F482640

General Info

Members Datasets Scaffolds Average Seq Length
830 296 1660 191

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100200006|Ga0070706_1002000062
Length 221
Sequence MPGYPHLVPVLAATLEPPAPQLPAPYCDDGPMTLSLPIEDGANELLSRSPLALLTGMLLDQQVPLEKAFSSPYELALRLGHEPTAAELADYNPEALAAVFSERPALHRFPKAMAARVQELTRVIAERYDGDAARVWTTAATGAELAGRLAELPGFGTYKAQIMTALLGKQLGVRPDGWREAAGRFGEEGSRWSVADITDAASLAAVREHKKQVKAAAKAQR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031273 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.66
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100200006 3300005467 Bacteria 1867
2 JGI25406J46586_10026636 3300003203 Bacteria 2226
3 JGI25406J46586_10051432 3300003203 Bacteria 1378
4 Ga0070658_10115677 3300005327 Bacteria 2225
5 Ga0070676_10132357 3300005328 Bacteria 1578
6 Ga0070683_100046191 3300005329 Bacteria 4022
7 Ga0070683_100051955 3300005329 Bacteria 3796
8 Ga0070683_100090481 3300005329 Bacteria 2873
9 Ga0070683_100292721 3300005329 Bacteria 1548
10 Ga0070683_100745345 3300005329 Bacteria 938
11 Ga0070690_100063725 3300005330 Bacteria 2379
12 Ga0070690_100445728 3300005330 Bacteria 959
13 Ga0068869_100241097 3300005334 Bacteria 1440
14 Ga0070680_100046060 3300005336 Bacteria 3547
15 Ga0070680_100933244 3300005336 Bacteria 749
16 Ga0070682_100037102 3300005337 Bacteria 2982
17 Ga0070682_100097853 3300005337 Bacteria 1932
18 Ga0070682_100553687 3300005337 Bacteria 900
19 Ga0068868_100235676 3300005338 Bacteria 1536
20 Ga0070660_100029919 3300005339 Bacteria 4083
21 Ga0070660_100109202 3300005339 Bacteria 2199
22 Ga0070660_100274378 3300005339 Bacteria 1379
23 Ga0070689_100061655 3300005340 Bacteria 2917
24 Ga0070691_10012298 3300005341 Bacteria 3918
25 Ga0070691_10093505 3300005341 Bacteria 1485
26 Ga0070687_100026444 3300005343 Bacteria 2794
27 Ga0070661_100031694 3300005344 Bacteria 3823
28 Ga0070661_100084305 3300005344 Bacteria 2348
29 Ga0070661_100235328 3300005344 Bacteria 1409
30 Ga0070692_10099929 3300005345 Bacteria 1589
31 Ga0070669_100215396 3300005353 Bacteria 1517
32 Ga0070675_100071388 3300005354 Bacteria 2880
33 Ga0070671_100136085 3300005355 Bacteria 2071
34 Ga0070671_100160710 3300005355 Bacteria 1899
35 Ga0070673_100077674 3300005364 Bacteria 2683
36 Ga0070667_100120941 3300005367 Bacteria 2277
37 Ga0070703_10023877 3300005406 Bacteria 1803
38 Ga0070709_10000165 3300005434 Bacteria 41860
39 Ga0070709_10072380 3300005434 Bacteria 2228
40 Ga0070709_10198176 3300005434 Bacteria 1420
41 Ga0070709_10381062 3300005434 Bacteria 1048
42 Ga0070714_100000318 3300005435 Bacteria 36459
43 Ga0070714_100000689 3300005435 Bacteria 23869
44 Ga0070714_100107703 3300005435 Bacteria 2463
45 Ga0070714_100130892 3300005435 Bacteria 2242
46 Ga0070714_100314723 3300005435 Bacteria 1462
47 Ga0070714_100323225 3300005435 Bacteria 1443
48 Ga0070714_100327661 3300005435 Bacteria 1433
49 Ga0070714_100434270 3300005435 Bacteria 1245
50 Ga0070714_100451261 3300005435 Bacteria 1221
51 Ga0070713_100002403 3300005436 Bacteria 12211
52 Ga0070713_100077760 3300005436 Bacteria 2822
53 Ga0070713_100085400 3300005436 Bacteria 2703
54 Ga0070713_100110827 3300005436 Bacteria 2392
55 Ga0070713_100209379 3300005436 Bacteria 1764
56 Ga0070713_100295037 3300005436 Bacteria 1491
57 Ga0070710_10004650 3300005437 Bacteria 6492
58 Ga0070710_10111283 3300005437 Bacteria 1645
59 Ga0070701_10054289 3300005438 Bacteria 2089
60 Ga0070711_100000158 3300005439 Bacteria 36681
61 Ga0070711_100061073 3300005439 Bacteria 2622
62 Ga0070711_100185136 3300005439 Bacteria 1596
63 Ga0070705_100039731 3300005440 Bacteria 2671
64 Ga0070700_100046386 3300005441 Bacteria 2684
65 Ga0070694_100451049 3300005444 Bacteria 1015
66 Ga0070708_100027451 3300005445 Bacteria 4885
67 Ga0070708_100046036 3300005445 Bacteria 3847
68 Ga0070708_100069236 3300005445 Bacteria 3173
69 Ga0070708_100174273 3300005445 Bacteria 2009
70 Ga0070708_100286122 3300005445 Bacteria 1551
71 Ga0070663_100176013 3300005455 Bacteria 1657
72 Ga0070678_100071149 3300005456 Bacteria 2603
73 Ga0070662_100200609 3300005457 Bacteria 1583
74 Ga0070681_10072320 3300005458 Bacteria 3411
75 Ga0070681_10142805 3300005458 Bacteria 2323
76 Ga0070685_10425788 3300005466 Bacteria 925
77 Ga0070706_100007197 3300005467 Bacteria 10459
78 Ga0070706_100025430 3300005467 Bacteria 5449
79 Ga0070706_100025704 3300005467 Bacteria 5419
80 Ga0070706_100061551 3300005467 Bacteria 3466
81 Ga0070706_100309083 3300005467 Bacteria 1475
82 Ga0070707_100002252 3300005468 Bacteria 18404
83 Ga0070707_100013838 3300005468 Bacteria 7555
84 Ga0070707_100025462 3300005468 Bacteria 5613
85 Ga0070707_100118089 3300005468 Bacteria 2574
86 Ga0070707_100356140 3300005468 Bacteria 1421
87 Ga0070707_100377365 3300005468 Bacteria 1377
88 Ga0070698_100000028 3300005471 Bacteria 98040
89 Ga0070698_100017873 3300005471 Bacteria 7470
90 Ga0070698_100036945 3300005471 Bacteria 5040
91 Ga0070698_100116624 3300005471 Bacteria 2633
92 Ga0070698_100419988 3300005471 Bacteria 1272
93 Ga0070699_100314352 3300005518 Bacteria 1407
94 Ga0070679_100029643 3300005530 Bacteria 5398
95 Ga0070679_100091308 3300005530 Bacteria 3033
96 Ga0070679_100212928 3300005530 Bacteria 1896
97 Ga0070679_100225635 3300005530 Bacteria 1834
98 Ga0070679_100251424 3300005530 Bacteria 1724
99 Ga0070679_100976554 3300005530 Bacteria 791
100 Ga0070684_100056907 3300005535 Bacteria 3413
101 Ga0070684_100061371 3300005535 Bacteria 3290
102 Ga0070684_100420442 3300005535 Bacteria 1234
103 Ga0070697_100128279 3300005536 Bacteria 2125
104 Ga0068853_100245316 3300005539 Bacteria 1642
105 Ga0070672_100080750 3300005543 Bacteria 2606
106 Ga0070686_100214169 3300005544 Bacteria 1389
107 Ga0070695_100685073 3300005545 Bacteria 812
108 Ga0070693_100029706 3300005547 Bacteria 2983
109 Ga0070693_100191468 3300005547 Bacteria 1323
110 Ga0070665_100094927 3300005548 Bacteria 2987
111 Ga0070665_100395622 3300005548 Bacteria 1389
112 Ga0070704_100533625 3300005549 Bacteria 1023
113 Ga0068855_100287901 3300005563 Bacteria 1822
114 Ga0068855_100296141 3300005563 Bacteria 1793
115 Ga0068855_100584951 3300005563 Bacteria 1205
116 Ga0070664_100049942 3300005564 Bacteria 3538
117 Ga0068857_100076359 3300005577 Bacteria 2988
118 Ga0068854_100058858 3300005578 Bacteria 2775
119 Ga0068856_100039845 3300005614 Bacteria 4613
120 Ga0068856_100125024 3300005614 Bacteria 2575
121 Ga0068856_100202278 3300005614 Bacteria 2001
122 Ga0068856_100377649 3300005614 Bacteria 1436
123 Ga0068856_100714355 3300005614 Bacteria 1022
124 Ga0070702_100031011 3300005615 Bacteria 2921
125 Ga0070702_100058569 3300005615 Bacteria 2232
126 Ga0068852_100219060 3300005616 Bacteria 1809
127 Ga0068859_100030304 3300005617 Bacteria 5428
128 Ga0068864_100054407 3300005618 Bacteria 3454
129 Ga0068864_100216635 3300005618 Bacteria 1765
130 Ga0068866_10317658 3300005718 Bacteria 978
131 Ga0068870_10241281 3300005840 Bacteria 1116
132 Ga0068863_100143487 3300005841 Bacteria 2283
133 Ga0068863_100250153 3300005841 Bacteria 1712
134 Ga0068858_100038629 3300005842 Bacteria 4429
135 Ga0068858_100120587 3300005842 Bacteria 2452
136 Ga0068860_100101942 3300005843 Bacteria 2738
137 Ga0068862_101008367 3300005844 Bacteria 824
138 Ga0068862_101610697 3300005844 Bacteria 656
139 Ga0081455_10290191 3300005937 Bacteria 1178
140 Ga0081540_1000960 3300005983 Bacteria 26024
141 Ga0081539_10000168 3300005985 Bacteria 153724
142 Ga0081539_10001596 3300005985 Bacteria 37369
143 Ga0070717_10000613 3300006028 Bacteria 22913
144 Ga0070717_10003861 3300006028 Bacteria 10776
145 Ga0070717_10089543 3300006028 Bacteria 2595
146 Ga0070717_10184170 3300006028 Bacteria 1821
147 Ga0070717_10255600 3300006028 Bacteria 1549
148 Ga0070717_10268244 3300006028 Bacteria 1511
149 Ga0070717_10529486 3300006028 Bacteria 1066
150 Ga0070717_11387624 3300006028 Bacteria 638
151 Ga0070715_10003238 3300006163 Bacteria 5132
152 Ga0070715_10011325 3300006163 Bacteria 3210
153 Ga0070715_10017515 3300006163 Bacteria 2713
154 Ga0070715_10070031 3300006163 Bacteria 1564
155 Ga0070715_10091086 3300006163 Bacteria 1403
156 Ga0070716_100003016 3300006173 Bacteria 7853
157 Ga0070716_100006566 3300006173 Bacteria 5687
158 Ga0070716_100022526 3300006173 Bacteria 3330
159 Ga0070716_100046508 3300006173 Bacteria 2442
160 Ga0070716_100049433 3300006173 Bacteria 2382
161 Ga0070716_100107921 3300006173 Bacteria 1719
162 Ga0070716_100142998 3300006173 Bacteria 1528
163 Ga0070716_100161225 3300006173 Bacteria 1453
164 Ga0070716_100180091 3300006173 Bacteria 1387
165 Ga0070712_100001425 3300006175 Bacteria 14566
166 Ga0070712_100006067 3300006175 Bacteria 7481
167 Ga0070712_100068139 3300006175 Bacteria 2534
168 Ga0070712_100275053 3300006175 Bacteria 1354
169 Ga0070712_100474080 3300006175 Bacteria 1045
170 Ga0097621_100154910 3300006237 Bacteria 1966
171 Ga0068871_100078711 3300006358 Bacteria 2726
172 Ga0075433_10226640 3300006852 Bacteria 1660
173 Ga0075433_10821483 3300006852 Bacteria 812
174 Ga0075434_100174437 3300006871 Bacteria 2170
175 Ga0075434_100722038 3300006871 Bacteria 1013
176 Ga0075434_101054610 3300006871 Bacteria 826
177 Ga0068865_100484309 3300006881 Bacteria 1029
178 Ga0075436_100024664 3300006914 Bacteria 4135
179 Ga0075436_100287363 3300006914 Bacteria 1177
180 Ga0075436_100618483 3300006914 Bacteria 799
181 Ga0097620_100030304 3300006931 Bacteria 5428
182 Ga0075435_100463516 3300007076 Bacteria 1093
183 Ga0075435_100504994 3300007076 Bacteria 1045
184 Ga0099795_10055513 3300007788 Bacteria 1455
185 Ga0105251_10059567 3300009011 Bacteria 1800
186 Ga0105240_10107430 3300009093 Bacteria 3383
187 Ga0105240_10342987 3300009093 Bacteria 1696
188 Ga0111539_10760425 3300009094 Bacteria 1128
189 Ga0105245_10014529 3300009098 Bacteria 6856
190 Ga0105245_11087380 3300009098 Bacteria 846
191 Ga0105247_10022237 3300009101 Bacteria 3818
192 Ga0105247_10654236 3300009101 Bacteria 785
193 Ga0114129_10274852 3300009147 Bacteria 2253
194 Ga0105243_10032414 3300009148 Bacteria 4037
195 Ga0105241_10051803 3300009174 Bacteria 3132
196 Ga0105241_10191984 3300009174 Bacteria 1701
197 Ga0105241_10275241 3300009174 Bacteria 1436
198 Ga0105242_10628235 3300009176 Bacteria 1041
199 Ga0105248_10504725 3300009177 Bacteria 1364
200 Ga0105248_10742750 3300009177 Bacteria 1107
201 Ga0105237_10895640 3300009545 Bacteria 894
202 Ga0105238_10332936 3300009551 Bacteria 1505
203 Ga0105249_10077682 3300009553 Bacteria 3079
204 Ga0105249_11234610 3300009553 Bacteria 819
205 Ga0105239_10079492 3300010375 Bacteria 3609
206 Ga0105239_10335671 3300010375 Bacteria 1705
207 Ga0157341_1000456 3300012494 Bacteria 2067
208 Ga0157373_10108168 3300013100 Bacteria 1955
209 Ga0157371_10026824 3300013102 Bacteria 4184
210 Ga0157369_10011297 3300013105 Bacteria 10144
211 Ga0157369_10215324 3300013105 Bacteria 2012
212 Ga0157369_10577647 3300013105 Bacteria 1161
213 Ga0157369_10845954 3300013105 Bacteria 939
214 Ga0157374_10021503 3300013296 Bacteria 5742
215 Ga0157378_10155054 3300013297 Bacteria 2137
216 Ga0163162_10464161 3300013306 Bacteria 1398
217 Ga0163162_10572436 3300013306 Bacteria 1257
218 Ga0157375_10067111 3300013308 Bacteria 3584
219 Ga0157375_10414829 3300013308 Bacteria 1513
220 Ga0157375_10601299 3300013308 Bacteria 1259
221 Ga0163163_10080540 3300014325 Bacteria 3256
222 Ga0163163_10659864 3300014325 Bacteria 1109
223 Ga0157377_10030606 3300014745 Bacteria 2917
224 Ga0157376_10070067 3300014969 Bacteria 2975
225 Ga0163161_10293298 3300017792 Bacteria 1279
226 Ga0206352_10580932 3300020078 Bacteria 679
227 Ga0206354_10169703 3300020081 Bacteria 1439
228 Ga0206354_10517769 3300020081 Bacteria 2849
229 Ga0206353_10010843 3300020082 Bacteria 1842
230 Ga0206353_10373402 3300020082 Bacteria 1103
231 Ga0206353_11075300 3300020082 Bacteria 1649
232 Ga0213875_10003914 3300021388 Bacteria 8327
233 Ga0213875_10027609 3300021388 Bacteria 2701
234 Ga0224712_10043787 3300022467 Bacteria 1704
235 Ga0224572_1000411 3300024225 Bacteria 4890
236 Ga0207653_10011575 3300025885 Bacteria 2752
237 Ga0207692_10000088 3300025898 Bacteria 26975
238 Ga0207692_10028561 3300025898 Bacteria 2640
239 Ga0207692_10050147 3300025898 Bacteria 2109
240 Ga0207692_10052988 3300025898 Bacteria 2064
241 Ga0207692_10396893 3300025898 Bacteria 859
242 Ga0207642_10182244 3300025899 Bacteria 1145
243 Ga0207710_10083427 3300025900 Bacteria 1486
244 Ga0207680_10439570 3300025903 Bacteria 925
245 Ga0207647_10081670 3300025904 Bacteria 1937
246 Ga0207685_10005526 3300025905 Bacteria 3346
247 Ga0207685_10018343 3300025905 Bacteria 2283
248 Ga0207699_10000608 3300025906 Bacteria 17514
249 Ga0207699_10001012 3300025906 Bacteria 13309
250 Ga0207699_10004119 3300025906 Bacteria 6967
251 Ga0207699_10008170 3300025906 Bacteria 5151
252 Ga0207699_10014333 3300025906 Bacteria 4083
253 Ga0207699_10030959 3300025906 Bacteria 3000
254 Ga0207699_10099645 3300025906 Bacteria 1841
255 Ga0207699_10353773 3300025906 Bacteria 1037
256 Ga0207699_10608150 3300025906 Bacteria 796
257 Ga0207643_10039030 3300025908 Bacteria 2670
258 Ga0207705_10103263 3300025909 Bacteria 2099
259 Ga0207705_10167226 3300025909 Bacteria 1654
260 Ga0207705_10348128 3300025909 Bacteria 1141
261 Ga0207684_10000479 3300025910 Bacteria 51757
262 Ga0207684_10031124 3300025910 Bacteria 4541
263 Ga0207684_10038125 3300025910 Bacteria 4079
264 Ga0207684_10097069 3300025910 Bacteria 2515
265 Ga0207684_10267871 3300025910 Bacteria 1474
266 Ga0207684_10863774 3300025910 Bacteria 762
267 Ga0207654_10024927 3300025911 Bacteria 3221
268 Ga0207707_10070181 3300025912 Bacteria 3053
269 Ga0207695_10119018 3300025913 Bacteria 2612
270 Ga0207693_10000436 3300025915 Bacteria 38097
271 Ga0207693_10013696 3300025915 Bacteria 6533
272 Ga0207693_10028840 3300025915 Bacteria 4386
273 Ga0207693_10187025 3300025915 Bacteria 1630
274 Ga0207693_10252786 3300025915 Bacteria 1383
275 Ga0207693_10320784 3300025915 Bacteria 1213
276 Ga0207663_10000615 3300025916 Bacteria 15819
277 Ga0207663_10007709 3300025916 Bacteria 5601
278 Ga0207663_10015272 3300025916 Bacteria 4233
279 Ga0207663_10045564 3300025916 Bacteria 2698
280 Ga0207663_10088485 3300025916 Bacteria 2048
281 Ga0207663_10096041 3300025916 Bacteria 1979
282 Ga0207663_10252762 3300025916 Bacteria 1298
283 Ga0207663_10259204 3300025916 Bacteria 1283
284 Ga0207660_10127040 3300025917 Bacteria 1937
285 Ga0207657_10009348 3300025919 Bacteria 9867
286 Ga0207657_10092759 3300025919 Bacteria 2516
287 Ga0207657_10127284 3300025919 Bacteria 2091
288 Ga0207649_10065416 3300025920 Bacteria 2301
289 Ga0207649_10549674 3300025920 Bacteria 883
290 Ga0207652_10051551 3300025921 Bacteria 3528
291 Ga0207652_10121271 3300025921 Bacteria 2326
292 Ga0207652_10606183 3300025921 Bacteria 982
293 Ga0207646_10001795 3300025922 Bacteria 25949
294 Ga0207646_10037708 3300025922 Bacteria 4357
295 Ga0207646_10086289 3300025922 Bacteria 2808
296 Ga0207646_10152844 3300025922 Bacteria 2081
297 Ga0207646_10297110 3300025922 Bacteria 1459
298 Ga0207694_10135476 3300025924 Bacteria 1977
299 Ga0207694_10252978 3300025924 Bacteria 1442
300 Ga0207694_10399319 3300025924 Bacteria 1143
301 Ga0207659_10235298 3300025926 Bacteria 1479
302 Ga0207687_10122369 3300025927 Bacteria 1948
303 Ga0207700_10000029 3300025928 Bacteria 132615
304 Ga0207700_10005448 3300025928 Bacteria 7620
305 Ga0207700_10026096 3300025928 Bacteria 4069
306 Ga0207700_10043955 3300025928 Bacteria 3285
307 Ga0207700_10050230 3300025928 Bacteria 3107
308 Ga0207700_10053591 3300025928 Bacteria 3023
309 Ga0207700_10071911 3300025928 Bacteria 2665
310 Ga0207700_10292942 3300025928 Bacteria 1403
311 Ga0207700_10392408 3300025928 Bacteria 1215
312 Ga0207700_10976358 3300025928 Bacteria 758
313 Ga0207700_11206666 3300025928 Bacteria 675
314 Ga0207664_10000110 3300025929 Bacteria 72637
315 Ga0207664_10003503 3300025929 Bacteria 10479
316 Ga0207664_10017314 3300025929 Bacteria 5280
317 Ga0207664_10022560 3300025929 Bacteria 4703
318 Ga0207664_10041698 3300025929 Bacteria 3577
319 Ga0207664_10047498 3300025929 Bacteria 3373
320 Ga0207664_10079094 3300025929 Bacteria 2668
321 Ga0207664_10096587 3300025929 Bacteria 2432
322 Ga0207664_10109795 3300025929 Bacteria 2292
323 Ga0207664_10114508 3300025929 Bacteria 2247
324 Ga0207664_10120446 3300025929 Bacteria 2195
325 Ga0207664_10149922 3300025929 Bacteria 1980
326 Ga0207664_10256952 3300025929 Bacteria 1527
327 Ga0207664_10258149 3300025929 Bacteria 1523
328 Ga0207664_10303265 3300025929 Bacteria 1406
329 Ga0207664_11066056 3300025929 Bacteria 723
330 Ga0207644_10169885 3300025931 Bacteria 1701
331 Ga0207644_10496594 3300025931 Bacteria 1006
332 Ga0207706_10021844 3300025933 Bacteria 5744
333 Ga0207709_10167029 3300025935 Bacteria 1541
334 Ga0207665_10000144 3300025939 Bacteria 48077
335 Ga0207665_10001603 3300025939 Bacteria 15248
336 Ga0207665_10015291 3300025939 Bacteria 5039
337 Ga0207665_10019951 3300025939 Bacteria 4405
338 Ga0207665_10102307 3300025939 Bacteria 2002
339 Ga0207665_10242410 3300025939 Bacteria 1329
340 Ga0207665_10262766 3300025939 Bacteria 1279
341 Ga0207691_10153945 3300025940 Bacteria 2020
342 Ga0207689_10008458 3300025942 Bacteria 8963
343 Ga0207661_10000534 3300025944 Bacteria 24348
344 Ga0207661_10064694 3300025944 Bacteria 2965
345 Ga0207661_10279849 3300025944 Bacteria 1491
346 Ga0207661_10530458 3300025944 Bacteria 1077
347 Ga0207661_10557639 3300025944 Bacteria 1050
348 Ga0207679_10216486 3300025945 Bacteria 1609
349 Ga0207679_10237324 3300025945 Bacteria 1543
350 Ga0207667_10212261 3300025949 Bacteria 1984
351 Ga0207667_10287954 3300025949 Bacteria 1678
352 Ga0207651_10841634 3300025960 Bacteria 815
353 Ga0207640_10105079 3300025981 Bacteria 1989
354 Ga0207677_10067136 3300026023 Bacteria 2511
355 Ga0207677_10263742 3300026023 Bacteria 1405
356 Ga0207703_10362348 3300026035 Bacteria 1337
357 Ga0207703_10435679 3300026035 Bacteria 1222
358 Ga0207703_10879454 3300026035 Bacteria 857
359 Ga0207639_10081154 3300026041 Bacteria 2568
360 Ga0207678_10013141 3300026067 Bacteria 7264
361 Ga0207678_10023957 3300026067 Bacteria 5337
362 Ga0207708_10029675 3300026075 Bacteria 4145
363 Ga0207702_10131178 3300026078 Bacteria 2255
364 Ga0207702_10133041 3300026078 Bacteria 2240
365 Ga0207702_10147687 3300026078 Bacteria 2135
366 Ga0207702_10169821 3300026078 Bacteria 1999
367 Ga0207702_10283456 3300026078 Bacteria 1567
368 Ga0207641_10128559 3300026088 Bacteria 2271
369 Ga0207641_10169932 3300026088 Bacteria 1989
370 Ga0207641_10763465 3300026088 Bacteria 955
371 Ga0207676_10075198 3300026095 Bacteria 2724
372 Ga0207676_10095761 3300026095 Bacteria 2448
373 Ga0207674_10044680 3300026116 Bacteria 4562
374 Ga0207674_10053348 3300026116 Bacteria 4122
375 Ga0207674_10058820 3300026116 Bacteria 3892
376 Ga0207674_10058879 3300026116 Bacteria 3889
377 Ga0207675_100015848 3300026118 Bacteria 7029
378 Ga0207683_10081725 3300026121 Bacteria 2868
379 Ga0207698_10187060 3300026142 Bacteria 1840
380 Ga0207698_10604796 3300026142 Bacteria 1081
381 Ga0207428_10388682 3300027907 Bacteria 1023
382 Ga0268266_10063049 3300028379 Bacteria 3200
383 Ga0268266_10245973 3300028379 Bacteria 1652
384 Ga0268266_10827569 3300028379 Bacteria 894
385 Ga0268266_11129461 3300028379 Bacteria 758
386 Ga0265326_10014033 3300028558 Bacteria 2334
387 Ga0265319_1002350 3300028563 Bacteria 10400
388 Ga0265334_10001287 3300028573 Bacteria 12126
389 Ga0265322_10119163 3300028654 Bacteria 751
390 Ga0265336_10031700 3300028666 Bacteria 1641
391 Ga0265336_10074240 3300028666 Bacteria 1016
392 Ga0265338_10001268 3300028800 Bacteria 41631
393 Ga0265338_10008494 3300028800 Bacteria 12457
394 Ga0265338_10441864 3300028800 Bacteria 922
395 Ga0265332_10000806 3300031238 Bacteria 19038
396 Ga0265320_10092882 3300031240 Bacteria 1396
397 Ga0265325_10023840 3300031241 Bacteria 3335
398 Ga0265340_10012110 3300031247 Bacteria 4560
399 Ga0265339_10107959 3300031249 Bacteria 1443
400 Ga0265333_100268 3300031273 Bacteria 613
401 Ga0265316_10121623 3300031344 Bacteria 1971
402 Ga0307513_10080990 3300031456 Bacteria 3347
403 Ga0265314_10006319 3300031711 Bacteria 10507
404 Ga0265342_10007542 3300031712 Bacteria 7950
405 Ga0316214_1005909 3300033545 Bacteria 1611
406 Ga0316214_1019900 3300033545 Bacteria 937
407 Ga0373930_0020965 3300034816 Bacteria 1278
408 Ga0373950_0038877 3300034818 Bacteria 905
409 Ga0373959_0023760 3300034820 Bacteria 1194
410 Ga0373938_0019607 3300034957 Bacteria 1355
411 Ga0373938_0040393 3300034957 Bacteria 1035
412 Ga0373926_0001134 3300035083 Bacteria 7918
413 Ga0373926_0022191 3300035083 Bacteria 2202
414 Ga0373926_0041652 3300035083 Bacteria 1641
415 Ga0373926_0071754 3300035083 Bacteria 1273
416 Ga0373926_0121345 3300035083 Unclassified 986
417 Ga0373926_0223889 3300035083 Bacteria 726
418 Ga0373928_0002714 3300035084 Bacteria 3423
419 Ga0373929_0003272 3300035085 Bacteria 2930
420 Ga0373934_0000108 3300035086 Bacteria 29499
421 Ga0373934_0013193 3300035086 Bacteria 3122
422 Ga0373934_0027248 3300035086 Bacteria 2220
423 Ga0373934_0041723 3300035086 Bacteria 1812
424 Ga0373940_0006912 3300035088 Bacteria 2542
425 Ga0373940_0009897 3300035088 Bacteria 2229
426 Ga0373944_0000289 3300035089 Bacteria 11174
427 Ga0373949_0029974 3300035090 Bacteria 1291
428 Ga0373949_0111868 3300035090 Bacteria 759
429 Ga0373952_0069798 3300035092 Bacteria 876
430 Ga0373923_0000440 3300035111 Bacteria 9801
431 Ga0373923_0040322 3300035111 Bacteria 1921
432 Ga0373923_0057383 3300035111 Bacteria 1646
433 Ga0373923_0064270 3300035111 Bacteria 1565
434 Ga0373932_0025734 3300035112 Bacteria 1595
435 Ga0373932_0059220 3300035112 Bacteria 1159
436 Ga0373936_0012254 3300035113 Bacteria 3259
437 Ga0373936_0013551 3300035113 Bacteria 3112
438 Ga0373939_0022213 3300035114 Bacteria 1746
439 Ga0373941_0006307 3300035115 Bacteria 2849
440 Ga0373941_0062504 3300035115 Bacteria 1215
441 Ga0373945_0003403 3300035116 Bacteria 5002
442 Ga0373945_0046394 3300035116 Bacteria 1585
443 Ga0373945_0098883 3300035116 Bacteria 1139
444 Ga0373953_0000094 3300035117 Bacteria 21383
445 Ga0373953_0014394 3300035117 Bacteria 2844
446 Ga0373954_0017488 3300035118 Bacteria 3221
447 Ga0373954_0049604 3300035118 Bacteria 1968
448 Ga0373954_0055917 3300035118 Bacteria 1857
449 Ga0373954_0080796 3300035118 Bacteria 1553
450 Ga0373954_0166850 3300035118 Bacteria 1078
451 Ga0373956_0001194 3300035119 Bacteria 10735
452 Ga0373956_0023529 3300035119 Bacteria 2645
453 Ga0373956_0039119 3300035119 Bacteria 2101
454 Ga0373956_0073006 3300035119 Bacteria 1567
455 Ga0373957_0000166 3300035120 Bacteria 16937
456 Ga0373957_0017140 3300035120 Bacteria 2517
457 Ga0373957_0029204 3300035120 Bacteria 2013
458 Ga0373957_0184407 3300035120 Bacteria 866
459 Ga0373957_0244383 3300035120 Bacteria 754
460 Ga0373960_0005964 3300035121 Bacteria 2840
461 Ga0373960_0011035 3300035121 Bacteria 2218
462 Ga0373943_0010430 3300035170 Bacteria 4162
463 Ga0373943_0010566 3300035170 Bacteria 4139
464 Ga0373943_0040749 3300035170 Bacteria 2243
465 Ga0373943_0215177 3300035170 Bacteria 1068
466 Ga0373943_0305977 3300035170 Bacteria 903
467 Ga0373946_0000253 3300035171 Bacteria 16969
468 Ga0373946_0000665 3300035171 Bacteria 11525
469 Ga0373955_0000112 3300035172 Bacteria 32757
470 Ga0373955_0016168 3300035172 Bacteria 3668
471 Ga0373955_0034753 3300035172 Bacteria 2665
472 Ga0373955_0036781 3300035172 Bacteria 2600
473 Ga0373955_0149199 3300035172 Bacteria 1375
474 Ga0373942_0008613 3300035207 Bacteria 2380
475 Ga0373942_0014666 3300035207 Bacteria 1901
476 Ga0373924_0000211 3300035410 Bacteria 17761
477 Ga0373924_0036499 3300035410 Bacteria 1997
478 Ga0373924_0060595 3300035410 Bacteria 1582
479 Ga0373924_0070876 3300035410 Bacteria 1470
480 Ga0373924_0124105 3300035410 Bacteria 1121
481 Ga0373931_0025020 3300035691 Bacteria 3030
482 Ga0373931_0057950 3300035691 Bacteria 2079
483 Ga0373935_0000970 3300035692 Bacteria 15551
484 Ga0373935_0069952 3300035692 Bacteria 2262
485 Ga0373935_0146207 3300035692 Bacteria 1600
486 Ga0373935_0159764 3300035692 Bacteria 1535
487 Ga0373935_0327343 3300035692 Bacteria 1088
488 Ga0373935_0327790 3300035692 Bacteria 1088
489 Ga0373927_0003427 3300035695 Bacteria 11371
490 Ga0373927_0008071 3300035695 Bacteria 7107
491 Ga0373927_0051612 3300035695 Bacteria 2659
492 Ga0373927_0082711 3300035695 Bacteria 2082
493 Ga0373927_0145110 3300035695 Bacteria 1553
494 Ga0373927_0536300 3300035695 Bacteria 773
495 Ga0373933_0000022 3300035724 Bacteria 94582
496 Ga0373933_0008118 3300035724 Bacteria 5727
497 Ga0373933_0009952 3300035724 Bacteria 5204
498 Ga0373933_0010723 3300035724 Bacteria 5027
499 Ga0373933_0015930 3300035724 Bacteria 4196
500 Ga0373933_0041424 3300035724 Bacteria 2718
501 Ga0373933_0125134 3300035724 Bacteria 1612
502 Ga0373933_0215671 3300035724 Bacteria 1230
503 Ga0373947_0000006 3300035725 Bacteria 223611
504 Ga0373947_0001275 3300035725 Bacteria 15526
505 Ga0373947_0100360 3300035725 Bacteria 1818
506 Ga0373947_0136977 3300035725 Bacteria 1567
507 Ga0373947_0188985 3300035725 Bacteria 1343
508 Ga0373937_0000022 3300036401 Bacteria 127537
509 Ga0373937_0008926 3300036401 Bacteria 8704
510 Ga0373937_0021822 3300036401 Bacteria 5748
511 Ga0373937_0031743 3300036401 Bacteria 4787
512 Ga0373937_0067715 3300036401 Bacteria 3290
513 Ga0373937_0082709 3300036401 Bacteria 2970
514 Ga0373937_0091797 3300036401 Bacteria 2814
515 Ga0372808_001444 3300036459 Bacteria 2471
516 Ga0373925_0026273 3300037068 Bacteria 4260
517 Ga0373925_0035770 3300037068 Bacteria 3666
518 Ga0373925_0082951 3300037068 Bacteria 2440
519 Ga0373925_0100820 3300037068 Bacteria 2219
520 Ga0373925_0388852 3300037068 Bacteria 1136
521 Ga0373925_0940153 3300037068 Bacteria 712
522 Ga0395898_0082286 3300037466 Bacteria 3103
523 Ga0436364_0037108 3300037853 Bacteria 71393
524 Ga0436364_0261597 3300037853 Bacteria 1114
525 Ga0436364_0287557 3300037853 Bacteria 2574
526 Ga0436364_0939371 3300037853 Bacteria 4107
527 Ga0436364_1104976 3300037853 Bacteria 23337
528 Ga0436364_1228585 3300037853 Bacteria 1633
529 Ga0436360_0208988 3300039438 Bacteria 2006
530 Ga0436363_0334125 3300039450 Bacteria 1123
531 Ga0436363_0902303 3300039450 Bacteria 3476
532 Ga0436362_1163076 3300039453 Bacteria 724
533 Ga0466967_0386297 3300045976 Bacteria 1360
534 Ga0495592_0000025 3300046454 Bacteria 136324
535 Ga0495592_0021532 3300046454 Bacteria 4904
536 Ga0495592_0041359 3300046454 Bacteria 3454
537 Ga0495592_0085010 3300046454 Bacteria 2281
538 Ga0495592_0314287 3300046454 Bacteria 1014
539 Ga0495592_0547723 3300046454 Bacteria 712
540 Ga0495603_0005042 3300046455 Bacteria 7895
541 Ga0495603_0127411 3300046455 Bacteria 1483
542 Ga0495629_0002510 3300046459 Bacteria 14082
543 Ga0495629_0128252 3300046459 Bacteria 1767
544 Ga0495629_0144145 3300046459 Bacteria 1657
545 Ga0495629_0335007 3300046459 Bacteria 1033
546 Ga0495629_0475182 3300046459 Bacteria 845
547 Ga0495641_0023745 3300046461 Bacteria 3039
548 Ga0495641_0025292 3300046461 Bacteria 2915
549 Ga0495641_0033918 3300046461 Bacteria 2418
550 Ga0495641_0060163 3300046461 Bacteria 1716
551 Ga0495651_0000014 3300046462 Bacteria 136312
552 Ga0495651_0007180 3300046462 Bacteria 8517
553 Ga0495651_0021944 3300046462 Bacteria 4965
554 Ga0495651_0028505 3300046462 Bacteria 4350
555 Ga0495651_0042434 3300046462 Bacteria 3531
556 Ga0495651_0048290 3300046462 Bacteria 3287
557 Ga0495651_0088658 3300046462 Bacteria 2324
558 Ga0495651_0143650 3300046462 Bacteria 1727
559 Ga0495653_0014717 3300046463 Bacteria 6381
560 Ga0495653_0016957 3300046463 Bacteria 5924
561 Ga0495653_0026663 3300046463 Bacteria 4631
562 Ga0495653_0043271 3300046463 Bacteria 3502
563 Ga0495653_0044783 3300046463 Bacteria 3433
564 Ga0495653_0045692 3300046463 Bacteria 3394
565 Ga0495653_0046178 3300046463 Bacteria 3373
566 Ga0495653_0063155 3300046463 Bacteria 2796
567 Ga0495653_0078687 3300046463 Bacteria 2444
568 Ga0495653_0119616 3300046463 Bacteria 1880
569 Ga0495580_0172773 3300046472 Bacteria 1493
570 Ga0495580_0338896 3300046472 Bacteria 1020
571 Ga0495582_0018083 3300046473 Bacteria 3855
572 Ga0495582_0045935 3300046473 Bacteria 2405
573 Ga0495582_0112136 3300046473 Bacteria 1532
574 Ga0495639_0003951 3300046475 Bacteria 6368
575 Ga0495639_0378547 3300046475 Bacteria 713
576 Ga0495639_0464978 3300046475 Bacteria 643
577 Ga0495662_0000415 3300046476 Bacteria 19153
578 Ga0495662_0020737 3300046476 Bacteria 3179
579 Ga0495662_0048126 3300046476 Bacteria 2058
580 Ga0495662_0073669 3300046476 Bacteria 1656
581 Ga0495662_0075897 3300046476 Bacteria 1631
582 Ga0495662_0154573 3300046476 Bacteria 1130
583 Ga0495662_0166289 3300046476 Bacteria 1087
584 Ga0495664_0008128 3300046477 Bacteria 5843
585 Ga0495664_0029022 3300046477 Bacteria 3233
586 Ga0495664_0120739 3300046477 Bacteria 1585
587 Ga0495664_0125558 3300046477 Bacteria 1552
588 Ga0495594_0047095 3300046499 Bacteria 2368
589 Ga0495594_0124249 3300046499 Bacteria 1460
590 Ga0495608_0000190 3300046511 Bacteria 43597
591 Ga0495608_0028031 3300046511 Bacteria 3828
592 Ga0495608_0028686 3300046511 Bacteria 3782
593 Ga0495608_0033081 3300046511 Bacteria 3496
594 Ga0495608_0070311 3300046511 Bacteria 2284
595 Ga0495608_0129896 3300046511 Bacteria 1613
596 Ga0495608_0140027 3300046511 Bacteria 1544
597 Ga0495608_0208713 3300046511 Bacteria 1228
598 Ga0495618_0023599 3300046514 Bacteria 3805
599 Ga0495618_0033244 3300046514 Bacteria 3233
600 Ga0495618_0255303 3300046514 Bacteria 1099
601 Ga0495628_0000346 3300046516 Bacteria 42250
602 Ga0495628_0096929 3300046516 Bacteria 2278
603 Ga0495628_0100836 3300046516 Bacteria 2228
604 Ga0495628_0137232 3300046516 Bacteria 1868
605 Ga0495628_0190508 3300046516 Bacteria 1548
606 Ga0495628_0304756 3300046516 Bacteria 1178
607 Ga0495628_0340798 3300046516 Bacteria 1103
608 Ga0495630_0079683 3300046517 Bacteria 2470
609 Ga0495630_0142407 3300046517 Bacteria 1823
610 Ga0495630_0153212 3300046517 Bacteria 1754
611 Ga0495666_0036493 3300046526 Bacteria 2394
612 Ga0495666_0401726 3300046526 Bacteria 616
613 Ga0495652_0009488 3300046529 Bacteria 8837
614 Ga0495652_0010242 3300046529 Bacteria 8500
615 Ga0495652_0030510 3300046529 Bacteria 4727
616 Ga0495652_0038016 3300046529 Bacteria 4172
617 Ga0495652_0079960 3300046529 Bacteria 2701
618 Ga0495652_0091033 3300046529 Bacteria 2494
619 Ga0495652_0130949 3300046529 Bacteria 1986
620 Ga0495652_0266493 3300046529 Bacteria 1261
621 Ga0495652_0467933 3300046529 Bacteria 879
622 Ga0495652_0621910 3300046529 Bacteria 734
623 Ga0495665_0000524 3300046531 Bacteria 19423
624 Ga0495665_0014274 3300046531 Bacteria 4285
625 Ga0495665_0015164 3300046531 Bacteria 4154
626 Ga0495665_0109107 3300046531 Bacteria 1452
627 Ga0495640_0002533 3300046533 Bacteria 14681
628 Ga0495640_0030276 3300046533 Bacteria 3877
629 Ga0495640_0040272 3300046533 Bacteria 3273
630 Ga0495640_0046332 3300046533 Bacteria 3012
631 Ga0495640_0048094 3300046533 Bacteria 2949
632 Ga0495640_0095045 3300046533 Bacteria 1962
633 Ga0495640_0237811 3300046533 Bacteria 1144
634 Ga0495586_0006410 3300046535 Bacteria 6286
635 Ga0495586_0097256 3300046535 Bacteria 1631
636 Ga0495586_0466895 3300046535 Bacteria 728
637 Ga0495587_0000029 3300046536 Bacteria 136321
638 Ga0495587_0006950 3300046536 Bacteria 7350
639 Ga0495587_0012669 3300046536 Bacteria 5303
640 Ga0495587_0081467 3300046536 Bacteria 1875
641 Ga0495587_0111654 3300046536 Bacteria 1570
642 Ga0495587_0128291 3300046536 Bacteria 1450
643 Ga0495587_0269542 3300046536 Bacteria 955
644 Ga0495645_0022525 3300046543 Bacteria 4558
645 Ga0495645_0033757 3300046543 Bacteria 3733
646 Ga0495645_0113797 3300046543 Bacteria 1912
647 Ga0495645_0128315 3300046543 Bacteria 1780
648 Ga0495645_0181273 3300046543 Bacteria 1443
649 Ga0495645_0300157 3300046543 Bacteria 1049
650 Ga0495667_0000036 3300046559 Bacteria 136146
651 Ga0495667_0000607 3300046559 Bacteria 22870
652 Ga0495667_0001443 3300046559 Bacteria 15660
653 Ga0495667_0011226 3300046559 Bacteria 6067
654 Ga0495667_0127393 3300046559 Bacteria 1642
655 Ga0495667_0308849 3300046559 Bacteria 1001
656 Ga0495667_0315536 3300046559 Bacteria 989
657 Ga0495634_0030816 3300046642 Bacteria 3699
658 Ga0495634_0044601 3300046642 Bacteria 3000
659 Ga0495634_0069302 3300046642 Bacteria 2327
660 Ga0495634_0079689 3300046642 Bacteria 2144
661 Ga0495634_0084894 3300046642 Bacteria 2064
662 Ga0495634_0098423 3300046642 Bacteria 1892
663 Ga0495635_0000666 3300046663 Bacteria 22059
664 Ga0495635_0004586 3300046663 Bacteria 9583
665 Ga0495635_0008790 3300046663 Bacteria 7053
666 Ga0495635_0017383 3300046663 Bacteria 5024
667 Ga0495635_0038965 3300046663 Bacteria 3290
668 Ga0495635_0110970 3300046663 Bacteria 1873
669 Ga0495588_0058930 3300046674 Bacteria 1985
670 Ga0495657_0000071 3300046675 Bacteria 92182
671 Ga0495657_0004781 3300046675 Bacteria 10796
672 Ga0495657_0008636 3300046675 Bacteria 7776
673 Ga0495657_0038498 3300046675 Bacteria 3290
674 Ga0495657_0044277 3300046675 Bacteria 3028
675 Ga0495657_0052598 3300046675 Bacteria 2729
676 Ga0495599_0000094 3300046678 Bacteria 62648
677 Ga0495599_0010549 3300046678 Bacteria 5652
678 Ga0495599_0025290 3300046678 Bacteria 3715
679 Ga0495599_0045618 3300046678 Bacteria 2748
680 Ga0495599_0075935 3300046678 Bacteria 2098
681 Ga0495599_0088526 3300046678 Bacteria 1933
682 Ga0495599_0373501 3300046678 Bacteria 852
683 Ga0495623_0000113 3300046679 Bacteria 49223
684 Ga0495623_0067661 3300046679 Bacteria 2229
685 Ga0495623_0073363 3300046679 Bacteria 2127
686 Ga0495623_0126899 3300046679 Bacteria 1531
687 Ga0495646_0008387 3300046680 Bacteria 6569
688 Ga0495646_0031995 3300046680 Bacteria 3275
689 Ga0495646_0079454 3300046680 Bacteria 1915
690 Ga0495646_0169645 3300046680 Bacteria 1203
691 Ga0495647_0019101 3300046681 Bacteria 2448
692 Ga0495647_0032534 3300046681 Bacteria 1944
693 Ga0495658_0003156 3300046683 Bacteria 8214
694 Ga0495658_0246658 3300046683 Bacteria 1122
695 Ga0495613_0155947 3300046689 Bacteria 1626
696 Ga0495624_0003337 3300046690 Bacteria 11932
697 Ga0495624_0026797 3300046690 Bacteria 3776
698 Ga0495624_0051450 3300046690 Bacteria 2606
699 Ga0495600_0056648 3300046809 Bacteria 2561
700 Ga0495600_0074984 3300046809 Bacteria 2209
701 Ga0495600_0430895 3300046809 Bacteria 817
702 Ga0495581_0000903 3300047315 Bacteria 15917
703 Ga0495581_0187254 3300047315 Bacteria 1210
704 Ga0495581_0282435 3300047315 Bacteria 970
705 Ga0495604_0000044 3300047317 Bacteria 112937
706 Ga0495604_0023045 3300047317 Bacteria 4969
707 Ga0495604_0115051 3300047317 Bacteria 1955
708 Ga0495604_0145466 3300047317 Bacteria 1689
709 Ga0495604_0253470 3300047317 Bacteria 1199
710 Ga0495604_0300080 3300047317 Bacteria 1079
711 Ga0495674_0000044 3300047319 Bacteria 84651
712 Ga0495674_0020966 3300047319 Bacteria 6047
713 Ga0495674_0057081 3300047319 Bacteria 3417
714 Ga0495674_0059918 3300047319 Bacteria 3323
715 Ga0495674_0145173 3300047319 Bacteria 1992
716 Ga0495674_0171184 3300047319 Bacteria 1812
717 Ga0495676_0008527 3300047321 Bacteria 9393
718 Ga0495676_0058852 3300047321 Bacteria 3021
719 Ga0495676_0158664 3300047321 Bacteria 1602
720 Ga0495680_0000219 3300047322 Bacteria 62686
721 Ga0495680_0008298 3300047322 Bacteria 9458
722 Ga0495680_0009686 3300047322 Bacteria 8646
723 Ga0495680_0017665 3300047322 Bacteria 6078
724 Ga0495680_0018149 3300047322 Bacteria 5983
725 Ga0495680_0043101 3300047322 Bacteria 3575
726 Ga0495680_0048768 3300047322 Bacteria 3323
727 Ga0495680_0192560 3300047322 Bacteria 1466
728 Ga0495680_0349093 3300047322 Bacteria 1030
729 Ga0495675_0002157 3300047444 Bacteria 11734
730 Ga0495675_0004181 3300047444 Bacteria 8733
731 Ga0495675_0023500 3300047444 Bacteria 3928
732 Ga0495675_0056484 3300047444 Bacteria 2489
733 Ga0495675_0098618 3300047444 Bacteria 1830
734 Ga0495684_0000962 3300047471 Bacteria 23465
735 Ga0495684_0019115 3300047471 Bacteria 5275
736 Ga0495684_0023643 3300047471 Bacteria 4725
737 Ga0495684_0045001 3300047471 Bacteria 3378
738 Ga0495684_0047586 3300047471 Bacteria 3279
739 Ga0495684_0058044 3300047471 Bacteria 2948
740 Ga0495684_0064779 3300047471 Bacteria 2777
741 Ga0495684_0367508 3300047471 Bacteria 1017
742 Ga0495593_0013529 3300047673 Bacteria 4652
743 Ga0495593_0063625 3300047673 Bacteria 1926
744 Ga0495593_0123293 3300047673 Bacteria 1318
745 Ga0495593_0484999 3300047673 Bacteria 619
746 Ga0495602_0000480 3300048088 Bacteria 36967
747 Ga0495602_0011445 3300048088 Bacteria 9175
748 Ga0495602_0051492 3300048088 Bacteria 3666
749 Ga0495602_0081676 3300048088 Bacteria 2716
750 Ga0495602_0130961 3300048088 Bacteria 2000
751 Ga0495602_0144692 3300048088 Bacteria 1877
752 Ga0495602_0314385 3300048088 Bacteria 1142
753 Ga0495602_0436655 3300048088 Bacteria 926
754 Ga0495614_0005646 3300048089 Bacteria 5641
755 Ga0496100_0069654 3300048903 Bacteria 2343
756 Ga0496100_0380351 3300048903 Bacteria 1072
757 Ga0496100_0642941 3300048903 Bacteria 825
758 Ga0496101_0081580 3300048904 Bacteria 2392
759 Ga0496101_0139003 3300048904 Bacteria 1850
760 Ga0496102_0026222 3300048905 Bacteria 5196
761 Ga0496102_0082077 3300048905 Bacteria 2973
762 Ga0496102_1043812 3300048905 Bacteria 737
763 Ga0496103_0112067 3300048906 Bacteria 1733
764 Ga0496104_0000937 3300048907 Bacteria 25040
765 Ga0496104_0008559 3300048907 Bacteria 9098
766 Ga0496104_0226081 3300048907 Bacteria 1783
767 Ga0496105_0004650 3300048908 Bacteria 10346
768 Ga0496105_0039198 3300048908 Bacteria 3904
769 Ga0496105_0039664 3300048908 Bacteria 3882
770 Ga0496105_0141738 3300048908 Bacteria 1978
771 Ga0496105_0532042 3300048908 Bacteria 919
772 Ga0496106_0084617 3300048909 Bacteria 2440
773 Ga0496106_0460027 3300048909 Bacteria 1022
774 Ga0496107_0243041 3300048910 Bacteria 1339
775 Ga0496107_0550371 3300048910 Bacteria 855
776 Ga0496108_0013818 3300048911 Bacteria 6586
777 Ga0496108_0018374 3300048911 Bacteria 5725
778 Ga0496108_0329259 3300048911 Bacteria 1332
779 Ga0496108_0334223 3300048911 Bacteria 1321
780 Ga0496109_0282136 3300048912 Bacteria 1565
781 Ga0496110_0008342 3300048913 Bacteria 8335
782 Ga0496110_0020460 3300048913 Bacteria 5588
783 Ga0496110_0175364 3300048913 Bacteria 1946
784 Ga0496110_0402202 3300048913 Bacteria 1248
785 Ga0496110_1027197 3300048913 Bacteria 732
786 Ga0496111_0050441 3300048914 Bacteria 3002
787 Ga0496111_0089111 3300048914 Bacteria 2259
788 Ga0496112_0000856 3300048915 Bacteria 21735
789 Ga0496112_0321594 3300048915 Bacteria 1491
790 Ga0496112_0379829 3300048915 Bacteria 1354
791 Ga0496113_0002091 3300048916 Bacteria 11499
792 Ga0496113_0060684 3300048916 Bacteria 2851
793 Ga0496113_0237122 3300048916 Bacteria 1455
794 Ga0496114_0115280 3300048917 Bacteria 2305
795 Ga0496114_0116764 3300048917 Bacteria 2291
796 Ga0496114_0426917 3300048917 Bacteria 1174
797 Ga0496114_0734777 3300048917 Bacteria 864
798 Ga0496115_0010010 3300048918 Bacteria 7066
799 Ga0496115_0103986 3300048918 Bacteria 2330
800 Ga0496115_0208692 3300048918 Bacteria 1613
801 Ga0496115_0454258 3300048918 Bacteria 1034
802 Ga0496126_0073104 3300048929 Bacteria 3049
803 Ga0496126_0119671 3300048929 Bacteria 2285
804 Ga0496126_0385488 3300048929 Bacteria 1140
805 nmdc:mga05p37_17739_c1 3300050507 Bacteria 8590
806 nmdc:mga08y16_281472_c1 3300050511 Bacteria 1715
807 nmdc:mga0n895_431931_c1 3300050512 Bacteria 1331
808 nmdc:mga0rr50_412662_c1 3300050513 Bacteria 1142
809 nmdc:mga0rr50_479843_c1 3300050513 Bacteria 1056
810 nmdc:mga08x19_153879_c1 3300050514 Bacteria 1559
811 nmdc:mga08x19_158074_c1 3300050514 Bacteria 1538
812 nmdc:mga08x19_361036_c1 3300050514 Bacteria 1015
813 nmdc:mga08x19_567600_c1 3300050514 Bacteria 803
814 nmdc:mga08x19_932844_c1 3300050514 Bacteria 617
815 nmdc:mga0a205_268338_c1 3300050515 Bacteria 1584
816 nmdc:mga0a205_328002_c1 3300050515 Bacteria 1401
817 Ga0495601_0093640 3300053077 Bacteria 1935
818 Ga0495601_0301055 3300053077 Bacteria 1044
819 Ga0495601_0416969 3300053077 Bacteria 870
820 Ga0495601_0463444 3300053077 Bacteria 819
821 Ga0495612_0023842 3300053078 Bacteria 2456
822 Ga0495612_0047110 3300053078 Bacteria 1766
823 Ga0495612_0056807 3300053078 Bacteria 1616
824 Ga0495595_0002659 3300053084 Bacteria 7012
825 Ga0495595_0019682 3300053084 Bacteria 2932
826 Ga0495595_0024477 3300053084 Bacteria 2667
827 Ga0495619_0018796 3300053085 Bacteria 4387
828 Ga0495619_0131015 3300053085 Bacteria 1723
829 Ga0495619_0196856 3300053085 Bacteria 1395
830 Ga0495619_0216579 3300053085 Bacteria 1326
831 Ga0070706_100200006
832 JGI25406J46586_10026636
833 JGI25406J46586_10051432
834 Ga0070658_10115677
835 Ga0070676_10132357
836 Ga0070683_100046191
837 Ga0070683_100051955
838 Ga0070683_100090481
839 Ga0070683_100292721
840 Ga0070683_100745345
841 Ga0070690_100063725
842 Ga0070690_100445728
843 Ga0068869_100241097
844 Ga0070680_100046060
845 Ga0070680_100933244
846 Ga0070682_100037102
847 Ga0070682_100097853
848 Ga0070682_100553687
849 Ga0068868_100235676
850 Ga0070660_100029919
851 Ga0070660_100109202
852 Ga0070660_100274378
853 Ga0070689_100061655
854 Ga0070691_10012298
855 Ga0070691_10093505
856 Ga0070687_100026444
857 Ga0070661_100031694
858 Ga0070661_100084305
859 Ga0070661_100235328
860 Ga0070692_10099929
861 Ga0070669_100215396
862 Ga0070675_100071388
863 Ga0070671_100136085
864 Ga0070671_100160710
865 Ga0070673_100077674
866 Ga0070667_100120941
867 Ga0070703_10023877
868 Ga0070709_10000165
869 Ga0070709_10072380
870 Ga0070709_10198176
871 Ga0070709_10381062
872 Ga0070714_100000318
873 Ga0070714_100000689
874 Ga0070714_100107703
875 Ga0070714_100130892
876 Ga0070714_100314723
877 Ga0070714_100323225
878 Ga0070714_100327661
879 Ga0070714_100434270
880 Ga0070714_100451261
881 Ga0070713_100002403
882 Ga0070713_100077760
883 Ga0070713_100085400
884 Ga0070713_100110827
885 Ga0070713_100209379
886 Ga0070713_100295037
887 Ga0070710_10004650
888 Ga0070710_10111283
889 Ga0070701_10054289
890 Ga0070711_100000158
891 Ga0070711_100061073
892 Ga0070711_100185136
893 Ga0070705_100039731
894 Ga0070700_100046386
895 Ga0070694_100451049
896 Ga0070708_100027451
897 Ga0070708_100046036
898 Ga0070708_100069236
899 Ga0070708_100174273
900 Ga0070708_100286122
901 Ga0070663_100176013
902 Ga0070678_100071149
903 Ga0070662_100200609
904 Ga0070681_10072320
905 Ga0070681_10142805
906 Ga0070685_10425788
907 Ga0070706_100007197
908 Ga0070706_100025430
909 Ga0070706_100025704
910 Ga0070706_100061551
911 Ga0070706_100309083
912 Ga0070707_100002252
913 Ga0070707_100013838
914 Ga0070707_100025462
915 Ga0070707_100118089
916 Ga0070707_100356140
917 Ga0070707_100377365
918 Ga0070698_100000028
919 Ga0070698_100017873
920 Ga0070698_100036945
921 Ga0070698_100116624
922 Ga0070698_100419988
923 Ga0070699_100314352
924 Ga0070679_100029643
925 Ga0070679_100091308
926 Ga0070679_100212928
927 Ga0070679_100225635
928 Ga0070679_100251424
929 Ga0070679_100976554
930 Ga0070684_100056907
931 Ga0070684_100061371
932 Ga0070684_100420442
933 Ga0070697_100128279
934 Ga0068853_100245316
935 Ga0070672_100080750
936 Ga0070686_100214169
937 Ga0070695_100685073
938 Ga0070693_100029706
939 Ga0070693_100191468
940 Ga0070665_100094927
941 Ga0070665_100395622
942 Ga0070704_100533625
943 Ga0068855_100287901
944 Ga0068855_100296141
945 Ga0068855_100584951
946 Ga0070664_100049942
947 Ga0068857_100076359
948 Ga0068854_100058858
949 Ga0068856_100039845
950 Ga0068856_100125024
951 Ga0068856_100202278
952 Ga0068856_100377649
953 Ga0068856_100714355
954 Ga0070702_100031011
955 Ga0070702_100058569
956 Ga0068852_100219060
957 Ga0068859_100030304
958 Ga0068864_100054407
959 Ga0068864_100216635
960 Ga0068866_10317658
961 Ga0068870_10241281
962 Ga0068863_100143487
963 Ga0068863_100250153
964 Ga0068858_100038629
965 Ga0068858_100120587
966 Ga0068860_100101942
967 Ga0068862_101008367
968 Ga0068862_101610697
969 Ga0081455_10290191
970 Ga0081540_1000960
971 Ga0081539_10000168
972 Ga0081539_10001596
973 Ga0070717_10000613
974 Ga0070717_10003861
975 Ga0070717_10089543
976 Ga0070717_10184170
977 Ga0070717_10255600
978 Ga0070717_10268244
979 Ga0070717_10529486
980 Ga0070717_11387624
981 Ga0070715_10003238
982 Ga0070715_10011325
983 Ga0070715_10017515
984 Ga0070715_10070031
985 Ga0070715_10091086
986 Ga0070716_100003016
987 Ga0070716_100006566
988 Ga0070716_100022526
989 Ga0070716_100046508
990 Ga0070716_100049433
991 Ga0070716_100107921
992 Ga0070716_100142998
993 Ga0070716_100161225
994 Ga0070716_100180091
995 Ga0070712_100001425
996 Ga0070712_100006067
997 Ga0070712_100068139
998 Ga0070712_100275053
999 Ga0070712_100474080
1000 Ga0097621_100154910
1001 Ga0068871_100078711
1002 Ga0075433_10226640
1003 Ga0075433_10821483
1004 Ga0075434_100174437
1005 Ga0075434_100722038
1006 Ga0075434_101054610
1007 Ga0068865_100484309
1008 Ga0075436_100024664
1009 Ga0075436_100287363
1010 Ga0075436_100618483
1011 Ga0097620_100030304
1012 Ga0075435_100463516
1013 Ga0075435_100504994
1014 Ga0099795_10055513
1015 Ga0105251_10059567
1016 Ga0105240_10107430
1017 Ga0105240_10342987
1018 Ga0111539_10760425
1019 Ga0105245_10014529
1020 Ga0105245_11087380
1021 Ga0105247_10022237
1022 Ga0105247_10654236
1023 Ga0114129_10274852
1024 Ga0105243_10032414
1025 Ga0105241_10051803
1026 Ga0105241_10191984
1027 Ga0105241_10275241
1028 Ga0105242_10628235
1029 Ga0105248_10504725
1030 Ga0105248_10742750
1031 Ga0105237_10895640
1032 Ga0105238_10332936
1033 Ga0105249_10077682
1034 Ga0105249_11234610
1035 Ga0105239_10079492
1036 Ga0105239_10335671
1037 Ga0157341_1000456
1038 Ga0157373_10108168
1039 Ga0157371_10026824
1040 Ga0157369_10011297
1041 Ga0157369_10215324
1042 Ga0157369_10577647
1043 Ga0157369_10845954
1044 Ga0157374_10021503
1045 Ga0157378_10155054
1046 Ga0163162_10464161
1047 Ga0163162_10572436
1048 Ga0157375_10067111
1049 Ga0157375_10414829
1050 Ga0157375_10601299
1051 Ga0163163_10080540
1052 Ga0163163_10659864
1053 Ga0157377_10030606
1054 Ga0157376_10070067
1055 Ga0163161_10293298
1056 Ga0206352_10580932
1057 Ga0206354_10169703
1058 Ga0206354_10517769
1059 Ga0206353_10010843
1060 Ga0206353_10373402
1061 Ga0206353_11075300
1062 Ga0213875_10003914
1063 Ga0213875_10027609
1064 Ga0224712_10043787
1065 Ga0224572_1000411
1066 Ga0207653_10011575
1067 Ga0207692_10000088
1068 Ga0207692_10028561
1069 Ga0207692_10050147
1070 Ga0207692_10052988
1071 Ga0207692_10396893
1072 Ga0207642_10182244
1073 Ga0207710_10083427
1074 Ga0207680_10439570
1075 Ga0207647_10081670
1076 Ga0207685_10005526
1077 Ga0207685_10018343
1078 Ga0207699_10000608
1079 Ga0207699_10001012
1080 Ga0207699_10004119
1081 Ga0207699_10008170
1082 Ga0207699_10014333
1083 Ga0207699_10030959
1084 Ga0207699_10099645
1085 Ga0207699_10353773
1086 Ga0207699_10608150
1087 Ga0207643_10039030
1088 Ga0207705_10103263
1089 Ga0207705_10167226
1090 Ga0207705_10348128
1091 Ga0207684_10000479
1092 Ga0207684_10031124
1093 Ga0207684_10038125
1094 Ga0207684_10097069
1095 Ga0207684_10267871
1096 Ga0207684_10863774
1097 Ga0207654_10024927
1098 Ga0207707_10070181
1099 Ga0207695_10119018
1100 Ga0207693_10000436
1101 Ga0207693_10013696
1102 Ga0207693_10028840
1103 Ga0207693_10187025
1104 Ga0207693_10252786
1105 Ga0207693_10320784
1106 Ga0207663_10000615
1107 Ga0207663_10007709
1108 Ga0207663_10015272
1109 Ga0207663_10045564
1110 Ga0207663_10088485
1111 Ga0207663_10096041
1112 Ga0207663_10252762
1113 Ga0207663_10259204
1114 Ga0207660_10127040
1115 Ga0207657_10009348
1116 Ga0207657_10092759
1117 Ga0207657_10127284
1118 Ga0207649_10065416
1119 Ga0207649_10549674
1120 Ga0207652_10051551
1121 Ga0207652_10121271
1122 Ga0207652_10606183
1123 Ga0207646_10001795
1124 Ga0207646_10037708
1125 Ga0207646_10086289
1126 Ga0207646_10152844
1127 Ga0207646_10297110
1128 Ga0207694_10135476
1129 Ga0207694_10252978
1130 Ga0207694_10399319
1131 Ga0207659_10235298
1132 Ga0207687_10122369
1133 Ga0207700_10000029
1134 Ga0207700_10005448
1135 Ga0207700_10026096
1136 Ga0207700_10043955
1137 Ga0207700_10050230
1138 Ga0207700_10053591
1139 Ga0207700_10071911
1140 Ga0207700_10292942
1141 Ga0207700_10392408
1142 Ga0207700_10976358
1143 Ga0207700_11206666
1144 Ga0207664_10000110
1145 Ga0207664_10003503
1146 Ga0207664_10017314
1147 Ga0207664_10022560
1148 Ga0207664_10041698
1149 Ga0207664_10047498
1150 Ga0207664_10079094
1151 Ga0207664_10096587
1152 Ga0207664_10109795
1153 Ga0207664_10114508
1154 Ga0207664_10120446
1155 Ga0207664_10149922
1156 Ga0207664_10256952
1157 Ga0207664_10258149
1158 Ga0207664_10303265
1159 Ga0207664_11066056
1160 Ga0207644_10169885
1161 Ga0207644_10496594
1162 Ga0207706_10021844
1163 Ga0207709_10167029
1164 Ga0207665_10000144
1165 Ga0207665_10001603
1166 Ga0207665_10015291
1167 Ga0207665_10019951
1168 Ga0207665_10102307
1169 Ga0207665_10242410
1170 Ga0207665_10262766
1171 Ga0207691_10153945
1172 Ga0207689_10008458
1173 Ga0207661_10000534
1174 Ga0207661_10064694
1175 Ga0207661_10279849
1176 Ga0207661_10530458
1177 Ga0207661_10557639
1178 Ga0207679_10216486
1179 Ga0207679_10237324
1180 Ga0207667_10212261
1181 Ga0207667_10287954
1182 Ga0207651_10841634
1183 Ga0207640_10105079
1184 Ga0207677_10067136
1185 Ga0207677_10263742
1186 Ga0207703_10362348
1187 Ga0207703_10435679
1188 Ga0207703_10879454
1189 Ga0207639_10081154
1190 Ga0207678_10013141
1191 Ga0207678_10023957
1192 Ga0207708_10029675
1193 Ga0207702_10131178
1194 Ga0207702_10133041
1195 Ga0207702_10147687
1196 Ga0207702_10169821
1197 Ga0207702_10283456
1198 Ga0207641_10128559
1199 Ga0207641_10169932
1200 Ga0207641_10763465
1201 Ga0207676_10075198
1202 Ga0207676_10095761
1203 Ga0207674_10044680
1204 Ga0207674_10053348
1205 Ga0207674_10058820
1206 Ga0207674_10058879
1207 Ga0207675_100015848
1208 Ga0207683_10081725
1209 Ga0207698_10187060
1210 Ga0207698_10604796
1211 Ga0207428_10388682
1212 Ga0268266_10063049
1213 Ga0268266_10245973
1214 Ga0268266_10827569
1215 Ga0268266_11129461
1216 Ga0265326_10014033
1217 Ga0265319_1002350
1218 Ga0265334_10001287
1219 Ga0265322_10119163
1220 Ga0265336_10031700
1221 Ga0265336_10074240
1222 Ga0265338_10001268
1223 Ga0265338_10008494
1224 Ga0265338_10441864
1225 Ga0265332_10000806
1226 Ga0265320_10092882
1227 Ga0265325_10023840
1228 Ga0265340_10012110
1229 Ga0265339_10107959
1230 Ga0265333_100268
1231 Ga0265316_10121623
1232 Ga0307513_10080990
1233 Ga0265314_10006319
1234 Ga0265342_10007542
1235 Ga0316214_1005909
1236 Ga0316214_1019900
1237 Ga0373930_0020965
1238 Ga0373950_0038877
1239 Ga0373959_0023760
1240 Ga0373938_0019607
1241 Ga0373938_0040393
1242 Ga0373926_0001134
1243 Ga0373926_0022191
1244 Ga0373926_0041652
1245 Ga0373926_0071754
1246 Ga0373926_0121345
1247 Ga0373926_0223889
1248 Ga0373928_0002714
1249 Ga0373929_0003272
1250 Ga0373934_0000108
1251 Ga0373934_0013193
1252 Ga0373934_0027248
1253 Ga0373934_0041723
1254 Ga0373940_0006912
1255 Ga0373940_0009897
1256 Ga0373944_0000289
1257 Ga0373949_0029974
1258 Ga0373949_0111868
1259 Ga0373952_0069798
1260 Ga0373923_0000440
1261 Ga0373923_0040322
1262 Ga0373923_0057383
1263 Ga0373923_0064270
1264 Ga0373932_0025734
1265 Ga0373932_0059220
1266 Ga0373936_0012254
1267 Ga0373936_0013551
1268 Ga0373939_0022213
1269 Ga0373941_0006307
1270 Ga0373941_0062504
1271 Ga0373945_0003403
1272 Ga0373945_0046394
1273 Ga0373945_0098883
1274 Ga0373953_0000094
1275 Ga0373953_0014394
1276 Ga0373954_0017488
1277 Ga0373954_0049604
1278 Ga0373954_0055917
1279 Ga0373954_0080796
1280 Ga0373954_0166850
1281 Ga0373956_0001194
1282 Ga0373956_0023529
1283 Ga0373956_0039119
1284 Ga0373956_0073006
1285 Ga0373957_0000166
1286 Ga0373957_0017140
1287 Ga0373957_0029204
1288 Ga0373957_0184407
1289 Ga0373957_0244383
1290 Ga0373960_0005964
1291 Ga0373960_0011035
1292 Ga0373943_0010430
1293 Ga0373943_0010566
1294 Ga0373943_0040749
1295 Ga0373943_0215177
1296 Ga0373943_0305977
1297 Ga0373946_0000253
1298 Ga0373946_0000665
1299 Ga0373955_0000112
1300 Ga0373955_0016168
1301 Ga0373955_0034753
1302 Ga0373955_0036781
1303 Ga0373955_0149199
1304 Ga0373942_0008613
1305 Ga0373942_0014666
1306 Ga0373924_0000211
1307 Ga0373924_0036499
1308 Ga0373924_0060595
1309 Ga0373924_0070876
1310 Ga0373924_0124105
1311 Ga0373931_0025020
1312 Ga0373931_0057950
1313 Ga0373935_0000970
1314 Ga0373935_0069952
1315 Ga0373935_0146207
1316 Ga0373935_0159764
1317 Ga0373935_0327343
1318 Ga0373935_0327790
1319 Ga0373927_0003427
1320 Ga0373927_0008071
1321 Ga0373927_0051612
1322 Ga0373927_0082711
1323 Ga0373927_0145110
1324 Ga0373927_0536300
1325 Ga0373933_0000022
1326 Ga0373933_0008118
1327 Ga0373933_0009952
1328 Ga0373933_0010723
1329 Ga0373933_0015930
1330 Ga0373933_0041424
1331 Ga0373933_0125134
1332 Ga0373933_0215671
1333 Ga0373947_0000006
1334 Ga0373947_0001275
1335 Ga0373947_0100360
1336 Ga0373947_0136977
1337 Ga0373947_0188985
1338 Ga0373937_0000022
1339 Ga0373937_0008926
1340 Ga0373937_0021822
1341 Ga0373937_0031743
1342 Ga0373937_0067715
1343 Ga0373937_0082709
1344 Ga0373937_0091797
1345 Ga0372808_001444
1346 Ga0373925_0026273
1347 Ga0373925_0035770
1348 Ga0373925_0082951
1349 Ga0373925_0100820
1350 Ga0373925_0388852
1351 Ga0373925_0940153
1352 Ga0395898_0082286
1353 Ga0436364_0037108
1354 Ga0436364_0261597
1355 Ga0436364_0287557
1356 Ga0436364_0939371
1357 Ga0436364_1104976
1358 Ga0436364_1228585
1359 Ga0436360_0208988
1360 Ga0436363_0334125
1361 Ga0436363_0902303
1362 Ga0436362_1163076
1363 Ga0466967_0386297
1364 Ga0495592_0000025
1365 Ga0495592_0021532
1366 Ga0495592_0041359
1367 Ga0495592_0085010
1368 Ga0495592_0314287
1369 Ga0495592_0547723
1370 Ga0495603_0005042
1371 Ga0495603_0127411
1372 Ga0495629_0002510
1373 Ga0495629_0128252
1374 Ga0495629_0144145
1375 Ga0495629_0335007
1376 Ga0495629_0475182
1377 Ga0495641_0023745
1378 Ga0495641_0025292
1379 Ga0495641_0033918
1380 Ga0495641_0060163
1381 Ga0495651_0000014
1382 Ga0495651_0007180
1383 Ga0495651_0021944
1384 Ga0495651_0028505
1385 Ga0495651_0042434
1386 Ga0495651_0048290
1387 Ga0495651_0088658
1388 Ga0495651_0143650
1389 Ga0495653_0014717
1390 Ga0495653_0016957
1391 Ga0495653_0026663
1392 Ga0495653_0043271
1393 Ga0495653_0044783
1394 Ga0495653_0045692
1395 Ga0495653_0046178
1396 Ga0495653_0063155
1397 Ga0495653_0078687
1398 Ga0495653_0119616
1399 Ga0495580_0172773
1400 Ga0495580_0338896
1401 Ga0495582_0018083
1402 Ga0495582_0045935
1403 Ga0495582_0112136
1404 Ga0495639_0003951
1405 Ga0495639_0378547
1406 Ga0495639_0464978
1407 Ga0495662_0000415
1408 Ga0495662_0020737
1409 Ga0495662_0048126
1410 Ga0495662_0073669
1411 Ga0495662_0075897
1412 Ga0495662_0154573
1413 Ga0495662_0166289
1414 Ga0495664_0008128
1415 Ga0495664_0029022
1416 Ga0495664_0120739
1417 Ga0495664_0125558
1418 Ga0495594_0047095
1419 Ga0495594_0124249
1420 Ga0495608_0000190
1421 Ga0495608_0028031
1422 Ga0495608_0028686
1423 Ga0495608_0033081
1424 Ga0495608_0070311
1425 Ga0495608_0129896
1426 Ga0495608_0140027
1427 Ga0495608_0208713
1428 Ga0495618_0023599
1429 Ga0495618_0033244
1430 Ga0495618_0255303
1431 Ga0495628_0000346
1432 Ga0495628_0096929
1433 Ga0495628_0100836
1434 Ga0495628_0137232
1435 Ga0495628_0190508
1436 Ga0495628_0304756
1437 Ga0495628_0340798
1438 Ga0495630_0079683
1439 Ga0495630_0142407
1440 Ga0495630_0153212
1441 Ga0495666_0036493
1442 Ga0495666_0401726
1443 Ga0495652_0009488
1444 Ga0495652_0010242
1445 Ga0495652_0030510
1446 Ga0495652_0038016
1447 Ga0495652_0079960
1448 Ga0495652_0091033
1449 Ga0495652_0130949
1450 Ga0495652_0266493
1451 Ga0495652_0467933
1452 Ga0495652_0621910
1453 Ga0495665_0000524
1454 Ga0495665_0014274
1455 Ga0495665_0015164
1456 Ga0495665_0109107
1457 Ga0495640_0002533
1458 Ga0495640_0030276
1459 Ga0495640_0040272
1460 Ga0495640_0046332
1461 Ga0495640_0048094
1462 Ga0495640_0095045
1463 Ga0495640_0237811
1464 Ga0495586_0006410
1465 Ga0495586_0097256
1466 Ga0495586_0466895
1467 Ga0495587_0000029
1468 Ga0495587_0006950
1469 Ga0495587_0012669
1470 Ga0495587_0081467
1471 Ga0495587_0111654
1472 Ga0495587_0128291
1473 Ga0495587_0269542
1474 Ga0495645_0022525
1475 Ga0495645_0033757
1476 Ga0495645_0113797
1477 Ga0495645_0128315
1478 Ga0495645_0181273
1479 Ga0495645_0300157
1480 Ga0495667_0000036
1481 Ga0495667_0000607
1482 Ga0495667_0001443
1483 Ga0495667_0011226
1484 Ga0495667_0127393
1485 Ga0495667_0308849
1486 Ga0495667_0315536
1487 Ga0495634_0030816
1488 Ga0495634_0044601
1489 Ga0495634_0069302
1490 Ga0495634_0079689
1491 Ga0495634_0084894
1492 Ga0495634_0098423
1493 Ga0495635_0000666
1494 Ga0495635_0004586
1495 Ga0495635_0008790
1496 Ga0495635_0017383
1497 Ga0495635_0038965
1498 Ga0495635_0110970
1499 Ga0495588_0058930
1500 Ga0495657_0000071
1501 Ga0495657_0004781
1502 Ga0495657_0008636
1503 Ga0495657_0038498
1504 Ga0495657_0044277
1505 Ga0495657_0052598
1506 Ga0495599_0000094
1507 Ga0495599_0010549
1508 Ga0495599_0025290
1509 Ga0495599_0045618
1510 Ga0495599_0075935
1511 Ga0495599_0088526
1512 Ga0495599_0373501
1513 Ga0495623_0000113
1514 Ga0495623_0067661
1515 Ga0495623_0073363
1516 Ga0495623_0126899
1517 Ga0495646_0008387
1518 Ga0495646_0031995
1519 Ga0495646_0079454
1520 Ga0495646_0169645
1521 Ga0495647_0019101
1522 Ga0495647_0032534
1523 Ga0495658_0003156
1524 Ga0495658_0246658
1525 Ga0495613_0155947
1526 Ga0495624_0003337
1527 Ga0495624_0026797
1528 Ga0495624_0051450
1529 Ga0495600_0056648
1530 Ga0495600_0074984
1531 Ga0495600_0430895
1532 Ga0495581_0000903
1533 Ga0495581_0187254
1534 Ga0495581_0282435
1535 Ga0495604_0000044
1536 Ga0495604_0023045
1537 Ga0495604_0115051
1538 Ga0495604_0145466
1539 Ga0495604_0253470
1540 Ga0495604_0300080
1541 Ga0495674_0000044
1542 Ga0495674_0020966
1543 Ga0495674_0057081
1544 Ga0495674_0059918
1545 Ga0495674_0145173
1546 Ga0495674_0171184
1547 Ga0495676_0008527
1548 Ga0495676_0058852
1549 Ga0495676_0158664
1550 Ga0495680_0000219
1551 Ga0495680_0008298
1552 Ga0495680_0009686
1553 Ga0495680_0017665
1554 Ga0495680_0018149
1555 Ga0495680_0043101
1556 Ga0495680_0048768
1557 Ga0495680_0192560
1558 Ga0495680_0349093
1559 Ga0495675_0002157
1560 Ga0495675_0004181
1561 Ga0495675_0023500
1562 Ga0495675_0056484
1563 Ga0495675_0098618
1564 Ga0495684_0000962
1565 Ga0495684_0019115
1566 Ga0495684_0023643
1567 Ga0495684_0045001
1568 Ga0495684_0047586
1569 Ga0495684_0058044
1570 Ga0495684_0064779
1571 Ga0495684_0367508
1572 Ga0495593_0013529
1573 Ga0495593_0063625
1574 Ga0495593_0123293
1575 Ga0495593_0484999
1576 Ga0495602_0000480
1577 Ga0495602_0011445
1578 Ga0495602_0051492
1579 Ga0495602_0081676
1580 Ga0495602_0130961
1581 Ga0495602_0144692
1582 Ga0495602_0314385
1583 Ga0495602_0436655
1584 Ga0495614_0005646
1585 Ga0496100_0069654
1586 Ga0496100_0380351
1587 Ga0496100_0642941
1588 Ga0496101_0081580
1589 Ga0496101_0139003
1590 Ga0496102_0026222
1591 Ga0496102_0082077
1592 Ga0496102_1043812
1593 Ga0496103_0112067
1594 Ga0496104_0000937
1595 Ga0496104_0008559
1596 Ga0496104_0226081
1597 Ga0496105_0004650
1598 Ga0496105_0039198
1599 Ga0496105_0039664
1600 Ga0496105_0141738
1601 Ga0496105_0532042
1602 Ga0496106_0084617
1603 Ga0496106_0460027
1604 Ga0496107_0243041
1605 Ga0496107_0550371
1606 Ga0496108_0013818
1607 Ga0496108_0018374
1608 Ga0496108_0329259
1609 Ga0496108_0334223
1610 Ga0496109_0282136
1611 Ga0496110_0008342
1612 Ga0496110_0020460
1613 Ga0496110_0175364
1614 Ga0496110_0402202
1615 Ga0496110_1027197
1616 Ga0496111_0050441
1617 Ga0496111_0089111
1618 Ga0496112_0000856
1619 Ga0496112_0321594
1620 Ga0496112_0379829
1621 Ga0496113_0002091
1622 Ga0496113_0060684
1623 Ga0496113_0237122
1624 Ga0496114_0115280
1625 Ga0496114_0116764
1626 Ga0496114_0426917
1627 Ga0496114_0734777
1628 Ga0496115_0010010
1629 Ga0496115_0103986
1630 Ga0496115_0208692
1631 Ga0496115_0454258
1632 Ga0496126_0073104
1633 Ga0496126_0119671
1634 Ga0496126_0385488
1635 nmdc:mga05p37_17739_c1
1636 nmdc:mga08y16_281472_c1
1637 nmdc:mga0n895_431931_c1
1638 nmdc:mga0rr50_412662_c1
1639 nmdc:mga0rr50_479843_c1
1640 nmdc:mga08x19_153879_c1
1641 nmdc:mga08x19_158074_c1
1642 nmdc:mga08x19_361036_c1
1643 nmdc:mga08x19_567600_c1
1644 nmdc:mga08x19_932844_c1
1645 nmdc:mga0a205_268338_c1
1646 nmdc:mga0a205_328002_c1
1647 Ga0495601_0093640
1648 Ga0495601_0301055
1649 Ga0495601_0416969
1650 Ga0495601_0463444
1651 Ga0495612_0023842
1652 Ga0495612_0047110
1653 Ga0495612_0056807
1654 Ga0495595_0002659
1655 Ga0495595_0019682
1656 Ga0495595_0024477
1657 Ga0495619_0018796
1658 Ga0495619_0131015
1659 Ga0495619_0196856
1660 Ga0495619_0216579

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rds-assembly1.cif.gz_A structure of human nthl1 0.7904 21 132
7rdt-assembly1.cif.gz_A structure of human nthl1 - linker 1 chimera 0.7727 21 134
4ypr-assembly1.cif.gz_A crystal structure of d144n muty bound to its anti-substrate 0.7671 19 137
1ngn-assembly1.cif.gz_A mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4 0.7602 15 133
8dwf-assembly1.cif.gz_A glycosylase muty variant e43s in complex with dna containing d(8-oxo-g) paired with substrate adenine 0.7576 19 137
ID Description Score Start End Superfamily
af_I1JZX0_85_197_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8392 22 132 1.10.340.30
af_Q58829_25_138_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8089 21 132 1.10.340.30
af_K7MWZ4_17_115_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8021 22 111 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7907 21 132 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.7905 20 144 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7K2FY59-F1-model_v4 Fe-S cluster assembly protein HesB 0.9949 4 190 GO:0003824
GO:0006281
AF-A0A6B3CYA7-F1-model_v4 Fe-S cluster assembly protein HesB 0.9948 5 88 GO:0003824
GO:0006281
AF-A0A397QJ74-F1-model_v4 deleted 0.9946 4 171
AF-A0A4V6AXU0-F1-model_v4 Fe-S cluster assembly protein HesB 0.9933 4 190 GO:0003824
GO:0006284
AF-A0A1H4VCL2-F1-model_v4 Uncharacterized HhH-GPD family protein 0.9928 4 190 GO:0003824
GO:0006284

Map