 | |||
| 1589 | Ga0501044_0185754 | |||
| 1590 | Ga0501044_0356212 | |||
| 1591 | nmdc:mga03683_46491_c1 | |||
| 1592 | nmdc:mga03n38_25366_c1 | |||
| 1593 | nmdc:mga03n38_8811_c1 | |||
| 1594 | nmdc:mga00v17_126655_c1 | |||
| 1595 | nmdc:mga00v17_16244_c1 | |||
| 1596 | nmdc:mga00v17_240726_c1 | |||
| 1597 | nmdc:mga00v17_27500_c1 | |||
| 1598 | nmdc:mga00v17_48346_c1 | |||
| 1599 | nmdc:mga00v17_73742_c1 | |||
| 1600 | nmdc:mga0yw44_14316_c1 | |||
| 1601 | nmdc:mga0yw44_315421_c1 | |||
| 1602 | nmdc:mga0yw44_78115_c1 | |||
| 1603 | nmdc:mga07m45_16949_c1 | |||
| 1604 | nmdc:mga07m45_21175_c1 | |||
| 1605 | nmdc:mga07m45_2336_c1 | |||
| 1606 | nmdc:mga07m45_6888_c1 | |||
| 1607 | nmdc:mga05p37_46428_c1 | |||
| 1608 | nmdc:mga0qj67_108849_c1 | |||
| 1609 | nmdc:mga0qj67_8759_c1 | |||
| 1610 | nmdc:mga06r32_130143_c1 | |||
| 1611 | nmdc:mga0n895_39273_c1 | |||
| 1612 | nmdc:mga0n895_68037_c1 | |||
| 1613 | nmdc:mga08x19_3592_c1 | |||
| 1614 | nmdc:mga0a205_66053_c1 | |||
| 1615 | nmdc:mga0sz30_1773_c1 | |||
| 1616 | nmdc:mga0sz30_2736_c1 | |||
| 1617 | nmdc:mga0sz30_37886_c1 | |||
| 1618 | nmdc:mga0sz30_49153_c1 | |||
| 1619 | nmdc:mga0sz30_5748_c1 | |||
| 1620 | Ga0495601_0003453 | |||
| 1621 | Ga0495601_0015018 | |||
| 1622 | Ga0495612_0002225 | |||
| 1623 | Ga0495655_0038702 | |||
| 1624 | Ga0495595_0000998 | |||
| 1625 | Ga0495595_0002982 | |||
| 1626 | Ga0495595_0019055 | |||
| 1627 | Ga0495619_0008087 | |||
| 1628 | Ga0495619_0023053 | |||
| 1629 | Ga0500643_019143 | |||
| 1630 | Ga0500616_0002196 | |||
| 1631 | Ga0500616_0107672 | |||
| 1632 | Ga0500645_000152 | |||
| 1633 | Ga0501084_0250937 | |||
| 1634 | Ga0466962_0001670 | |||
| 1635 | Ga0466962_0047643 | |||
| 1636 | Ga0466962_0114489 | |||
| 1637 | 2644488552 | |||
| 1638 | 2644639791 | |||
| 1639 | 2676494361 | |||
| 1640 | 2738703392 | |||
| 1641 | 2739329149 | |||
| 1642 | 2842136327 | |||
| 1643 | 2856742111 | |||
| 1644 | 2873321865 | |||
| 1645 | 2884695210 | |||
| 1646 | 2891401531 | |||
| 1647 | 2891555145 | |||
| 1648 | 2891566776 | |||
| 1649 | 2895432462 | |||
| 1650 | 2895446082 | |||
| 1651 | 2902795519 | |||
| 1652 | 2902800249 | |||
| 1653 | 2902811083 | |||
| 1654 | 2902842736 | |||
| 1655 | 2929218263 | |||
| 1656 | 2939583925 | |||
| 1657 | 8053948998 | |||
| 1658 | 8055071533 | |||
| 1659 | 8055174860 | |||
| 1660 | 8056061506 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t2a-assembly1.cif.gz_i | cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution | 0.6809 | 21 | 80 |
| 5xxb-assembly1.cif.gz_g | large subunit of toxoplasma gondii ribosome | 0.5388 | 21 | 77 |
| 7xge-assembly3.cif.gz_E | crystal structure of mcl-1 in complex with computationally designed inhibitor protein | 0.4557 | 154 | 274 |
| 7u8r-assembly1.cif.gz_o | structure of porcine kidney v-atpase with sidk, rotary state 3 | 0.4109 | 152 | 276 |
| 6vqc-assembly1.cif.gz_g | mammalian v-atpase from rat brain membrane-embedded vo region rotational state 1 (from focused refinement) | 0.4033 | 142 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69662_1_106_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.878 | 1 | 105 | 1.20.120.330 |
| af_O69662_1_106_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.863 | 1 | 105 | 1.20.120.330 |
| af_A0A1D6FII0_204_293_1.10.287.10 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.6933 | 14 | 79 | 1.10.287.10 |
| 4jhfC02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 | 0.6846 | 1 | 78 | 1.20.58.200 |
| 4jhfC02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 | 0.6389 | 1 | 78 | 1.20.58.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A655AJG2-F1-model_v4 | Transmembrane protein | 0.9184 | 165 | 330 |
GO:0016020
|
| AF-A0A535BIG9-F1-model_v4 | Stage II sporulation protein M | 0.9134 | 161 | 315 |
GO:0016020
|
| AF-A0A6A7MV29-F1-model_v4 | deleted | 0.9091 | 177 | 330 |
|
| AF-A0A6N9YEL9-F1-model_v4 | deleted | 0.9055 | 161 | 293 |
|
| AF-A0A536B3H6-F1-model_v4 | Stage II sporulation protein M | 0.9045 | 166 | 308 |
GO:0016020
|