F482640
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 830 | 296 | 1660 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100200006|Ga0070706_1002000062 |
| Length | 221 |
| Sequence | MPGYPHLVPVLAATLEPPAPQLPAPYCDDGPMTLSLPIEDGANELLSRSPLALLTGMLLDQQVPLEKAFSSPYELALRLGHEPTAAELADYNPEALAAVFSERPALHRFPKAMAARVQELTRVIAERYDGDAARVWTTAATGAELAGRLAELPGFGTYKAQIMTALLGKQLGVRPDGWREAAGRFGEEGSRWSVADITDAASLAAVREHKKQVKAAAKAQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031273 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.66 |
| Rhizosphere | 92.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100200006 | 3300005467 | Bacteria | 1867 |
| 2 | JGI25406J46586_10026636 | 3300003203 | Bacteria | 2226 |
| 3 | JGI25406J46586_10051432 | 3300003203 | Bacteria | 1378 |
| 4 | Ga0070658_10115677 | 3300005327 | Bacteria | 2225 |
| 5 | Ga0070676_10132357 | 3300005328 | Bacteria | 1578 |
| 6 | Ga0070683_100046191 | 3300005329 | Bacteria | 4022 |
| 7 | Ga0070683_100051955 | 3300005329 | Bacteria | 3796 |
| 8 | Ga0070683_100090481 | 3300005329 | Bacteria | 2873 |
| 9 | Ga0070683_100292721 | 3300005329 | Bacteria | 1548 |
| 10 | Ga0070683_100745345 | 3300005329 | Bacteria | 938 |
| 11 | Ga0070690_100063725 | 3300005330 | Bacteria | 2379 |
| 12 | Ga0070690_100445728 | 3300005330 | Bacteria | 959 |
| 13 | Ga0068869_100241097 | 3300005334 | Bacteria | 1440 |
| 14 | Ga0070680_100046060 | 3300005336 | Bacteria | 3547 |
| 15 | Ga0070680_100933244 | 3300005336 | Bacteria | 749 |
| 16 | Ga0070682_100037102 | 3300005337 | Bacteria | 2982 |
| 17 | Ga0070682_100097853 | 3300005337 | Bacteria | 1932 |
| 18 | Ga0070682_100553687 | 3300005337 | Bacteria | 900 |
| 19 | Ga0068868_100235676 | 3300005338 | Bacteria | 1536 |
| 20 | Ga0070660_100029919 | 3300005339 | Bacteria | 4083 |
| 21 | Ga0070660_100109202 | 3300005339 | Bacteria | 2199 |
| 22 | Ga0070660_100274378 | 3300005339 | Bacteria | 1379 |
| 23 | Ga0070689_100061655 | 3300005340 | Bacteria | 2917 |
| 24 | Ga0070691_10012298 | 3300005341 | Bacteria | 3918 |
| 25 | Ga0070691_10093505 | 3300005341 | Bacteria | 1485 |
| 26 | Ga0070687_100026444 | 3300005343 | Bacteria | 2794 |
| 27 | Ga0070661_100031694 | 3300005344 | Bacteria | 3823 |
| 28 | Ga0070661_100084305 | 3300005344 | Bacteria | 2348 |
| 29 | Ga0070661_100235328 | 3300005344 | Bacteria | 1409 |
| 30 | Ga0070692_10099929 | 3300005345 | Bacteria | 1589 |
| 31 | Ga0070669_100215396 | 3300005353 | Bacteria | 1517 |
| 32 | Ga0070675_100071388 | 3300005354 | Bacteria | 2880 |
| 33 | Ga0070671_100136085 | 3300005355 | Bacteria | 2071 |
| 34 | Ga0070671_100160710 | 3300005355 | Bacteria | 1899 |
| 35 | Ga0070673_100077674 | 3300005364 | Bacteria | 2683 |
| 36 | Ga0070667_100120941 | 3300005367 | Bacteria | 2277 |
| 37 | Ga0070703_10023877 | 3300005406 | Bacteria | 1803 |
| 38 | Ga0070709_10000165 | 3300005434 | Bacteria | 41860 |
| 39 | Ga0070709_10072380 | 3300005434 | Bacteria | 2228 |
| 40 | Ga0070709_10198176 | 3300005434 | Bacteria | 1420 |
| 41 | Ga0070709_10381062 | 3300005434 | Bacteria | 1048 |
| 42 | Ga0070714_100000318 | 3300005435 | Bacteria | 36459 |
| 43 | Ga0070714_100000689 | 3300005435 | Bacteria | 23869 |
| 44 | Ga0070714_100107703 | 3300005435 | Bacteria | 2463 |
| 45 | Ga0070714_100130892 | 3300005435 | Bacteria | 2242 |
| 46 | Ga0070714_100314723 | 3300005435 | Bacteria | 1462 |
| 47 | Ga0070714_100323225 | 3300005435 | Bacteria | 1443 |
| 48 | Ga0070714_100327661 | 3300005435 | Bacteria | 1433 |
| 49 | Ga0070714_100434270 | 3300005435 | Bacteria | 1245 |
| 50 | Ga0070714_100451261 | 3300005435 | Bacteria | 1221 |
| 51 | Ga0070713_100002403 | 3300005436 | Bacteria | 12211 |
| 52 | Ga0070713_100077760 | 3300005436 | Bacteria | 2822 |
| 53 | Ga0070713_100085400 | 3300005436 | Bacteria | 2703 |
| 54 | Ga0070713_100110827 | 3300005436 | Bacteria | 2392 |
| 55 | Ga0070713_100209379 | 3300005436 | Bacteria | 1764 |
| 56 | Ga0070713_100295037 | 3300005436 | Bacteria | 1491 |
| 57 | Ga0070710_10004650 | 3300005437 | Bacteria | 6492 |
| 58 | Ga0070710_10111283 | 3300005437 | Bacteria | 1645 |
| 59 | Ga0070701_10054289 | 3300005438 | Bacteria | 2089 |
| 60 | Ga0070711_100000158 | 3300005439 | Bacteria | 36681 |
| 61 | Ga0070711_100061073 | 3300005439 | Bacteria | 2622 |
| 62 | Ga0070711_100185136 | 3300005439 | Bacteria | 1596 |
| 63 | Ga0070705_100039731 | 3300005440 | Bacteria | 2671 |
| 64 | Ga0070700_100046386 | 3300005441 | Bacteria | 2684 |
| 65 | Ga0070694_100451049 | 3300005444 | Bacteria | 1015 |
| 66 | Ga0070708_100027451 | 3300005445 | Bacteria | 4885 |
| 67 | Ga0070708_100046036 | 3300005445 | Bacteria | 3847 |
| 68 | Ga0070708_100069236 | 3300005445 | Bacteria | 3173 |
| 69 | Ga0070708_100174273 | 3300005445 | Bacteria | 2009 |
| 70 | Ga0070708_100286122 | 3300005445 | Bacteria | 1551 |
| 71 | Ga0070663_100176013 | 3300005455 | Bacteria | 1657 |
| 72 | Ga0070678_100071149 | 3300005456 | Bacteria | 2603 |
| 73 | Ga0070662_100200609 | 3300005457 | Bacteria | 1583 |
| 74 | Ga0070681_10072320 | 3300005458 | Bacteria | 3411 |
| 75 | Ga0070681_10142805 | 3300005458 | Bacteria | 2323 |
| 76 | Ga0070685_10425788 | 3300005466 | Bacteria | 925 |
| 77 | Ga0070706_100007197 | 3300005467 | Bacteria | 10459 |
| 78 | Ga0070706_100025430 | 3300005467 | Bacteria | 5449 |
| 79 | Ga0070706_100025704 | 3300005467 | Bacteria | 5419 |
| 80 | Ga0070706_100061551 | 3300005467 | Bacteria | 3466 |
| 81 | Ga0070706_100309083 | 3300005467 | Bacteria | 1475 |
| 82 | Ga0070707_100002252 | 3300005468 | Bacteria | 18404 |
| 83 | Ga0070707_100013838 | 3300005468 | Bacteria | 7555 |
| 84 | Ga0070707_100025462 | 3300005468 | Bacteria | 5613 |
| 85 | Ga0070707_100118089 | 3300005468 | Bacteria | 2574 |
| 86 | Ga0070707_100356140 | 3300005468 | Bacteria | 1421 |
| 87 | Ga0070707_100377365 | 3300005468 | Bacteria | 1377 |
| 88 | Ga0070698_100000028 | 3300005471 | Bacteria | 98040 |
| 89 | Ga0070698_100017873 | 3300005471 | Bacteria | 7470 |
| 90 | Ga0070698_100036945 | 3300005471 | Bacteria | 5040 |
| 91 | Ga0070698_100116624 | 3300005471 | Bacteria | 2633 |
| 92 | Ga0070698_100419988 | 3300005471 | Bacteria | 1272 |
| 93 | Ga0070699_100314352 | 3300005518 | Bacteria | 1407 |
| 94 | Ga0070679_100029643 | 3300005530 | Bacteria | 5398 |
| 95 | Ga0070679_100091308 | 3300005530 | Bacteria | 3033 |
| 96 | Ga0070679_100212928 | 3300005530 | Bacteria | 1896 |
| 97 | Ga0070679_100225635 | 3300005530 | Bacteria | 1834 |
| 98 | Ga0070679_100251424 | 3300005530 | Bacteria | 1724 |
| 99 | Ga0070679_100976554 | 3300005530 | Bacteria | 791 |
| 100 | Ga0070684_100056907 | 3300005535 | Bacteria | 3413 |
| 101 | Ga0070684_100061371 | 3300005535 | Bacteria | 3290 |
| 102 | Ga0070684_100420442 | 3300005535 | Bacteria | 1234 |
| 103 | Ga0070697_100128279 | 3300005536 | Bacteria | 2125 |
| 104 | Ga0068853_100245316 | 3300005539 | Bacteria | 1642 |
| 105 | Ga0070672_100080750 | 3300005543 | Bacteria | 2606 |
| 106 | Ga0070686_100214169 | 3300005544 | Bacteria | 1389 |
| 107 | Ga0070695_100685073 | 3300005545 | Bacteria | 812 |
| 108 | Ga0070693_100029706 | 3300005547 | Bacteria | 2983 |
| 109 | Ga0070693_100191468 | 3300005547 | Bacteria | 1323 |
| 110 | Ga0070665_100094927 | 3300005548 | Bacteria | 2987 |
| 111 | Ga0070665_100395622 | 3300005548 | Bacteria | 1389 |
| 112 | Ga0070704_100533625 | 3300005549 | Bacteria | 1023 |
| 113 | Ga0068855_100287901 | 3300005563 | Bacteria | 1822 |
| 114 | Ga0068855_100296141 | 3300005563 | Bacteria | 1793 |
| 115 | Ga0068855_100584951 | 3300005563 | Bacteria | 1205 |
| 116 | Ga0070664_100049942 | 3300005564 | Bacteria | 3538 |
| 117 | Ga0068857_100076359 | 3300005577 | Bacteria | 2988 |
| 118 | Ga0068854_100058858 | 3300005578 | Bacteria | 2775 |
| 119 | Ga0068856_100039845 | 3300005614 | Bacteria | 4613 |
| 120 | Ga0068856_100125024 | 3300005614 | Bacteria | 2575 |
| 121 | Ga0068856_100202278 | 3300005614 | Bacteria | 2001 |
| 122 | Ga0068856_100377649 | 3300005614 | Bacteria | 1436 |
| 123 | Ga0068856_100714355 | 3300005614 | Bacteria | 1022 |
| 124 | Ga0070702_100031011 | 3300005615 | Bacteria | 2921 |
| 125 | Ga0070702_100058569 | 3300005615 | Bacteria | 2232 |
| 126 | Ga0068852_100219060 | 3300005616 | Bacteria | 1809 |
| 127 | Ga0068859_100030304 | 3300005617 | Bacteria | 5428 |
| 128 | Ga0068864_100054407 | 3300005618 | Bacteria | 3454 |
| 129 | Ga0068864_100216635 | 3300005618 | Bacteria | 1765 |
| 130 | Ga0068866_10317658 | 3300005718 | Bacteria | 978 |
| 131 | Ga0068870_10241281 | 3300005840 | Bacteria | 1116 |
| 132 | Ga0068863_100143487 | 3300005841 | Bacteria | 2283 |
| 133 | Ga0068863_100250153 | 3300005841 | Bacteria | 1712 |
| 134 | Ga0068858_100038629 | 3300005842 | Bacteria | 4429 |
| 135 | Ga0068858_100120587 | 3300005842 | Bacteria | 2452 |
| 136 | Ga0068860_100101942 | 3300005843 | Bacteria | 2738 |
| 137 | Ga0068862_101008367 | 3300005844 | Bacteria | 824 |
| 138 | Ga0068862_101610697 | 3300005844 | Bacteria | 656 |
| 139 | Ga0081455_10290191 | 3300005937 | Bacteria | 1178 |
| 140 | Ga0081540_1000960 | 3300005983 | Bacteria | 26024 |
| 141 | Ga0081539_10000168 | 3300005985 | Bacteria | 153724 |
| 142 | Ga0081539_10001596 | 3300005985 | Bacteria | 37369 |
| 143 | Ga0070717_10000613 | 3300006028 | Bacteria | 22913 |
| 144 | Ga0070717_10003861 | 3300006028 | Bacteria | 10776 |
| 145 | Ga0070717_10089543 | 3300006028 | Bacteria | 2595 |
| 146 | Ga0070717_10184170 | 3300006028 | Bacteria | 1821 |
| 147 | Ga0070717_10255600 | 3300006028 | Bacteria | 1549 |
| 148 | Ga0070717_10268244 | 3300006028 | Bacteria | 1511 |
| 149 | Ga0070717_10529486 | 3300006028 | Bacteria | 1066 |
| 150 | Ga0070717_11387624 | 3300006028 | Bacteria | 638 |
| 151 | Ga0070715_10003238 | 3300006163 | Bacteria | 5132 |
| 152 | Ga0070715_10011325 | 3300006163 | Bacteria | 3210 |
| 153 | Ga0070715_10017515 | 3300006163 | Bacteria | 2713 |
| 154 | Ga0070715_10070031 | 3300006163 | Bacteria | 1564 |
| 155 | Ga0070715_10091086 | 3300006163 | Bacteria | 1403 |
| 156 | Ga0070716_100003016 | 3300006173 | Bacteria | 7853 |
| 157 | Ga0070716_100006566 | 3300006173 | Bacteria | 5687 |
| 158 | Ga0070716_100022526 | 3300006173 | Bacteria | 3330 |
| 159 | Ga0070716_100046508 | 3300006173 | Bacteria | 2442 |
| 160 | Ga0070716_100049433 | 3300006173 | Bacteria | 2382 |
| 161 | Ga0070716_100107921 | 3300006173 | Bacteria | 1719 |
| 162 | Ga0070716_100142998 | 3300006173 | Bacteria | 1528 |
| 163 | Ga0070716_100161225 | 3300006173 | Bacteria | 1453 |
| 164 | Ga0070716_100180091 | 3300006173 | Bacteria | 1387 |
| 165 | Ga0070712_100001425 | 3300006175 | Bacteria | 14566 |
| 166 | Ga0070712_100006067 | 3300006175 | Bacteria | 7481 |
| 167 | Ga0070712_100068139 | 3300006175 | Bacteria | 2534 |
| 168 | Ga0070712_100275053 | 3300006175 | Bacteria | 1354 |
| 169 | Ga0070712_100474080 | 3300006175 | Bacteria | 1045 |
| 170 | Ga0097621_100154910 | 3300006237 | Bacteria | 1966 |
| 171 | Ga0068871_100078711 | 3300006358 | Bacteria | 2726 |
| 172 | Ga0075433_10226640 | 3300006852 | Bacteria | 1660 |
| 173 | Ga0075433_10821483 | 3300006852 | Bacteria | 812 |
| 174 | Ga0075434_100174437 | 3300006871 | Bacteria | 2170 |
| 175 | Ga0075434_100722038 | 3300006871 | Bacteria | 1013 |
| 176 | Ga0075434_101054610 | 3300006871 | Bacteria | 826 |
| 177 | Ga0068865_100484309 | 3300006881 | Bacteria | 1029 |
| 178 | Ga0075436_100024664 | 3300006914 | Bacteria | 4135 |
| 179 | Ga0075436_100287363 | 3300006914 | Bacteria | 1177 |
| 180 | Ga0075436_100618483 | 3300006914 | Bacteria | 799 |
| 181 | Ga0097620_100030304 | 3300006931 | Bacteria | 5428 |
| 182 | Ga0075435_100463516 | 3300007076 | Bacteria | 1093 |
| 183 | Ga0075435_100504994 | 3300007076 | Bacteria | 1045 |
| 184 | Ga0099795_10055513 | 3300007788 | Bacteria | 1455 |
| 185 | Ga0105251_10059567 | 3300009011 | Bacteria | 1800 |
| 186 | Ga0105240_10107430 | 3300009093 | Bacteria | 3383 |
| 187 | Ga0105240_10342987 | 3300009093 | Bacteria | 1696 |
| 188 | Ga0111539_10760425 | 3300009094 | Bacteria | 1128 |
| 189 | Ga0105245_10014529 | 3300009098 | Bacteria | 6856 |
| 190 | Ga0105245_11087380 | 3300009098 | Bacteria | 846 |
| 191 | Ga0105247_10022237 | 3300009101 | Bacteria | 3818 |
| 192 | Ga0105247_10654236 | 3300009101 | Bacteria | 785 |
| 193 | Ga0114129_10274852 | 3300009147 | Bacteria | 2253 |
| 194 | Ga0105243_10032414 | 3300009148 | Bacteria | 4037 |
| 195 | Ga0105241_10051803 | 3300009174 | Bacteria | 3132 |
| 196 | Ga0105241_10191984 | 3300009174 | Bacteria | 1701 |
| 197 | Ga0105241_10275241 | 3300009174 | Bacteria | 1436 |
| 198 | Ga0105242_10628235 | 3300009176 | Bacteria | 1041 |
| 199 | Ga0105248_10504725 | 3300009177 | Bacteria | 1364 |
| 200 | Ga0105248_10742750 | 3300009177 | Bacteria | 1107 |
| 201 | Ga0105237_10895640 | 3300009545 | Bacteria | 894 |
| 202 | Ga0105238_10332936 | 3300009551 | Bacteria | 1505 |
| 203 | Ga0105249_10077682 | 3300009553 | Bacteria | 3079 |
| 204 | Ga0105249_11234610 | 3300009553 | Bacteria | 819 |
| 205 | Ga0105239_10079492 | 3300010375 | Bacteria | 3609 |
| 206 | Ga0105239_10335671 | 3300010375 | Bacteria | 1705 |
| 207 | Ga0157341_1000456 | 3300012494 | Bacteria | 2067 |
| 208 | Ga0157373_10108168 | 3300013100 | Bacteria | 1955 |
| 209 | Ga0157371_10026824 | 3300013102 | Bacteria | 4184 |
| 210 | Ga0157369_10011297 | 3300013105 | Bacteria | 10144 |
| 211 | Ga0157369_10215324 | 3300013105 | Bacteria | 2012 |
| 212 | Ga0157369_10577647 | 3300013105 | Bacteria | 1161 |
| 213 | Ga0157369_10845954 | 3300013105 | Bacteria | 939 |
| 214 | Ga0157374_10021503 | 3300013296 | Bacteria | 5742 |
| 215 | Ga0157378_10155054 | 3300013297 | Bacteria | 2137 |
| 216 | Ga0163162_10464161 | 3300013306 | Bacteria | 1398 |
| 217 | Ga0163162_10572436 | 3300013306 | Bacteria | 1257 |
| 218 | Ga0157375_10067111 | 3300013308 | Bacteria | 3584 |
| 219 | Ga0157375_10414829 | 3300013308 | Bacteria | 1513 |
| 220 | Ga0157375_10601299 | 3300013308 | Bacteria | 1259 |
| 221 | Ga0163163_10080540 | 3300014325 | Bacteria | 3256 |
| 222 | Ga0163163_10659864 | 3300014325 | Bacteria | 1109 |
| 223 | Ga0157377_10030606 | 3300014745 | Bacteria | 2917 |
| 224 | Ga0157376_10070067 | 3300014969 | Bacteria | 2975 |
| 225 | Ga0163161_10293298 | 3300017792 | Bacteria | 1279 |
| 226 | Ga0206352_10580932 | 3300020078 | Bacteria | 679 |
| 227 | Ga0206354_10169703 | 3300020081 | Bacteria | 1439 |
| 228 | Ga0206354_10517769 | 3300020081 | Bacteria | 2849 |
| 229 | Ga0206353_10010843 | 3300020082 | Bacteria | 1842 |
| 230 | Ga0206353_10373402 | 3300020082 | Bacteria | 1103 |
| 231 | Ga0206353_11075300 | 3300020082 | Bacteria | 1649 |
| 232 | Ga0213875_10003914 | 3300021388 | Bacteria | 8327 |
| 233 | Ga0213875_10027609 | 3300021388 | Bacteria | 2701 |
| 234 | Ga0224712_10043787 | 3300022467 | Bacteria | 1704 |
| 235 | Ga0224572_1000411 | 3300024225 | Bacteria | 4890 |
| 236 | Ga0207653_10011575 | 3300025885 | Bacteria | 2752 |
| 237 | Ga0207692_10000088 | 3300025898 | Bacteria | 26975 |
| 238 | Ga0207692_10028561 | 3300025898 | Bacteria | 2640 |
| 239 | Ga0207692_10050147 | 3300025898 | Bacteria | 2109 |
| 240 | Ga0207692_10052988 | 3300025898 | Bacteria | 2064 |
| 241 | Ga0207692_10396893 | 3300025898 | Bacteria | 859 |
| 242 | Ga0207642_10182244 | 3300025899 | Bacteria | 1145 |
| 243 | Ga0207710_10083427 | 3300025900 | Bacteria | 1486 |
| 244 | Ga0207680_10439570 | 3300025903 | Bacteria | 925 |
| 245 | Ga0207647_10081670 | 3300025904 | Bacteria | 1937 |
| 246 | Ga0207685_10005526 | 3300025905 | Bacteria | 3346 |
| 247 | Ga0207685_10018343 | 3300025905 | Bacteria | 2283 |
| 248 | Ga0207699_10000608 | 3300025906 | Bacteria | 17514 |
| 249 | Ga0207699_10001012 | 3300025906 | Bacteria | 13309 |
| 250 | Ga0207699_10004119 | 3300025906 | Bacteria | 6967 |
| 251 | Ga0207699_10008170 | 3300025906 | Bacteria | 5151 |
| 252 | Ga0207699_10014333 | 3300025906 | Bacteria | 4083 |
| 253 | Ga0207699_10030959 | 3300025906 | Bacteria | 3000 |
| 254 | Ga0207699_10099645 | 3300025906 | Bacteria | 1841 |
| 255 | Ga0207699_10353773 | 3300025906 | Bacteria | 1037 |
| 256 | Ga0207699_10608150 | 3300025906 | Bacteria | 796 |
| 257 | Ga0207643_10039030 | 3300025908 | Bacteria | 2670 |
| 258 | Ga0207705_10103263 | 3300025909 | Bacteria | 2099 |
| 259 | Ga0207705_10167226 | 3300025909 | Bacteria | 1654 |
| 260 | Ga0207705_10348128 | 3300025909 | Bacteria | 1141 |
| 261 | Ga0207684_10000479 | 3300025910 | Bacteria | 51757 |
| 262 | Ga0207684_10031124 | 3300025910 | Bacteria | 4541 |
| 263 | Ga0207684_10038125 | 3300025910 | Bacteria | 4079 |
| 264 | Ga0207684_10097069 | 3300025910 | Bacteria | 2515 |
| 265 | Ga0207684_10267871 | 3300025910 | Bacteria | 1474 |
| 266 | Ga0207684_10863774 | 3300025910 | Bacteria | 762 |
| 267 | Ga0207654_10024927 | 3300025911 | Bacteria | 3221 |
| 268 | Ga0207707_10070181 | 3300025912 | Bacteria | 3053 |
| 269 | Ga0207695_10119018 | 3300025913 | Bacteria | 2612 |
| 270 | Ga0207693_10000436 | 3300025915 | Bacteria | 38097 |
| 271 | Ga0207693_10013696 | 3300025915 | Bacteria | 6533 |
| 272 | Ga0207693_10028840 | 3300025915 | Bacteria | 4386 |
| 273 | Ga0207693_10187025 | 3300025915 | Bacteria | 1630 |
| 274 | Ga0207693_10252786 | 3300025915 | Bacteria | 1383 |
| 275 | Ga0207693_10320784 | 3300025915 | Bacteria | 1213 |
| 276 | Ga0207663_10000615 | 3300025916 | Bacteria | 15819 |
| 277 | Ga0207663_10007709 | 3300025916 | Bacteria | 5601 |
| 278 | Ga0207663_10015272 | 3300025916 | Bacteria | 4233 |
| 279 | Ga0207663_10045564 | 3300025916 | Bacteria | 2698 |
| 280 | Ga0207663_10088485 | 3300025916 | Bacteria | 2048 |
| 281 | Ga0207663_10096041 | 3300025916 | Bacteria | 1979 |
| 282 | Ga0207663_10252762 | 3300025916 | Bacteria | 1298 |
| 283 | Ga0207663_10259204 | 3300025916 | Bacteria | 1283 |
| 284 | Ga0207660_10127040 | 3300025917 | Bacteria | 1937 |
| 285 | Ga0207657_10009348 | 3300025919 | Bacteria | 9867 |
| 286 | Ga0207657_10092759 | 3300025919 | Bacteria | 2516 |
| 287 | Ga0207657_10127284 | 3300025919 | Bacteria | 2091 |
| 288 | Ga0207649_10065416 | 3300025920 | Bacteria | 2301 |
| 289 | Ga0207649_10549674 | 3300025920 | Bacteria | 883 |
| 290 | Ga0207652_10051551 | 3300025921 | Bacteria | 3528 |
| 291 | Ga0207652_10121271 | 3300025921 | Bacteria | 2326 |
| 292 | Ga0207652_10606183 | 3300025921 | Bacteria | 982 |
| 293 | Ga0207646_10001795 | 3300025922 | Bacteria | 25949 |
| 294 | Ga0207646_10037708 | 3300025922 | Bacteria | 4357 |
| 295 | Ga0207646_10086289 | 3300025922 | Bacteria | 2808 |
| 296 | Ga0207646_10152844 | 3300025922 | Bacteria | 2081 |
| 297 | Ga0207646_10297110 | 3300025922 | Bacteria | 1459 |
| 298 | Ga0207694_10135476 | 3300025924 | Bacteria | 1977 |
| 299 | Ga0207694_10252978 | 3300025924 | Bacteria | 1442 |
| 300 | Ga0207694_10399319 | 3300025924 | Bacteria | 1143 |
| 301 | Ga0207659_10235298 | 3300025926 | Bacteria | 1479 |
| 302 | Ga0207687_10122369 | 3300025927 | Bacteria | 1948 |
| 303 | Ga0207700_10000029 | 3300025928 | Bacteria | 132615 |
| 304 | Ga0207700_10005448 | 3300025928 | Bacteria | 7620 |
| 305 | Ga0207700_10026096 | 3300025928 | Bacteria | 4069 |
| 306 | Ga0207700_10043955 | 3300025928 | Bacteria | 3285 |
| 307 | Ga0207700_10050230 | 3300025928 | Bacteria | 3107 |
| 308 | Ga0207700_10053591 | 3300025928 | Bacteria | 3023 |
| 309 | Ga0207700_10071911 | 3300025928 | Bacteria | 2665 |
| 310 | Ga0207700_10292942 | 3300025928 | Bacteria | 1403 |
| 311 | Ga0207700_10392408 | 3300025928 | Bacteria | 1215 |
| 312 | Ga0207700_10976358 | 3300025928 | Bacteria | 758 |
| 313 | Ga0207700_11206666 | 3300025928 | Bacteria | 675 |
| 314 | Ga0207664_10000110 | 3300025929 | Bacteria | 72637 |
| 315 | Ga0207664_10003503 | 3300025929 | Bacteria | 10479 |
| 316 | Ga0207664_10017314 | 3300025929 | Bacteria | 5280 |
| 317 | Ga0207664_10022560 | 3300025929 | Bacteria | 4703 |
| 318 | Ga0207664_10041698 | 3300025929 | Bacteria | 3577 |
| 319 | Ga0207664_10047498 | 3300025929 | Bacteria | 3373 |
| 320 | Ga0207664_10079094 | 3300025929 | Bacteria | 2668 |
| 321 | Ga0207664_10096587 | 3300025929 | Bacteria | 2432 |
| 322 | Ga0207664_10109795 | 3300025929 | Bacteria | 2292 |
| 323 | Ga0207664_10114508 | 3300025929 | Bacteria | 2247 |
| 324 | Ga0207664_10120446 | 3300025929 | Bacteria | 2195 |
| 325 | Ga0207664_10149922 | 3300025929 | Bacteria | 1980 |
| 326 | Ga0207664_10256952 | 3300025929 | Bacteria | 1527 |
| 327 | Ga0207664_10258149 | 3300025929 | Bacteria | 1523 |
| 328 | Ga0207664_10303265 | 3300025929 | Bacteria | 1406 |
| 329 | Ga0207664_11066056 | 3300025929 | Bacteria | 723 |
| 330 | Ga0207644_10169885 | 3300025931 | Bacteria | 1701 |
| 331 | Ga0207644_10496594 | 3300025931 | Bacteria | 1006 |
| 332 | Ga0207706_10021844 | 3300025933 | Bacteria | 5744 |
| 333 | Ga0207709_10167029 | 3300025935 | Bacteria | 1541 |
| 334 | Ga0207665_10000144 | 3300025939 | Bacteria | 48077 |
| 335 | Ga0207665_10001603 | 3300025939 | Bacteria | 15248 |
| 336 | Ga0207665_10015291 | 3300025939 | Bacteria | 5039 |
| 337 | Ga0207665_10019951 | 3300025939 | Bacteria | 4405 |
| 338 | Ga0207665_10102307 | 3300025939 | Bacteria | 2002 |
| 339 | Ga0207665_10242410 | 3300025939 | Bacteria | 1329 |
| 340 | Ga0207665_10262766 | 3300025939 | Bacteria | 1279 |
| 341 | Ga0207691_10153945 | 3300025940 | Bacteria | 2020 |
| 342 | Ga0207689_10008458 | 3300025942 | Bacteria | 8963 |
| 343 | Ga0207661_10000534 | 3300025944 | Bacteria | 24348 |
| 344 | Ga0207661_10064694 | 3300025944 | Bacteria | 2965 |
| 345 | Ga0207661_10279849 | 3300025944 | Bacteria | 1491 |
| 346 | Ga0207661_10530458 | 3300025944 | Bacteria | 1077 |
| 347 | Ga0207661_10557639 | 3300025944 | Bacteria | 1050 |
| 348 | Ga0207679_10216486 | 3300025945 | Bacteria | 1609 |
| 349 | Ga0207679_10237324 | 3300025945 | Bacteria | 1543 |
| 350 | Ga0207667_10212261 | 3300025949 | Bacteria | 1984 |
| 351 | Ga0207667_10287954 | 3300025949 | Bacteria | 1678 |
| 352 | Ga0207651_10841634 | 3300025960 | Bacteria | 815 |
| 353 | Ga0207640_10105079 | 3300025981 | Bacteria | 1989 |
| 354 | Ga0207677_10067136 | 3300026023 | Bacteria | 2511 |
| 355 | Ga0207677_10263742 | 3300026023 | Bacteria | 1405 |
| 356 | Ga0207703_10362348 | 3300026035 | Bacteria | 1337 |
| 357 | Ga0207703_10435679 | 3300026035 | Bacteria | 1222 |
| 358 | Ga0207703_10879454 | 3300026035 | Bacteria | 857 |
| 359 | Ga0207639_10081154 | 3300026041 | Bacteria | 2568 |
| 360 | Ga0207678_10013141 | 3300026067 | Bacteria | 7264 |
| 361 | Ga0207678_10023957 | 3300026067 | Bacteria | 5337 |
| 362 | Ga0207708_10029675 | 3300026075 | Bacteria | 4145 |
| 363 | Ga0207702_10131178 | 3300026078 | Bacteria | 2255 |
| 364 | Ga0207702_10133041 | 3300026078 | Bacteria | 2240 |
| 365 | Ga0207702_10147687 | 3300026078 | Bacteria | 2135 |
| 366 | Ga0207702_10169821 | 3300026078 | Bacteria | 1999 |
| 367 | Ga0207702_10283456 | 3300026078 | Bacteria | 1567 |
| 368 | Ga0207641_10128559 | 3300026088 | Bacteria | 2271 |
| 369 | Ga0207641_10169932 | 3300026088 | Bacteria | 1989 |
| 370 | Ga0207641_10763465 | 3300026088 | Bacteria | 955 |
| 371 | Ga0207676_10075198 | 3300026095 | Bacteria | 2724 |
| 372 | Ga0207676_10095761 | 3300026095 | Bacteria | 2448 |
| 373 | Ga0207674_10044680 | 3300026116 | Bacteria | 4562 |
| 374 | Ga0207674_10053348 | 3300026116 | Bacteria | 4122 |
| 375 | Ga0207674_10058820 | 3300026116 | Bacteria | 3892 |
| 376 | Ga0207674_10058879 | 3300026116 | Bacteria | 3889 |
| 377 | Ga0207675_100015848 | 3300026118 | Bacteria | 7029 |
| 378 | Ga0207683_10081725 | 3300026121 | Bacteria | 2868 |
| 379 | Ga0207698_10187060 | 3300026142 | Bacteria | 1840 |
| 380 | Ga0207698_10604796 | 3300026142 | Bacteria | 1081 |
| 381 | Ga0207428_10388682 | 3300027907 | Bacteria | 1023 |
| 382 | Ga0268266_10063049 | 3300028379 | Bacteria | 3200 |
| 383 | Ga0268266_10245973 | 3300028379 | Bacteria | 1652 |
| 384 | Ga0268266_10827569 | 3300028379 | Bacteria | 894 |
| 385 | Ga0268266_11129461 | 3300028379 | Bacteria | 758 |
| 386 | Ga0265326_10014033 | 3300028558 | Bacteria | 2334 |
| 387 | Ga0265319_1002350 | 3300028563 | Bacteria | 10400 |
| 388 | Ga0265334_10001287 | 3300028573 | Bacteria | 12126 |
| 389 | Ga0265322_10119163 | 3300028654 | Bacteria | 751 |
| 390 | Ga0265336_10031700 | 3300028666 | Bacteria | 1641 |
| 391 | Ga0265336_10074240 | 3300028666 | Bacteria | 1016 |
| 392 | Ga0265338_10001268 | 3300028800 | Bacteria | 41631 |
| 393 | Ga0265338_10008494 | 3300028800 | Bacteria | 12457 |
| 394 | Ga0265338_10441864 | 3300028800 | Bacteria | 922 |
| 395 | Ga0265332_10000806 | 3300031238 | Bacteria | 19038 |
| 396 | Ga0265320_10092882 | 3300031240 | Bacteria | 1396 |
| 397 | Ga0265325_10023840 | 3300031241 | Bacteria | 3335 |
| 398 | Ga0265340_10012110 | 3300031247 | Bacteria | 4560 |
| 399 | Ga0265339_10107959 | 3300031249 | Bacteria | 1443 |
| 400 | Ga0265333_100268 | 3300031273 | Bacteria | 613 |
| 401 | Ga0265316_10121623 | 3300031344 | Bacteria | 1971 |
| 402 | Ga0307513_10080990 | 3300031456 | Bacteria | 3347 |
| 403 | Ga0265314_10006319 | 3300031711 | Bacteria | 10507 |
| 404 | Ga0265342_10007542 | 3300031712 | Bacteria | 7950 |
| 405 | Ga0316214_1005909 | 3300033545 | Bacteria | 1611 |
| 406 | Ga0316214_1019900 | 3300033545 | Bacteria | 937 |
| 407 | Ga0373930_0020965 | 3300034816 | Bacteria | 1278 |
| 408 | Ga0373950_0038877 | 3300034818 | Bacteria | 905 |
| 409 | Ga0373959_0023760 | 3300034820 | Bacteria | 1194 |
| 410 | Ga0373938_0019607 | 3300034957 | Bacteria | 1355 |
| 411 | Ga0373938_0040393 | 3300034957 | Bacteria | 1035 |
| 412 | Ga0373926_0001134 | 3300035083 | Bacteria | 7918 |
| 413 | Ga0373926_0022191 | 3300035083 | Bacteria | 2202 |
| 414 | Ga0373926_0041652 | 3300035083 | Bacteria | 1641 |
| 415 | Ga0373926_0071754 | 3300035083 | Bacteria | 1273 |
| 416 | Ga0373926_0121345 | 3300035083 | Unclassified | 986 |
| 417 | Ga0373926_0223889 | 3300035083 | Bacteria | 726 |
| 418 | Ga0373928_0002714 | 3300035084 | Bacteria | 3423 |
| 419 | Ga0373929_0003272 | 3300035085 | Bacteria | 2930 |
| 420 | Ga0373934_0000108 | 3300035086 | Bacteria | 29499 |
| 421 | Ga0373934_0013193 | 3300035086 | Bacteria | 3122 |
| 422 | Ga0373934_0027248 | 3300035086 | Bacteria | 2220 |
| 423 | Ga0373934_0041723 | 3300035086 | Bacteria | 1812 |
| 424 | Ga0373940_0006912 | 3300035088 | Bacteria | 2542 |
| 425 | Ga0373940_0009897 | 3300035088 | Bacteria | 2229 |
| 426 | Ga0373944_0000289 | 3300035089 | Bacteria | 11174 |
| 427 | Ga0373949_0029974 | 3300035090 | Bacteria | 1291 |
| 428 | Ga0373949_0111868 | 3300035090 | Bacteria | 759 |
| 429 | Ga0373952_0069798 | 3300035092 | Bacteria | 876 |
| 430 | Ga0373923_0000440 | 3300035111 | Bacteria | 9801 |
| 431 | Ga0373923_0040322 | 3300035111 | Bacteria | 1921 |
| 432 | Ga0373923_0057383 | 3300035111 | Bacteria | 1646 |
| 433 | Ga0373923_0064270 | 3300035111 | Bacteria | 1565 |
| 434 | Ga0373932_0025734 | 3300035112 | Bacteria | 1595 |
| 435 | Ga0373932_0059220 | 3300035112 | Bacteria | 1159 |
| 436 | Ga0373936_0012254 | 3300035113 | Bacteria | 3259 |
| 437 | Ga0373936_0013551 | 3300035113 | Bacteria | 3112 |
| 438 | Ga0373939_0022213 | 3300035114 | Bacteria | 1746 |
| 439 | Ga0373941_0006307 | 3300035115 | Bacteria | 2849 |
| 440 | Ga0373941_0062504 | 3300035115 | Bacteria | 1215 |
| 441 | Ga0373945_0003403 | 3300035116 | Bacteria | 5002 |
| 442 | Ga0373945_0046394 | 3300035116 | Bacteria | 1585 |
| 443 | Ga0373945_0098883 | 3300035116 | Bacteria | 1139 |
| 444 | Ga0373953_0000094 | 3300035117 | Bacteria | 21383 |
| 445 | Ga0373953_0014394 | 3300035117 | Bacteria | 2844 |
| 446 | Ga0373954_0017488 | 3300035118 | Bacteria | 3221 |
| 447 | Ga0373954_0049604 | 3300035118 | Bacteria | 1968 |
| 448 | Ga0373954_0055917 | 3300035118 | Bacteria | 1857 |
| 449 | Ga0373954_0080796 | 3300035118 | Bacteria | 1553 |
| 450 | Ga0373954_0166850 | 3300035118 | Bacteria | 1078 |
| 451 | Ga0373956_0001194 | 3300035119 | Bacteria | 10735 |
| 452 | Ga0373956_0023529 | 3300035119 | Bacteria | 2645 |
| 453 | Ga0373956_0039119 | 3300035119 | Bacteria | 2101 |
| 454 | Ga0373956_0073006 | 3300035119 | Bacteria | 1567 |
| 455 | Ga0373957_0000166 | 3300035120 | Bacteria | 16937 |
| 456 | Ga0373957_0017140 | 3300035120 | Bacteria | 2517 |
| 457 | Ga0373957_0029204 | 3300035120 | Bacteria | 2013 |
| 458 | Ga0373957_0184407 | 3300035120 | Bacteria | 866 |
| 459 | Ga0373957_0244383 | 3300035120 | Bacteria | 754 |
| 460 | Ga0373960_0005964 | 3300035121 | Bacteria | 2840 |
| 461 | Ga0373960_0011035 | 3300035121 | Bacteria | 2218 |
| 462 | Ga0373943_0010430 | 3300035170 | Bacteria | 4162 |
| 463 | Ga0373943_0010566 | 3300035170 | Bacteria | 4139 |
| 464 | Ga0373943_0040749 | 3300035170 | Bacteria | 2243 |
| 465 | Ga0373943_0215177 | 3300035170 | Bacteria | 1068 |
| 466 | Ga0373943_0305977 | 3300035170 | Bacteria | 903 |
| 467 | Ga0373946_0000253 | 3300035171 | Bacteria | 16969 |
| 468 | Ga0373946_0000665 | 3300035171 | Bacteria | 11525 |
| 469 | Ga0373955_0000112 | 3300035172 | Bacteria | 32757 |
| 470 | Ga0373955_0016168 | 3300035172 | Bacteria | 3668 |
| 471 | Ga0373955_0034753 | 3300035172 | Bacteria | 2665 |
| 472 | Ga0373955_0036781 | 3300035172 | Bacteria | 2600 |
| 473 | Ga0373955_0149199 | 3300035172 | Bacteria | 1375 |
| 474 | Ga0373942_0008613 | 3300035207 | Bacteria | 2380 |
| 475 | Ga0373942_0014666 | 3300035207 | Bacteria | 1901 |
| 476 | Ga0373924_0000211 | 3300035410 | Bacteria | 17761 |
| 477 | Ga0373924_0036499 | 3300035410 | Bacteria | 1997 |
| 478 | Ga0373924_0060595 | 3300035410 | Bacteria | 1582 |
| 479 | Ga0373924_0070876 | 3300035410 | Bacteria | 1470 |
| 480 | Ga0373924_0124105 | 3300035410 | Bacteria | 1121 |
| 481 | Ga0373931_0025020 | 3300035691 | Bacteria | 3030 |
| 482 | Ga0373931_0057950 | 3300035691 | Bacteria | 2079 |
| 483 | Ga0373935_0000970 | 3300035692 | Bacteria | 15551 |
| 484 | Ga0373935_0069952 | 3300035692 | Bacteria | 2262 |
| 485 | Ga0373935_0146207 | 3300035692 | Bacteria | 1600 |
| 486 | Ga0373935_0159764 | 3300035692 | Bacteria | 1535 |
| 487 | Ga0373935_0327343 | 3300035692 | Bacteria | 1088 |
| 488 | Ga0373935_0327790 | 3300035692 | Bacteria | 1088 |
| 489 | Ga0373927_0003427 | 3300035695 | Bacteria | 11371 |
| 490 | Ga0373927_0008071 | 3300035695 | Bacteria | 7107 |
| 491 | Ga0373927_0051612 | 3300035695 | Bacteria | 2659 |
| 492 | Ga0373927_0082711 | 3300035695 | Bacteria | 2082 |
| 493 | Ga0373927_0145110 | 3300035695 | Bacteria | 1553 |
| 494 | Ga0373927_0536300 | 3300035695 | Bacteria | 773 |
| 495 | Ga0373933_0000022 | 3300035724 | Bacteria | 94582 |
| 496 | Ga0373933_0008118 | 3300035724 | Bacteria | 5727 |
| 497 | Ga0373933_0009952 | 3300035724 | Bacteria | 5204 |
| 498 | Ga0373933_0010723 | 3300035724 | Bacteria | 5027 |
| 499 | Ga0373933_0015930 | 3300035724 | Bacteria | 4196 |
| 500 | Ga0373933_0041424 | 3300035724 | Bacteria | 2718 |
| 501 | Ga0373933_0125134 | 3300035724 | Bacteria | 1612 |
| 502 | Ga0373933_0215671 | 3300035724 | Bacteria | 1230 |
| 503 | Ga0373947_0000006 | 3300035725 | Bacteria | 223611 |
| 504 | Ga0373947_0001275 | 3300035725 | Bacteria | 15526 |
| 505 | Ga0373947_0100360 | 3300035725 | Bacteria | 1818 |
| 506 | Ga0373947_0136977 | 3300035725 | Bacteria | 1567 |
| 507 | Ga0373947_0188985 | 3300035725 | Bacteria | 1343 |
| 508 | Ga0373937_0000022 | 3300036401 | Bacteria | 127537 |
| 509 | Ga0373937_0008926 | 3300036401 | Bacteria | 8704 |
| 510 | Ga0373937_0021822 | 3300036401 | Bacteria | 5748 |
| 511 | Ga0373937_0031743 | 3300036401 | Bacteria | 4787 |
| 512 | Ga0373937_0067715 | 3300036401 | Bacteria | 3290 |
| 513 | Ga0373937_0082709 | 3300036401 | Bacteria | 2970 |
| 514 | Ga0373937_0091797 | 3300036401 | Bacteria | 2814 |
| 515 | Ga0372808_001444 | 3300036459 | Bacteria | 2471 |
| 516 | Ga0373925_0026273 | 3300037068 | Bacteria | 4260 |
| 517 | Ga0373925_0035770 | 3300037068 | Bacteria | 3666 |
| 518 | Ga0373925_0082951 | 3300037068 | Bacteria | 2440 |
| 519 | Ga0373925_0100820 | 3300037068 | Bacteria | 2219 |
| 520 | Ga0373925_0388852 | 3300037068 | Bacteria | 1136 |
| 521 | Ga0373925_0940153 | 3300037068 | Bacteria | 712 |
| 522 | Ga0395898_0082286 | 3300037466 | Bacteria | 3103 |
| 523 | Ga0436364_0037108 | 3300037853 | Bacteria | 71393 |
| 524 | Ga0436364_0261597 | 3300037853 | Bacteria | 1114 |
| 525 | Ga0436364_0287557 | 3300037853 | Bacteria | 2574 |
| 526 | Ga0436364_0939371 | 3300037853 | Bacteria | 4107 |
| 527 | Ga0436364_1104976 | 3300037853 | Bacteria | 23337 |
| 528 | Ga0436364_1228585 | 3300037853 | Bacteria | 1633 |
| 529 | Ga0436360_0208988 | 3300039438 | Bacteria | 2006 |
| 530 | Ga0436363_0334125 | 3300039450 | Bacteria | 1123 |
| 531 | Ga0436363_0902303 | 3300039450 | Bacteria | 3476 |
| 532 | Ga0436362_1163076 | 3300039453 | Bacteria | 724 |
| 533 | Ga0466967_0386297 | 3300045976 | Bacteria | 1360 |
| 534 | Ga0495592_0000025 | 3300046454 | Bacteria | 136324 |
| 535 | Ga0495592_0021532 | 3300046454 | Bacteria | 4904 |
| 536 | Ga0495592_0041359 | 3300046454 | Bacteria | 3454 |
| 537 | Ga0495592_0085010 | 3300046454 | Bacteria | 2281 |
| 538 | Ga0495592_0314287 | 3300046454 | Bacteria | 1014 |
| 539 | Ga0495592_0547723 | 3300046454 | Bacteria | 712 |
| 540 | Ga0495603_0005042 | 3300046455 | Bacteria | 7895 |
| 541 | Ga0495603_0127411 | 3300046455 | Bacteria | 1483 |
| 542 | Ga0495629_0002510 | 3300046459 | Bacteria | 14082 |
| 543 | Ga0495629_0128252 | 3300046459 | Bacteria | 1767 |
| 544 | Ga0495629_0144145 | 3300046459 | Bacteria | 1657 |
| 545 | Ga0495629_0335007 | 3300046459 | Bacteria | 1033 |
| 546 | Ga0495629_0475182 | 3300046459 | Bacteria | 845 |
| 547 | Ga0495641_0023745 | 3300046461 | Bacteria | 3039 |
| 548 | Ga0495641_0025292 | 3300046461 | Bacteria | 2915 |
| 549 | Ga0495641_0033918 | 3300046461 | Bacteria | 2418 |
| 550 | Ga0495641_0060163 | 3300046461 | Bacteria | 1716 |
| 551 | Ga0495651_0000014 | 3300046462 | Bacteria | 136312 |
| 552 | Ga0495651_0007180 | 3300046462 | Bacteria | 8517 |
| 553 | Ga0495651_0021944 | 3300046462 | Bacteria | 4965 |
| 554 | Ga0495651_0028505 | 3300046462 | Bacteria | 4350 |
| 555 | Ga0495651_0042434 | 3300046462 | Bacteria | 3531 |
| 556 | Ga0495651_0048290 | 3300046462 | Bacteria | 3287 |
| 557 | Ga0495651_0088658 | 3300046462 | Bacteria | 2324 |
| 558 | Ga0495651_0143650 | 3300046462 | Bacteria | 1727 |
| 559 | Ga0495653_0014717 | 3300046463 | Bacteria | 6381 |
| 560 | Ga0495653_0016957 | 3300046463 | Bacteria | 5924 |
| 561 | Ga0495653_0026663 | 3300046463 | Bacteria | 4631 |
| 562 | Ga0495653_0043271 | 3300046463 | Bacteria | 3502 |
| 563 | Ga0495653_0044783 | 3300046463 | Bacteria | 3433 |
| 564 | Ga0495653_0045692 | 3300046463 | Bacteria | 3394 |
| 565 | Ga0495653_0046178 | 3300046463 | Bacteria | 3373 |
| 566 | Ga0495653_0063155 | 3300046463 | Bacteria | 2796 |
| 567 | Ga0495653_0078687 | 3300046463 | Bacteria | 2444 |
| 568 | Ga0495653_0119616 | 3300046463 | Bacteria | 1880 |
| 569 | Ga0495580_0172773 | 3300046472 | Bacteria | 1493 |
| 570 | Ga0495580_0338896 | 3300046472 | Bacteria | 1020 |
| 571 | Ga0495582_0018083 | 3300046473 | Bacteria | 3855 |
| 572 | Ga0495582_0045935 | 3300046473 | Bacteria | 2405 |
| 573 | Ga0495582_0112136 | 3300046473 | Bacteria | 1532 |
| 574 | Ga0495639_0003951 | 3300046475 | Bacteria | 6368 |
| 575 | Ga0495639_0378547 | 3300046475 | Bacteria | 713 |
| 576 | Ga0495639_0464978 | 3300046475 | Bacteria | 643 |
| 577 | Ga0495662_0000415 | 3300046476 | Bacteria | 19153 |
| 578 | Ga0495662_0020737 | 3300046476 | Bacteria | 3179 |
| 579 | Ga0495662_0048126 | 3300046476 | Bacteria | 2058 |
| 580 | Ga0495662_0073669 | 3300046476 | Bacteria | 1656 |
| 581 | Ga0495662_0075897 | 3300046476 | Bacteria | 1631 |
| 582 | Ga0495662_0154573 | 3300046476 | Bacteria | 1130 |
| 583 | Ga0495662_0166289 | 3300046476 | Bacteria | 1087 |
| 584 | Ga0495664_0008128 | 3300046477 | Bacteria | 5843 |
| 585 | Ga0495664_0029022 | 3300046477 | Bacteria | 3233 |
| 586 | Ga0495664_0120739 | 3300046477 | Bacteria | 1585 |
| 587 | Ga0495664_0125558 | 3300046477 | Bacteria | 1552 |
| 588 | Ga0495594_0047095 | 3300046499 | Bacteria | 2368 |
| 589 | Ga0495594_0124249 | 3300046499 | Bacteria | 1460 |
| 590 | Ga0495608_0000190 | 3300046511 | Bacteria | 43597 |
| 591 | Ga0495608_0028031 | 3300046511 | Bacteria | 3828 |
| 592 | Ga0495608_0028686 | 3300046511 | Bacteria | 3782 |
| 593 | Ga0495608_0033081 | 3300046511 | Bacteria | 3496 |
| 594 | Ga0495608_0070311 | 3300046511 | Bacteria | 2284 |
| 595 | Ga0495608_0129896 | 3300046511 | Bacteria | 1613 |
| 596 | Ga0495608_0140027 | 3300046511 | Bacteria | 1544 |
| 597 | Ga0495608_0208713 | 3300046511 | Bacteria | 1228 |
| 598 | Ga0495618_0023599 | 3300046514 | Bacteria | 3805 |
| 599 | Ga0495618_0033244 | 3300046514 | Bacteria | 3233 |
| 600 | Ga0495618_0255303 | 3300046514 | Bacteria | 1099 |
| 601 | Ga0495628_0000346 | 3300046516 | Bacteria | 42250 |
| 602 | Ga0495628_0096929 | 3300046516 | Bacteria | 2278 |
| 603 | Ga0495628_0100836 | 3300046516 | Bacteria | 2228 |
| 604 | Ga0495628_0137232 | 3300046516 | Bacteria | 1868 |
| 605 | Ga0495628_0190508 | 3300046516 | Bacteria | 1548 |
| 606 | Ga0495628_0304756 | 3300046516 | Bacteria | 1178 |
| 607 | Ga0495628_0340798 | 3300046516 | Bacteria | 1103 |
| 608 | Ga0495630_0079683 | 3300046517 | Bacteria | 2470 |
| 609 | Ga0495630_0142407 | 3300046517 | Bacteria | 1823 |
| 610 | Ga0495630_0153212 | 3300046517 | Bacteria | 1754 |
| 611 | Ga0495666_0036493 | 3300046526 | Bacteria | 2394 |
| 612 | Ga0495666_0401726 | 3300046526 | Bacteria | 616 |
| 613 | Ga0495652_0009488 | 3300046529 | Bacteria | 8837 |
| 614 | Ga0495652_0010242 | 3300046529 | Bacteria | 8500 |
| 615 | Ga0495652_0030510 | 3300046529 | Bacteria | 4727 |
| 616 | Ga0495652_0038016 | 3300046529 | Bacteria | 4172 |
| 617 | Ga0495652_0079960 | 3300046529 | Bacteria | 2701 |
| 618 | Ga0495652_0091033 | 3300046529 | Bacteria | 2494 |
| 619 | Ga0495652_0130949 | 3300046529 | Bacteria | 1986 |
| 620 | Ga0495652_0266493 | 3300046529 | Bacteria | 1261 |
| 621 | Ga0495652_0467933 | 3300046529 | Bacteria | 879 |
| 622 | Ga0495652_0621910 | 3300046529 | Bacteria | 734 |
| 623 | Ga0495665_0000524 | 3300046531 | Bacteria | 19423 |
| 624 | Ga0495665_0014274 | 3300046531 | Bacteria | 4285 |
| 625 | Ga0495665_0015164 | 3300046531 | Bacteria | 4154 |
| 626 | Ga0495665_0109107 | 3300046531 | Bacteria | 1452 |
| 627 | Ga0495640_0002533 | 3300046533 | Bacteria | 14681 |
| 628 | Ga0495640_0030276 | 3300046533 | Bacteria | 3877 |
| 629 | Ga0495640_0040272 | 3300046533 | Bacteria | 3273 |
| 630 | Ga0495640_0046332 | 3300046533 | Bacteria | 3012 |
| 631 | Ga0495640_0048094 | 3300046533 | Bacteria | 2949 |
| 632 | Ga0495640_0095045 | 3300046533 | Bacteria | 1962 |
| 633 | Ga0495640_0237811 | 3300046533 | Bacteria | 1144 |
| 634 | Ga0495586_0006410 | 3300046535 | Bacteria | 6286 |
| 635 | Ga0495586_0097256 | 3300046535 | Bacteria | 1631 |
| 636 | Ga0495586_0466895 | 3300046535 | Bacteria | 728 |
| 637 | Ga0495587_0000029 | 3300046536 | Bacteria | 136321 |
| 638 | Ga0495587_0006950 | 3300046536 | Bacteria | 7350 |
| 639 | Ga0495587_0012669 | 3300046536 | Bacteria | 5303 |
| 640 | Ga0495587_0081467 | 3300046536 | Bacteria | 1875 |
| 641 | Ga0495587_0111654 | 3300046536 | Bacteria | 1570 |
| 642 | Ga0495587_0128291 | 3300046536 | Bacteria | 1450 |
| 643 | Ga0495587_0269542 | 3300046536 | Bacteria | 955 |
| 644 | Ga0495645_0022525 | 3300046543 | Bacteria | 4558 |
| 645 | Ga0495645_0033757 | 3300046543 | Bacteria | 3733 |
| 646 | Ga0495645_0113797 | 3300046543 | Bacteria | 1912 |
| 647 | Ga0495645_0128315 | 3300046543 | Bacteria | 1780 |
| 648 | Ga0495645_0181273 | 3300046543 | Bacteria | 1443 |
| 649 | Ga0495645_0300157 | 3300046543 | Bacteria | 1049 |
| 650 | Ga0495667_0000036 | 3300046559 | Bacteria | 136146 |
| 651 | Ga0495667_0000607 | 3300046559 | Bacteria | 22870 |
| 652 | Ga0495667_0001443 | 3300046559 | Bacteria | 15660 |
| 653 | Ga0495667_0011226 | 3300046559 | Bacteria | 6067 |
| 654 | Ga0495667_0127393 | 3300046559 | Bacteria | 1642 |
| 655 | Ga0495667_0308849 | 3300046559 | Bacteria | 1001 |
| 656 | Ga0495667_0315536 | 3300046559 | Bacteria | 989 |
| 657 | Ga0495634_0030816 | 3300046642 | Bacteria | 3699 |
| 658 | Ga0495634_0044601 | 3300046642 | Bacteria | 3000 |
| 659 | Ga0495634_0069302 | 3300046642 | Bacteria | 2327 |
| 660 | Ga0495634_0079689 | 3300046642 | Bacteria | 2144 |
| 661 | Ga0495634_0084894 | 3300046642 | Bacteria | 2064 |
| 662 | Ga0495634_0098423 | 3300046642 | Bacteria | 1892 |
| 663 | Ga0495635_0000666 | 3300046663 | Bacteria | 22059 |
| 664 | Ga0495635_0004586 | 3300046663 | Bacteria | 9583 |
| 665 | Ga0495635_0008790 | 3300046663 | Bacteria | 7053 |
| 666 | Ga0495635_0017383 | 3300046663 | Bacteria | 5024 |
| 667 | Ga0495635_0038965 | 3300046663 | Bacteria | 3290 |
| 668 | Ga0495635_0110970 | 3300046663 | Bacteria | 1873 |
| 669 | Ga0495588_0058930 | 3300046674 | Bacteria | 1985 |
| 670 | Ga0495657_0000071 | 3300046675 | Bacteria | 92182 |
| 671 | Ga0495657_0004781 | 3300046675 | Bacteria | 10796 |
| 672 | Ga0495657_0008636 | 3300046675 | Bacteria | 7776 |
| 673 | Ga0495657_0038498 | 3300046675 | Bacteria | 3290 |
| 674 | Ga0495657_0044277 | 3300046675 | Bacteria | 3028 |
| 675 | Ga0495657_0052598 | 3300046675 | Bacteria | 2729 |
| 676 | Ga0495599_0000094 | 3300046678 | Bacteria | 62648 |
| 677 | Ga0495599_0010549 | 3300046678 | Bacteria | 5652 |
| 678 | Ga0495599_0025290 | 3300046678 | Bacteria | 3715 |
| 679 | Ga0495599_0045618 | 3300046678 | Bacteria | 2748 |
| 680 | Ga0495599_0075935 | 3300046678 | Bacteria | 2098 |
| 681 | Ga0495599_0088526 | 3300046678 | Bacteria | 1933 |
| 682 | Ga0495599_0373501 | 3300046678 | Bacteria | 852 |
| 683 | Ga0495623_0000113 | 3300046679 | Bacteria | 49223 |
| 684 | Ga0495623_0067661 | 3300046679 | Bacteria | 2229 |
| 685 | Ga0495623_0073363 | 3300046679 | Bacteria | 2127 |
| 686 | Ga0495623_0126899 | 3300046679 | Bacteria | 1531 |
| 687 | Ga0495646_0008387 | 3300046680 | Bacteria | 6569 |
| 688 | Ga0495646_0031995 | 3300046680 | Bacteria | 3275 |
| 689 | Ga0495646_0079454 | 3300046680 | Bacteria | 1915 |
| 690 | Ga0495646_0169645 | 3300046680 | Bacteria | 1203 |
| 691 | Ga0495647_0019101 | 3300046681 | Bacteria | 2448 |
| 692 | Ga0495647_0032534 | 3300046681 | Bacteria | 1944 |
| 693 | Ga0495658_0003156 | 3300046683 | Bacteria | 8214 |
| 694 | Ga0495658_0246658 | 3300046683 | Bacteria | 1122 |
| 695 | Ga0495613_0155947 | 3300046689 | Bacteria | 1626 |
| 696 | Ga0495624_0003337 | 3300046690 | Bacteria | 11932 |
| 697 | Ga0495624_0026797 | 3300046690 | Bacteria | 3776 |
| 698 | Ga0495624_0051450 | 3300046690 | Bacteria | 2606 |
| 699 | Ga0495600_0056648 | 3300046809 | Bacteria | 2561 |
| 700 | Ga0495600_0074984 | 3300046809 | Bacteria | 2209 |
| 701 | Ga0495600_0430895 | 3300046809 | Bacteria | 817 |
| 702 | Ga0495581_0000903 | 3300047315 | Bacteria | 15917 |
| 703 | Ga0495581_0187254 | 3300047315 | Bacteria | 1210 |
| 704 | Ga0495581_0282435 | 3300047315 | Bacteria | 970 |
| 705 | Ga0495604_0000044 | 3300047317 | Bacteria | 112937 |
| 706 | Ga0495604_0023045 | 3300047317 | Bacteria | 4969 |
| 707 | Ga0495604_0115051 | 3300047317 | Bacteria | 1955 |
| 708 | Ga0495604_0145466 | 3300047317 | Bacteria | 1689 |
| 709 | Ga0495604_0253470 | 3300047317 | Bacteria | 1199 |
| 710 | Ga0495604_0300080 | 3300047317 | Bacteria | 1079 |
| 711 | Ga0495674_0000044 | 3300047319 | Bacteria | 84651 |
| 712 | Ga0495674_0020966 | 3300047319 | Bacteria | 6047 |
| 713 | Ga0495674_0057081 | 3300047319 | Bacteria | 3417 |
| 714 | Ga0495674_0059918 | 3300047319 | Bacteria | 3323 |
| 715 | Ga0495674_0145173 | 3300047319 | Bacteria | 1992 |
| 716 | Ga0495674_0171184 | 3300047319 | Bacteria | 1812 |
| 717 | Ga0495676_0008527 | 3300047321 | Bacteria | 9393 |
| 718 | Ga0495676_0058852 | 3300047321 | Bacteria | 3021 |
| 719 | Ga0495676_0158664 | 3300047321 | Bacteria | 1602 |
| 720 | Ga0495680_0000219 | 3300047322 | Bacteria | 62686 |
| 721 | Ga0495680_0008298 | 3300047322 | Bacteria | 9458 |
| 722 | Ga0495680_0009686 | 3300047322 | Bacteria | 8646 |
| 723 | Ga0495680_0017665 | 3300047322 | Bacteria | 6078 |
| 724 | Ga0495680_0018149 | 3300047322 | Bacteria | 5983 |
| 725 | Ga0495680_0043101 | 3300047322 | Bacteria | 3575 |
| 726 | Ga0495680_0048768 | 3300047322 | Bacteria | 3323 |
| 727 | Ga0495680_0192560 | 3300047322 | Bacteria | 1466 |
| 728 | Ga0495680_0349093 | 3300047322 | Bacteria | 1030 |
| 729 | Ga0495675_0002157 | 3300047444 | Bacteria | 11734 |
| 730 | Ga0495675_0004181 | 3300047444 | Bacteria | 8733 |
| 731 | Ga0495675_0023500 | 3300047444 | Bacteria | 3928 |
| 732 | Ga0495675_0056484 | 3300047444 | Bacteria | 2489 |
| 733 | Ga0495675_0098618 | 3300047444 | Bacteria | 1830 |
| 734 | Ga0495684_0000962 | 3300047471 | Bacteria | 23465 |
| 735 | Ga0495684_0019115 | 3300047471 | Bacteria | 5275 |
| 736 | Ga0495684_0023643 | 3300047471 | Bacteria | 4725 |
| 737 | Ga0495684_0045001 | 3300047471 | Bacteria | 3378 |
| 738 | Ga0495684_0047586 | 3300047471 | Bacteria | 3279 |
| 739 | Ga0495684_0058044 | 3300047471 | Bacteria | 2948 |
| 740 | Ga0495684_0064779 | 3300047471 | Bacteria | 2777 |
| 741 | Ga0495684_0367508 | 3300047471 | Bacteria | 1017 |
| 742 | Ga0495593_0013529 | 3300047673 | Bacteria | 4652 |
| 743 | Ga0495593_0063625 | 3300047673 | Bacteria | 1926 |
| 744 | Ga0495593_0123293 | 3300047673 | Bacteria | 1318 |
| 745 | Ga0495593_0484999 | 3300047673 | Bacteria | 619 |
| 746 | Ga0495602_0000480 | 3300048088 | Bacteria | 36967 |
| 747 | Ga0495602_0011445 | 3300048088 | Bacteria | 9175 |
| 748 | Ga0495602_0051492 | 3300048088 | Bacteria | 3666 |
| 749 | Ga0495602_0081676 | 3300048088 | Bacteria | 2716 |
| 750 | Ga0495602_0130961 | 3300048088 | Bacteria | 2000 |
| 751 | Ga0495602_0144692 | 3300048088 | Bacteria | 1877 |
| 752 | Ga0495602_0314385 | 3300048088 | Bacteria | 1142 |
| 753 | Ga0495602_0436655 | 3300048088 | Bacteria | 926 |
| 754 | Ga0495614_0005646 | 3300048089 | Bacteria | 5641 |
| 755 | Ga0496100_0069654 | 3300048903 | Bacteria | 2343 |
| 756 | Ga0496100_0380351 | 3300048903 | Bacteria | 1072 |
| 757 | Ga0496100_0642941 | 3300048903 | Bacteria | 825 |
| 758 | Ga0496101_0081580 | 3300048904 | Bacteria | 2392 |
| 759 | Ga0496101_0139003 | 3300048904 | Bacteria | 1850 |
| 760 | Ga0496102_0026222 | 3300048905 | Bacteria | 5196 |
| 761 | Ga0496102_0082077 | 3300048905 | Bacteria | 2973 |
| 762 | Ga0496102_1043812 | 3300048905 | Bacteria | 737 |
| 763 | Ga0496103_0112067 | 3300048906 | Bacteria | 1733 |
| 764 | Ga0496104_0000937 | 3300048907 | Bacteria | 25040 |
| 765 | Ga0496104_0008559 | 3300048907 | Bacteria | 9098 |
| 766 | Ga0496104_0226081 | 3300048907 | Bacteria | 1783 |
| 767 | Ga0496105_0004650 | 3300048908 | Bacteria | 10346 |
| 768 | Ga0496105_0039198 | 3300048908 | Bacteria | 3904 |
| 769 | Ga0496105_0039664 | 3300048908 | Bacteria | 3882 |
| 770 | Ga0496105_0141738 | 3300048908 | Bacteria | 1978 |
| 771 | Ga0496105_0532042 | 3300048908 | Bacteria | 919 |
| 772 | Ga0496106_0084617 | 3300048909 | Bacteria | 2440 |
| 773 | Ga0496106_0460027 | 3300048909 | Bacteria | 1022 |
| 774 | Ga0496107_0243041 | 3300048910 | Bacteria | 1339 |
| 775 | Ga0496107_0550371 | 3300048910 | Bacteria | 855 |
| 776 | Ga0496108_0013818 | 3300048911 | Bacteria | 6586 |
| 777 | Ga0496108_0018374 | 3300048911 | Bacteria | 5725 |
| 778 | Ga0496108_0329259 | 3300048911 | Bacteria | 1332 |
| 779 | Ga0496108_0334223 | 3300048911 | Bacteria | 1321 |
| 780 | Ga0496109_0282136 | 3300048912 | Bacteria | 1565 |
| 781 | Ga0496110_0008342 | 3300048913 | Bacteria | 8335 |
| 782 | Ga0496110_0020460 | 3300048913 | Bacteria | 5588 |
| 783 | Ga0496110_0175364 | 3300048913 | Bacteria | 1946 |
| 784 | Ga0496110_0402202 | 3300048913 | Bacteria | 1248 |
| 785 | Ga0496110_1027197 | 3300048913 | Bacteria | 732 |
| 786 | Ga0496111_0050441 | 3300048914 | Bacteria | 3002 |
| 787 | Ga0496111_0089111 | 3300048914 | Bacteria | 2259 |
| 788 | Ga0496112_0000856 | 3300048915 | Bacteria | 21735 |
| 789 | Ga0496112_0321594 | 3300048915 | Bacteria | 1491 |
| 790 | Ga0496112_0379829 | 3300048915 | Bacteria | 1354 |
| 791 | Ga0496113_0002091 | 3300048916 | Bacteria | 11499 |
| 792 | Ga0496113_0060684 | 3300048916 | Bacteria | 2851 |
| 793 | Ga0496113_0237122 | 3300048916 | Bacteria | 1455 |
| 794 | Ga0496114_0115280 | 3300048917 | Bacteria | 2305 |
| 795 | Ga0496114_0116764 | 3300048917 | Bacteria | 2291 |
| 796 | Ga0496114_0426917 | 3300048917 | Bacteria | 1174 |
| 797 | Ga0496114_0734777 | 3300048917 | Bacteria | 864 |
| 798 | Ga0496115_0010010 | 3300048918 | Bacteria | 7066 |
| 799 | Ga0496115_0103986 | 3300048918 | Bacteria | 2330 |
| 800 | Ga0496115_0208692 | 3300048918 | Bacteria | 1613 |
| 801 | Ga0496115_0454258 | 3300048918 | Bacteria | 1034 |
| 802 | Ga0496126_0073104 | 3300048929 | Bacteria | 3049 |
| 803 | Ga0496126_0119671 | 3300048929 | Bacteria | 2285 |
| 804 | Ga0496126_0385488 | 3300048929 | Bacteria | 1140 |
| 805 | nmdc:mga05p37_17739_c1 | 3300050507 | Bacteria | 8590 |
| 806 | nmdc:mga08y16_281472_c1 | 3300050511 | Bacteria | 1715 |
| 807 | nmdc:mga0n895_431931_c1 | 3300050512 | Bacteria | 1331 |
| 808 | nmdc:mga0rr50_412662_c1 | 3300050513 | Bacteria | 1142 |
| 809 | nmdc:mga0rr50_479843_c1 | 3300050513 | Bacteria | 1056 |
| 810 | nmdc:mga08x19_153879_c1 | 3300050514 | Bacteria | 1559 |
| 811 | nmdc:mga08x19_158074_c1 | 3300050514 | Bacteria | 1538 |
| 812 | nmdc:mga08x19_361036_c1 | 3300050514 | Bacteria | 1015 |
| 813 | nmdc:mga08x19_567600_c1 | 3300050514 | Bacteria | 803 |
| 814 | nmdc:mga08x19_932844_c1 | 3300050514 | Bacteria | 617 |
| 815 | nmdc:mga0a205_268338_c1 | 3300050515 | Bacteria | 1584 |
| 816 | nmdc:mga0a205_328002_c1 | 3300050515 | Bacteria | 1401 |
| 817 | Ga0495601_0093640 | 3300053077 | Bacteria | 1935 |
| 818 | Ga0495601_0301055 | 3300053077 | Bacteria | 1044 |
| 819 | Ga0495601_0416969 | 3300053077 | Bacteria | 870 |
| 820 | Ga0495601_0463444 | 3300053077 | Bacteria | 819 |
| 821 | Ga0495612_0023842 | 3300053078 | Bacteria | 2456 |
| 822 | Ga0495612_0047110 | 3300053078 | Bacteria | 1766 |
| 823 | Ga0495612_0056807 | 3300053078 | Bacteria | 1616 |
| 824 | Ga0495595_0002659 | 3300053084 | Bacteria | 7012 |
| 825 | Ga0495595_0019682 | 3300053084 | Bacteria | 2932 |
| 826 | Ga0495595_0024477 | 3300053084 | Bacteria | 2667 |
| 827 | Ga0495619_0018796 | 3300053085 | Bacteria | 4387 |
| 828 | Ga0495619_0131015 | 3300053085 | Bacteria | 1723 |
| 829 | Ga0495619_0196856 | 3300053085 | Bacteria | 1395 |
| 830 | Ga0495619_0216579 | 3300053085 | Bacteria | 1326 |
| 831 | Ga0070706_100200006 | |||
| 832 | JGI25406J46586_10026636 | |||
| 833 | JGI25406J46586_10051432 | |||
| 834 | Ga0070658_10115677 | |||
| 835 | Ga0070676_10132357 | |||
| 836 | Ga0070683_100046191 | |||
| 837 | Ga0070683_100051955 | |||
| 838 | Ga0070683_100090481 | |||
| 839 | Ga0070683_100292721 | |||
| 840 | Ga0070683_100745345 | |||
| 841 | Ga0070690_100063725 | |||
| 842 | Ga0070690_100445728 | |||
| 843 | Ga0068869_100241097 | |||
| 844 | Ga0070680_100046060 | |||
| 845 | Ga0070680_100933244 | |||
| 846 | Ga0070682_100037102 | |||
| 847 | Ga0070682_100097853 | |||
| 848 | Ga0070682_100553687 | |||
| 849 | Ga0068868_100235676 | |||
| 850 | Ga0070660_100029919 | |||
| 851 | Ga0070660_100109202 | |||
| 852 | Ga0070660_100274378 | |||
| 853 | Ga0070689_100061655 | |||
| 854 | Ga0070691_10012298 | |||
| 855 | Ga0070691_10093505 | |||
| 856 | Ga0070687_100026444 | |||
| 857 | Ga0070661_100031694 | |||
| 858 | Ga0070661_100084305 | |||
| 859 | Ga0070661_100235328 | |||
| 860 | Ga0070692_10099929 | |||
| 861 | Ga0070669_100215396 | |||
| 862 | Ga0070675_100071388 | |||
| 863 | Ga0070671_100136085 | |||
| 864 | Ga0070671_100160710 | |||
| 865 | Ga0070673_100077674 | |||
| 866 | Ga0070667_100120941 | |||
| 867 | Ga0070703_10023877 | |||
| 868 | Ga0070709_10000165 | |||
| 869 | Ga0070709_10072380 | |||
| 870 | Ga0070709_10198176 | |||
| 871 | Ga0070709_10381062 | |||
| 872 | Ga0070714_100000318 | |||
| 873 | Ga0070714_100000689 | |||
| 874 | Ga0070714_100107703 | |||
| 875 | Ga0070714_100130892 | |||
| 876 | Ga0070714_100314723 | |||
| 877 | Ga0070714_100323225 | |||
| 878 | Ga0070714_100327661 | |||
| 879 | Ga0070714_100434270 | |||
| 880 | Ga0070714_100451261 | |||
| 881 | Ga0070713_100002403 | |||
| 882 | Ga0070713_100077760 | |||
| 883 | Ga0070713_100085400 | |||
| 884 | Ga0070713_100110827 | |||
| 885 | Ga0070713_100209379 | |||
| 886 | Ga0070713_100295037 | |||
| 887 | Ga0070710_10004650 | |||
| 888 | Ga0070710_10111283 | |||
| 889 | Ga0070701_10054289 | |||
| 890 | Ga0070711_100000158 | |||
| 891 | Ga0070711_100061073 | |||
| 892 | Ga0070711_100185136 | |||
| 893 | Ga0070705_100039731 | |||
| 894 | Ga0070700_100046386 | |||
| 895 | Ga0070694_100451049 | |||
| 896 | Ga0070708_100027451 | |||
| 897 | Ga0070708_100046036 | |||
| 898 | Ga0070708_100069236 | |||
| 899 | Ga0070708_100174273 | |||
| 900 | Ga0070708_100286122 | |||
| 901 | Ga0070663_100176013 | |||
| 902 | Ga0070678_100071149 | |||
| 903 | Ga0070662_100200609 | |||
| 904 | Ga0070681_10072320 | |||
| 905 | Ga0070681_10142805 | |||
| 906 | Ga0070685_10425788 | |||
| 907 | Ga0070706_100007197 | |||
| 908 | Ga0070706_100025430 | |||
| 909 | Ga0070706_100025704 | |||
| 910 | Ga0070706_100061551 | |||
| 911 | Ga0070706_100309083 | |||
| 912 | Ga0070707_100002252 | |||
| 913 | Ga0070707_100013838 | |||
| 914 | Ga0070707_100025462 | |||
| 915 | Ga0070707_100118089 | |||
| 916 | Ga0070707_100356140 | |||
| 917 | Ga0070707_100377365 | |||
| 918 | Ga0070698_100000028 | |||
| 919 | Ga0070698_100017873 | |||
| 920 | Ga0070698_100036945 | |||
| 921 | Ga0070698_100116624 | |||
| 922 | Ga0070698_100419988 | |||
| 923 | Ga0070699_100314352 | |||
| 924 | Ga0070679_100029643 | |||
| 925 | Ga0070679_100091308 | |||
| 926 | Ga0070679_100212928 | |||
| 927 | Ga0070679_100225635 | |||
| 928 | Ga0070679_100251424 | |||
| 929 | Ga0070679_100976554 | |||
| 930 | Ga0070684_100056907 | |||
| 931 | Ga0070684_100061371 | |||
| 932 | Ga0070684_100420442 | |||
| 933 | Ga0070697_100128279 | |||
| 934 | Ga0068853_100245316 | |||
| 935 | Ga0070672_100080750 | |||
| 936 | Ga0070686_100214169 | |||
| 937 | Ga0070695_100685073 | |||
| 938 | Ga0070693_100029706 | |||
| 939 | Ga0070693_100191468 | |||
| 940 | Ga0070665_100094927 | |||
| 941 | Ga0070665_100395622 | |||
| 942 | Ga0070704_100533625 | |||
| 943 | Ga0068855_100287901 | |||
| 944 | Ga0068855_100296141 | |||
| 945 | Ga0068855_100584951 | |||
| 946 | Ga0070664_100049942 | |||
| 947 | Ga0068857_100076359 | |||
| 948 | Ga0068854_100058858 | |||
| 949 | Ga0068856_100039845 | |||
| 950 | Ga0068856_100125024 | |||
| 951 | Ga0068856_100202278 | |||
| 952 | Ga0068856_100377649 | |||
| 953 | Ga0068856_100714355 | |||
| 954 | Ga0070702_100031011 | |||
| 955 | Ga0070702_100058569 | |||
| 956 | Ga0068852_100219060 | |||
| 957 | Ga0068859_100030304 | |||
| 958 | Ga0068864_100054407 | |||
| 959 | Ga0068864_100216635 | |||
| 960 | Ga0068866_10317658 | |||
| 961 | Ga0068870_10241281 | |||
| 962 | Ga0068863_100143487 | |||
| 963 | Ga0068863_100250153 | |||
| 964 | Ga0068858_100038629 | |||
| 965 | Ga0068858_100120587 | |||
| 966 | Ga0068860_100101942 | |||
| 967 | Ga0068862_101008367 | |||
| 968 | Ga0068862_101610697 | |||
| 969 | Ga0081455_10290191 | |||
| 970 | Ga0081540_1000960 | |||
| 971 | Ga0081539_10000168 | |||
| 972 | Ga0081539_10001596 | |||
| 973 | Ga0070717_10000613 | |||
| 974 | Ga0070717_10003861 | |||
| 975 | Ga0070717_10089543 | |||
| 976 | Ga0070717_10184170 | |||
| 977 | Ga0070717_10255600 | |||
| 978 | Ga0070717_10268244 | |||
| 979 | Ga0070717_10529486 | |||
| 980 | Ga0070717_11387624 | |||
| 981 | Ga0070715_10003238 | |||
| 982 | Ga0070715_10011325 | |||
| 983 | Ga0070715_10017515 | |||
| 984 | Ga0070715_10070031 | |||
| 985 | Ga0070715_10091086 | |||
| 986 | Ga0070716_100003016 | |||
| 987 | Ga0070716_100006566 | |||
| 988 | Ga0070716_100022526 | |||
| 989 | Ga0070716_100046508 | |||
| 990 | Ga0070716_100049433 | |||
| 991 | Ga0070716_100107921 | |||
| 992 | Ga0070716_100142998 | |||
| 993 | Ga0070716_100161225 | |||
| 994 | Ga0070716_100180091 | |||
| 995 | Ga0070712_100001425 | |||
| 996 | Ga0070712_100006067 | |||
| 997 | Ga0070712_100068139 | |||
| 998 | Ga0070712_100275053 | |||
| 999 | Ga0070712_100474080 | |||
| 1000 | Ga0097621_100154910 | |||
| 1001 | Ga0068871_100078711 | |||
| 1002 | Ga0075433_10226640 | |||
| 1003 | Ga0075433_10821483 | |||
| 1004 | Ga0075434_100174437 | |||
| 1005 | Ga0075434_100722038 | |||
| 1006 | Ga0075434_101054610 | |||
| 1007 | Ga0068865_100484309 | |||
| 1008 | Ga0075436_100024664 | |||
| 1009 | Ga0075436_100287363 | |||
| 1010 | Ga0075436_100618483 | |||
| 1011 | Ga0097620_100030304 | |||
| 1012 | Ga0075435_100463516 | |||
| 1013 | Ga0075435_100504994 | |||
| 1014 | Ga0099795_10055513 | |||
| 1015 | Ga0105251_10059567 | |||
| 1016 | Ga0105240_10107430 | |||
| 1017 | Ga0105240_10342987 | |||
| 1018 | Ga0111539_10760425 | |||
| 1019 | Ga0105245_10014529 | |||
| 1020 | Ga0105245_11087380 | |||
| 1021 | Ga0105247_10022237 | |||
| 1022 | Ga0105247_10654236 | |||
| 1023 | Ga0114129_10274852 | |||
| 1024 | Ga0105243_10032414 | |||
| 1025 | Ga0105241_10051803 | |||
| 1026 | Ga0105241_10191984 | |||
| 1027 | Ga0105241_10275241 | |||
| 1028 | Ga0105242_10628235 | |||
| 1029 | Ga0105248_10504725 | |||
| 1030 | Ga0105248_10742750 | |||
| 1031 | Ga0105237_10895640 | |||
| 1032 | Ga0105238_10332936 | |||
| 1033 | Ga0105249_10077682 | |||
| 1034 | Ga0105249_11234610 | |||
| 1035 | Ga0105239_10079492 | |||
| 1036 | Ga0105239_10335671 | |||
| 1037 | Ga0157341_1000456 | |||
| 1038 | Ga0157373_10108168 | |||
| 1039 | Ga0157371_10026824 | |||
| 1040 | Ga0157369_10011297 | |||
| 1041 | Ga0157369_10215324 | |||
| 1042 | Ga0157369_10577647 | |||
| 1043 | Ga0157369_10845954 | |||
| 1044 | Ga0157374_10021503 | |||
| 1045 | Ga0157378_10155054 | |||
| 1046 | Ga0163162_10464161 | |||
| 1047 | Ga0163162_10572436 | |||
| 1048 | Ga0157375_10067111 | |||
| 1049 | Ga0157375_10414829 | |||
| 1050 | Ga0157375_10601299 | |||
| 1051 | Ga0163163_10080540 | |||
| 1052 | Ga0163163_10659864 | |||
| 1053 | Ga0157377_10030606 | |||
| 1054 | Ga0157376_10070067 | |||
| 1055 | Ga0163161_10293298 | |||
| 1056 | Ga0206352_10580932 | |||
| 1057 | Ga0206354_10169703 | |||
| 1058 | Ga0206354_10517769 | |||
| 1059 | Ga0206353_10010843 | |||
| 1060 | Ga0206353_10373402 | |||
| 1061 | Ga0206353_11075300 | |||
| 1062 | Ga0213875_10003914 | |||
| 1063 | Ga0213875_10027609 | |||
| 1064 | Ga0224712_10043787 | |||
| 1065 | Ga0224572_1000411 | |||
| 1066 | Ga0207653_10011575 | |||
| 1067 | Ga0207692_10000088 | |||
| 1068 | Ga0207692_10028561 | |||
| 1069 | Ga0207692_10050147 | |||
| 1070 | Ga0207692_10052988 | |||
| 1071 | Ga0207692_10396893 | |||
| 1072 | Ga0207642_10182244 | |||
| 1073 | Ga0207710_10083427 | |||
| 1074 | Ga0207680_10439570 | |||
| 1075 | Ga0207647_10081670 | |||
| 1076 | Ga0207685_10005526 | |||
| 1077 | Ga0207685_10018343 | |||
| 1078 | Ga0207699_10000608 | |||
| 1079 | Ga0207699_10001012 | |||
| 1080 | Ga0207699_10004119 | |||
| 1081 | Ga0207699_10008170 | |||
| 1082 | Ga0207699_10014333 | |||
| 1083 | Ga0207699_10030959 | |||
| 1084 | Ga0207699_10099645 | |||
| 1085 | Ga0207699_10353773 | |||
| 1086 | Ga0207699_10608150 | |||
| 1087 | Ga0207643_10039030 | |||
| 1088 | Ga0207705_10103263 | |||
| 1089 | Ga0207705_10167226 | |||
| 1090 | Ga0207705_10348128 | |||
| 1091 | Ga0207684_10000479 | |||
| 1092 | Ga0207684_10031124 | |||
| 1093 | Ga0207684_10038125 | |||
| 1094 | Ga0207684_10097069 | |||
| 1095 | Ga0207684_10267871 | |||
| 1096 | Ga0207684_10863774 | |||
| 1097 | Ga0207654_10024927 | |||
| 1098 | Ga0207707_10070181 | |||
| 1099 | Ga0207695_10119018 | |||
| 1100 | Ga0207693_10000436 | |||
| 1101 | Ga0207693_10013696 | |||
| 1102 | Ga0207693_10028840 | |||
| 1103 | Ga0207693_10187025 | |||
| 1104 | Ga0207693_10252786 | |||
| 1105 | Ga0207693_10320784 | |||
| 1106 | Ga0207663_10000615 | |||
| 1107 | Ga0207663_10007709 | |||
| 1108 | Ga0207663_10015272 | |||
| 1109 | Ga0207663_10045564 | |||
| 1110 | Ga0207663_10088485 | |||
| 1111 | Ga0207663_10096041 | |||
| 1112 | Ga0207663_10252762 | |||
| 1113 | Ga0207663_10259204 | |||
| 1114 | Ga0207660_10127040 | |||
| 1115 | Ga0207657_10009348 | |||
| 1116 | Ga0207657_10092759 | |||
| 1117 | Ga0207657_10127284 | |||
| 1118 | Ga0207649_10065416 | |||
| 1119 | Ga0207649_10549674 | |||
| 1120 | Ga0207652_10051551 | |||
| 1121 | Ga0207652_10121271 | |||
| 1122 | Ga0207652_10606183 | |||
| 1123 | Ga0207646_10001795 | |||
| 1124 | Ga0207646_10037708 | |||
| 1125 | Ga0207646_10086289 | |||
| 1126 | Ga0207646_10152844 | |||
| 1127 | Ga0207646_10297110 | |||
| 1128 | Ga0207694_10135476 | |||
| 1129 | Ga0207694_10252978 | |||
| 1130 | Ga0207694_10399319 | |||
| 1131 | Ga0207659_10235298 | |||
| 1132 | Ga0207687_10122369 | |||
| 1133 | Ga0207700_10000029 | |||
| 1134 | Ga0207700_10005448 | |||
| 1135 | Ga0207700_10026096 | |||
| 1136 | Ga0207700_10043955 | |||
| 1137 | Ga0207700_10050230 | |||
| 1138 | Ga0207700_10053591 | |||
| 1139 | Ga0207700_10071911 | |||
| 1140 | Ga0207700_10292942 | |||
| 1141 | Ga0207700_10392408 | |||
| 1142 | Ga0207700_10976358 | |||
| 1143 | Ga0207700_11206666 | |||
| 1144 | Ga0207664_10000110 | |||
| 1145 | Ga0207664_10003503 | |||
| 1146 | Ga0207664_10017314 | |||
| 1147 | Ga0207664_10022560 | |||
| 1148 | Ga0207664_10041698 | |||
| 1149 | Ga0207664_10047498 | |||
| 1150 | Ga0207664_10079094 | |||
| 1151 | Ga0207664_10096587 | |||
| 1152 | Ga0207664_10109795 | |||
| 1153 | Ga0207664_10114508 | |||
| 1154 | Ga0207664_10120446 | |||
| 1155 | Ga0207664_10149922 | |||
| 1156 | Ga0207664_10256952 | |||
| 1157 | Ga0207664_10258149 | |||
| 1158 | Ga0207664_10303265 | |||
| 1159 | Ga0207664_11066056 | |||
| 1160 | Ga0207644_10169885 | |||
| 1161 | Ga0207644_10496594 | |||
| 1162 | Ga0207706_10021844 | |||
| 1163 | Ga0207709_10167029 | |||
| 1164 | Ga0207665_10000144 | |||
| 1165 | Ga0207665_10001603 | |||
| 1166 | Ga0207665_10015291 | |||
| 1167 | Ga0207665_10019951 | |||
| 1168 | Ga0207665_10102307 | |||
| 1169 | Ga0207665_10242410 | |||
| 1170 | Ga0207665_10262766 | |||
| 1171 | Ga0207691_10153945 | |||
| 1172 | Ga0207689_10008458 | |||
| 1173 | Ga0207661_10000534 | |||
| 1174 | Ga0207661_10064694 | |||
| 1175 | Ga0207661_10279849 | |||
| 1176 | Ga0207661_10530458 | |||
| 1177 | Ga0207661_10557639 | |||
| 1178 | Ga0207679_10216486 | |||
| 1179 | Ga0207679_10237324 | |||
| 1180 | Ga0207667_10212261 | |||
| 1181 | Ga0207667_10287954 | |||
| 1182 | Ga0207651_10841634 | |||
| 1183 | Ga0207640_10105079 | |||
| 1184 | Ga0207677_10067136 | |||
| 1185 | Ga0207677_10263742 | |||
| 1186 | Ga0207703_10362348 | |||
| 1187 | Ga0207703_10435679 | |||
| 1188 | Ga0207703_10879454 | |||
| 1189 | Ga0207639_10081154 | |||
| 1190 | Ga0207678_10013141 | |||
| 1191 | Ga0207678_10023957 | |||
| 1192 | Ga0207708_10029675 | |||
| 1193 | Ga0207702_10131178 | |||
| 1194 | Ga0207702_10133041 | |||
| 1195 | Ga0207702_10147687 | |||
| 1196 | Ga0207702_10169821 | |||
| 1197 | Ga0207702_10283456 | |||
| 1198 | Ga0207641_10128559 | |||
| 1199 | Ga0207641_10169932 | |||
| 1200 | Ga0207641_10763465 | |||
| 1201 | Ga0207676_10075198 | |||
| 1202 | Ga0207676_10095761 | |||
| 1203 | Ga0207674_10044680 | |||
| 1204 | Ga0207674_10053348 | |||
| 1205 | Ga0207674_10058820 | |||
| 1206 | Ga0207674_10058879 | |||
| 1207 | Ga0207675_100015848 | |||
| 1208 | Ga0207683_10081725 | |||
| 1209 | Ga0207698_10187060 | |||
| 1210 | Ga0207698_10604796 | |||
| 1211 | Ga0207428_10388682 | |||
| 1212 | Ga0268266_10063049 | |||
| 1213 | Ga0268266_10245973 | |||
| 1214 | Ga0268266_10827569 | |||
| 1215 | Ga0268266_11129461 | |||
| 1216 | Ga0265326_10014033 | |||
| 1217 | Ga0265319_1002350 | |||
| 1218 | Ga0265334_10001287 | |||
| 1219 | Ga0265322_10119163 | |||
| 1220 | Ga0265336_10031700 | |||
| 1221 | Ga0265336_10074240 | |||
| 1222 | Ga0265338_10001268 | |||
| 1223 | Ga0265338_10008494 | |||
| 1224 | Ga0265338_10441864 | |||
| 1225 | Ga0265332_10000806 | |||
| 1226 | Ga0265320_10092882 | |||
| 1227 | Ga0265325_10023840 | |||
| 1228 | Ga0265340_10012110 | |||
| 1229 | Ga0265339_10107959 | |||
| 1230 | Ga0265333_100268 | |||
| 1231 | Ga0265316_10121623 | |||
| 1232 | Ga0307513_10080990 | |||
| 1233 | Ga0265314_10006319 | |||
| 1234 | Ga0265342_10007542 | |||
| 1235 | Ga0316214_1005909 | |||
| 1236 | Ga0316214_1019900 | |||
| 1237 | Ga0373930_0020965 | |||
| 1238 | Ga0373950_0038877 | |||
| 1239 | Ga0373959_0023760 | |||
| 1240 | Ga0373938_0019607 | |||
| 1241 | Ga0373938_0040393 | |||
| 1242 | Ga0373926_0001134 | |||
| 1243 | Ga0373926_0022191 | |||
| 1244 | Ga0373926_0041652 | |||
| 1245 | Ga0373926_0071754 | |||
| 1246 | Ga0373926_0121345 | |||
| 1247 | Ga0373926_0223889 | |||
| 1248 | Ga0373928_0002714 | |||
| 1249 | Ga0373929_0003272 | |||
| 1250 | Ga0373934_0000108 | |||
| 1251 | Ga0373934_0013193 | |||
| 1252 | Ga0373934_0027248 | |||
| 1253 | Ga0373934_0041723 | |||
| 1254 | Ga0373940_0006912 | |||
| 1255 | Ga0373940_0009897 | |||
| 1256 | Ga0373944_0000289 | |||
| 1257 | Ga0373949_0029974 | |||
| 1258 | Ga0373949_0111868 | |||
| 1259 | Ga0373952_0069798 | |||
| 1260 | Ga0373923_0000440 | |||
| 1261 | Ga0373923_0040322 | |||
| 1262 | Ga0373923_0057383 | |||
| 1263 | Ga0373923_0064270 | |||
| 1264 | Ga0373932_0025734 | |||
| 1265 | Ga0373932_0059220 | |||
| 1266 | Ga0373936_0012254 | |||
| 1267 | Ga0373936_0013551 | |||
| 1268 | Ga0373939_0022213 | |||
| 1269 | Ga0373941_0006307 | |||
| 1270 | Ga0373941_0062504 | |||
| 1271 | Ga0373945_0003403 | |||
| 1272 | Ga0373945_0046394 | |||
| 1273 | Ga0373945_0098883 | |||
| 1274 | Ga0373953_0000094 | |||
| 1275 | Ga0373953_0014394 | |||
| 1276 | Ga0373954_0017488 | |||
| 1277 | Ga0373954_0049604 | |||
| 1278 | Ga0373954_0055917 | |||
| 1279 | Ga0373954_0080796 | |||
| 1280 | Ga0373954_0166850 | |||
| 1281 | Ga0373956_0001194 | |||
| 1282 | Ga0373956_0023529 | |||
| 1283 | Ga0373956_0039119 | |||
| 1284 | Ga0373956_0073006 | |||
| 1285 | Ga0373957_0000166 | |||
| 1286 | Ga0373957_0017140 | |||
| 1287 | Ga0373957_0029204 | |||
| 1288 | Ga0373957_0184407 | |||
| 1289 | Ga0373957_0244383 | |||
| 1290 | Ga0373960_0005964 | |||
| 1291 | Ga0373960_0011035 | |||
| 1292 | Ga0373943_0010430 | |||
| 1293 | Ga0373943_0010566 | |||
| 1294 | Ga0373943_0040749 | |||
| 1295 | Ga0373943_0215177 | |||
| 1296 | Ga0373943_0305977 | |||
| 1297 | Ga0373946_0000253 | |||
| 1298 | Ga0373946_0000665 | |||
| 1299 | Ga0373955_0000112 | |||
| 1300 | Ga0373955_0016168 | |||
| 1301 | Ga0373955_0034753 | |||
| 1302 | Ga0373955_0036781 | |||
| 1303 | Ga0373955_0149199 | |||
| 1304 | Ga0373942_0008613 | |||
| 1305 | Ga0373942_0014666 | |||
| 1306 | Ga0373924_0000211 | |||
| 1307 | Ga0373924_0036499 | |||
| 1308 | Ga0373924_0060595 | |||
| 1309 | Ga0373924_0070876 | |||
| 1310 | Ga0373924_0124105 | |||
| 1311 | Ga0373931_0025020 | |||
| 1312 | Ga0373931_0057950 | |||
| 1313 | Ga0373935_0000970 | |||
| 1314 | Ga0373935_0069952 | |||
| 1315 | Ga0373935_0146207 | |||
| 1316 | Ga0373935_0159764 | |||
| 1317 | Ga0373935_0327343 | |||
| 1318 | Ga0373935_0327790 | |||
| 1319 | Ga0373927_0003427 | |||
| 1320 | Ga0373927_0008071 | |||
| 1321 | Ga0373927_0051612 | |||
| 1322 | Ga0373927_0082711 | |||
| 1323 | Ga0373927_0145110 | |||
| 1324 | Ga0373927_0536300 | |||
| 1325 | Ga0373933_0000022 | |||
| 1326 | Ga0373933_0008118 | |||
| 1327 | Ga0373933_0009952 | |||
| 1328 | Ga0373933_0010723 | |||
| 1329 | Ga0373933_0015930 | |||
| 1330 | Ga0373933_0041424 | |||
| 1331 | Ga0373933_0125134 | |||
| 1332 | Ga0373933_0215671 | |||
| 1333 | Ga0373947_0000006 | |||
| 1334 | Ga0373947_0001275 | |||
| 1335 | Ga0373947_0100360 | |||
| 1336 | Ga0373947_0136977 | |||
| 1337 | Ga0373947_0188985 | |||
| 1338 | Ga0373937_0000022 | |||
| 1339 | Ga0373937_0008926 | |||
| 1340 | Ga0373937_0021822 | |||
| 1341 | Ga0373937_0031743 | |||
| 1342 | Ga0373937_0067715 | |||
| 1343 | Ga0373937_0082709 | |||
| 1344 | Ga0373937_0091797 | |||
| 1345 | Ga0372808_001444 | |||
| 1346 | Ga0373925_0026273 | |||
| 1347 | Ga0373925_0035770 | |||
| 1348 | Ga0373925_0082951 | |||
| 1349 | Ga0373925_0100820 | |||
| 1350 | Ga0373925_0388852 | |||
| 1351 | Ga0373925_0940153 | |||
| 1352 | Ga0395898_0082286 | |||
| 1353 | Ga0436364_0037108 | |||
| 1354 | Ga0436364_0261597 | |||
| 1355 | Ga0436364_0287557 | |||
| 1356 | Ga0436364_0939371 | |||
| 1357 | Ga0436364_1104976 | |||
| 1358 | Ga0436364_1228585 | |||
| 1359 | Ga0436360_0208988 | |||
| 1360 | Ga0436363_0334125 | |||
| 1361 | Ga0436363_0902303 | |||
| 1362 | Ga0436362_1163076 | |||
| 1363 | Ga0466967_0386297 | |||
| 1364 | Ga0495592_0000025 | |||
| 1365 | Ga0495592_0021532 | |||
| 1366 | Ga0495592_0041359 | |||
| 1367 | Ga0495592_0085010 | |||
| 1368 | Ga0495592_0314287 | |||
| 1369 | Ga0495592_0547723 | |||
| 1370 | Ga0495603_0005042 | |||
| 1371 | Ga0495603_0127411 | |||
| 1372 | Ga0495629_0002510 | |||
| 1373 | Ga0495629_0128252 | |||
| 1374 | Ga0495629_0144145 | |||
| 1375 | Ga0495629_0335007 | |||
| 1376 | Ga0495629_0475182 | |||
| 1377 | Ga0495641_0023745 | |||
| 1378 | Ga0495641_0025292 | |||
| 1379 | Ga0495641_0033918 | |||
| 1380 | Ga0495641_0060163 | |||
| 1381 | Ga0495651_0000014 | |||
| 1382 | Ga0495651_0007180 | |||
| 1383 | Ga0495651_0021944 | |||
| 1384 | Ga0495651_0028505 | |||
| 1385 | Ga0495651_0042434 | |||
| 1386 | Ga0495651_0048290 | |||
| 1387 | Ga0495651_0088658 | |||
| 1388 | Ga0495651_0143650 | |||
| 1389 | Ga0495653_0014717 | |||
| 1390 | Ga0495653_0016957 | |||
| 1391 | Ga0495653_0026663 | |||
| 1392 | Ga0495653_0043271 | |||
| 1393 | Ga0495653_0044783 | |||
| 1394 | Ga0495653_0045692 | |||
| 1395 | Ga0495653_0046178 | |||
| 1396 | Ga0495653_0063155 | |||
| 1397 | Ga0495653_0078687 | |||
| 1398 | Ga0495653_0119616 | |||
| 1399 | Ga0495580_0172773 | |||
| 1400 | Ga0495580_0338896 | |||
| 1401 | Ga0495582_0018083 | |||
| 1402 | Ga0495582_0045935 | |||
| 1403 | Ga0495582_0112136 | |||
| 1404 | Ga0495639_0003951 | |||
| 1405 | Ga0495639_0378547 | |||
| 1406 | Ga0495639_0464978 | |||
| 1407 | Ga0495662_0000415 | |||
| 1408 | Ga0495662_0020737 | |||
| 1409 | Ga0495662_0048126 | |||
| 1410 | Ga0495662_0073669 | |||
| 1411 | Ga0495662_0075897 | |||
| 1412 | Ga0495662_0154573 | |||
| 1413 | Ga0495662_0166289 | |||
| 1414 | Ga0495664_0008128 | |||
| 1415 | Ga0495664_0029022 | |||
| 1416 | Ga0495664_0120739 | |||
| 1417 | Ga0495664_0125558 | |||
| 1418 | Ga0495594_0047095 | |||
| 1419 | Ga0495594_0124249 | |||
| 1420 | Ga0495608_0000190 | |||
| 1421 | Ga0495608_0028031 | |||
| 1422 | Ga0495608_0028686 | |||
| 1423 | Ga0495608_0033081 | |||
| 1424 | Ga0495608_0070311 | |||
| 1425 | Ga0495608_0129896 | |||
| 1426 | Ga0495608_0140027 | |||
| 1427 | Ga0495608_0208713 | |||
| 1428 | Ga0495618_0023599 | |||
| 1429 | Ga0495618_0033244 | |||
| 1430 | Ga0495618_0255303 | |||
| 1431 | Ga0495628_0000346 | |||
| 1432 | Ga0495628_0096929 | |||
| 1433 | Ga0495628_0100836 | |||
| 1434 | Ga0495628_0137232 | |||
| 1435 | Ga0495628_0190508 | |||
| 1436 | Ga0495628_0304756 | |||
| 1437 | Ga0495628_0340798 | |||
| 1438 | Ga0495630_0079683 | |||
| 1439 | Ga0495630_0142407 | |||
| 1440 | Ga0495630_0153212 | |||
| 1441 | Ga0495666_0036493 | |||
| 1442 | Ga0495666_0401726 | |||
| 1443 | Ga0495652_0009488 | |||
| 1444 | Ga0495652_0010242 | |||
| 1445 | Ga0495652_0030510 | |||
| 1446 | Ga0495652_0038016 | |||
| 1447 | Ga0495652_0079960 | |||
| 1448 | Ga0495652_0091033 | |||
| 1449 | Ga0495652_0130949 | |||
| 1450 | Ga0495652_0266493 | |||
| 1451 | Ga0495652_0467933 | |||
| 1452 | Ga0495652_0621910 | |||
| 1453 | Ga0495665_0000524 | |||
| 1454 | Ga0495665_0014274 | |||
| 1455 | Ga0495665_0015164 | |||
| 1456 | Ga0495665_0109107 | |||
| 1457 | Ga0495640_0002533 | |||
| 1458 | Ga0495640_0030276 | |||
| 1459 | Ga0495640_0040272 | |||
| 1460 | Ga0495640_0046332 | |||
| 1461 | Ga0495640_0048094 | |||
| 1462 | Ga0495640_0095045 | |||
| 1463 | Ga0495640_0237811 | |||
| 1464 | Ga0495586_0006410 | |||
| 1465 | Ga0495586_0097256 | |||
| 1466 | Ga0495586_0466895 | |||
| 1467 | Ga0495587_0000029 | |||
| 1468 | Ga0495587_0006950 | |||
| 1469 | Ga0495587_0012669 | |||
| 1470 | Ga0495587_0081467 | |||
| 1471 | Ga0495587_0111654 | |||
| 1472 | Ga0495587_0128291 | |||
| 1473 | Ga0495587_0269542 | |||
| 1474 | Ga0495645_0022525 | |||
| 1475 | Ga0495645_0033757 | |||
| 1476 | Ga0495645_0113797 | |||
| 1477 | Ga0495645_0128315 | |||
| 1478 | Ga0495645_0181273 | |||
| 1479 | Ga0495645_0300157 | |||
| 1480 | Ga0495667_0000036 | |||
| 1481 | Ga0495667_0000607 | |||
| 1482 | Ga0495667_0001443 | |||
| 1483 | Ga0495667_0011226 | |||
| 1484 | Ga0495667_0127393 | |||
| 1485 | Ga0495667_0308849 | |||
| 1486 | Ga0495667_0315536 | |||
| 1487 | Ga0495634_0030816 | |||
| 1488 | Ga0495634_0044601 | |||
| 1489 | Ga0495634_0069302 | |||
| 1490 | Ga0495634_0079689 | |||
| 1491 | Ga0495634_0084894 | |||
| 1492 | Ga0495634_0098423 | |||
| 1493 | Ga0495635_0000666 | |||
| 1494 | Ga0495635_0004586 | |||
| 1495 | Ga0495635_0008790 | |||
| 1496 | Ga0495635_0017383 | |||
| 1497 | Ga0495635_0038965 | |||
| 1498 | Ga0495635_0110970 | |||
| 1499 | Ga0495588_0058930 | |||
| 1500 | Ga0495657_0000071 | |||
| 1501 | Ga0495657_0004781 | |||
| 1502 | Ga0495657_0008636 | |||
| 1503 | Ga0495657_0038498 | |||
| 1504 | Ga0495657_0044277 | |||
| 1505 | Ga0495657_0052598 | |||
| 1506 | Ga0495599_0000094 | |||
| 1507 | Ga0495599_0010549 | |||
| 1508 | Ga0495599_0025290 | |||
| 1509 | Ga0495599_0045618 | |||
| 1510 | Ga0495599_0075935 | |||
| 1511 | Ga0495599_0088526 | |||
| 1512 | Ga0495599_0373501 | |||
| 1513 | Ga0495623_0000113 | |||
| 1514 | Ga0495623_0067661 | |||
| 1515 | Ga0495623_0073363 | |||
| 1516 | Ga0495623_0126899 | |||
| 1517 | Ga0495646_0008387 | |||
| 1518 | Ga0495646_0031995 | |||
| 1519 | Ga0495646_0079454 | |||
| 1520 | Ga0495646_0169645 | |||
| 1521 | Ga0495647_0019101 | |||
| 1522 | Ga0495647_0032534 | |||
| 1523 | Ga0495658_0003156 | |||
| 1524 | Ga0495658_0246658 | |||
| 1525 | Ga0495613_0155947 | |||
| 1526 | Ga0495624_0003337 | |||
| 1527 | Ga0495624_0026797 | |||
| 1528 | Ga0495624_0051450 | |||
| 1529 | Ga0495600_0056648 | |||
| 1530 | Ga0495600_0074984 | |||
| 1531 | Ga0495600_0430895 | |||
| 1532 | Ga0495581_0000903 | |||
| 1533 | Ga0495581_0187254 | |||
| 1534 | Ga0495581_0282435 | |||
| 1535 | Ga0495604_0000044 | |||
| 1536 | Ga0495604_0023045 | |||
| 1537 | Ga0495604_0115051 | |||
| 1538 | Ga0495604_0145466 | |||
| 1539 | Ga0495604_0253470 | |||
| 1540 | Ga0495604_0300080 | |||
| 1541 | Ga0495674_0000044 | |||
| 1542 | Ga0495674_0020966 | |||
| 1543 | Ga0495674_0057081 | |||
| 1544 | Ga0495674_0059918 | |||
| 1545 | Ga0495674_0145173 | |||
| 1546 | Ga0495674_0171184 | |||
| 1547 | Ga0495676_0008527 | |||
| 1548 | Ga0495676_0058852 | |||
| 1549 | Ga0495676_0158664 | |||
| 1550 | Ga0495680_0000219 | |||
| 1551 | Ga0495680_0008298 | |||
| 1552 | Ga0495680_0009686 | |||
| 1553 | Ga0495680_0017665 | |||
| 1554 | Ga0495680_0018149 | |||
| 1555 | Ga0495680_0043101 | |||
| 1556 | Ga0495680_0048768 | |||
| 1557 | Ga0495680_0192560 | |||
| 1558 | Ga0495680_0349093 | |||
| 1559 | Ga0495675_0002157 | |||
| 1560 | Ga0495675_0004181 | |||
| 1561 | Ga0495675_0023500 | |||
| 1562 | Ga0495675_0056484 | |||
| 1563 | Ga0495675_0098618 | |||
| 1564 | Ga0495684_0000962 | |||
| 1565 | Ga0495684_0019115 | |||
| 1566 | Ga0495684_0023643 | |||
| 1567 | Ga0495684_0045001 | |||
| 1568 | Ga0495684_0047586 | |||
| 1569 | Ga0495684_0058044 | |||
| 1570 | Ga0495684_0064779 | |||
| 1571 | Ga0495684_0367508 | |||
| 1572 | Ga0495593_0013529 | |||
| 1573 | Ga0495593_0063625 | |||
| 1574 | Ga0495593_0123293 | |||
| 1575 | Ga0495593_0484999 | |||
| 1576 | Ga0495602_0000480 | |||
| 1577 | Ga0495602_0011445 | |||
| 1578 | Ga0495602_0051492 | |||
| 1579 | Ga0495602_0081676 | |||
| 1580 | Ga0495602_0130961 | |||
| 1581 | Ga0495602_0144692 | |||
| 1582 | Ga0495602_0314385 | |||
| 1583 | Ga0495602_0436655 | |||
| 1584 | Ga0495614_0005646 | |||
| 1585 | Ga0496100_0069654 | |||
| 1586 | Ga0496100_0380351 | |||
| 1587 | Ga0496100_0642941 | |||
| 1588 | Ga0496101_0081580 | |||
| 1589 | Ga0496101_0139003 | |||
| 1590 | Ga0496102_0026222 | |||
| 1591 | Ga0496102_0082077 | |||
| 1592 | Ga0496102_1043812 | |||
| 1593 | Ga0496103_0112067 | |||
| 1594 | Ga0496104_0000937 | |||
| 1595 | Ga0496104_0008559 | |||
| 1596 | Ga0496104_0226081 | |||
| 1597 | Ga0496105_0004650 | |||
| 1598 | Ga0496105_0039198 | |||
| 1599 | Ga0496105_0039664 | |||
| 1600 | Ga0496105_0141738 | |||
| 1601 | Ga0496105_0532042 | |||
| 1602 | Ga0496106_0084617 | |||
| 1603 | Ga0496106_0460027 | |||
| 1604 | Ga0496107_0243041 | |||
| 1605 | Ga0496107_0550371 | |||
| 1606 | Ga0496108_0013818 | |||
| 1607 | Ga0496108_0018374 | |||
| 1608 | Ga0496108_0329259 | |||
| 1609 | Ga0496108_0334223 | |||
| 1610 | Ga0496109_0282136 | |||
| 1611 | Ga0496110_0008342 | |||
| 1612 | Ga0496110_0020460 | |||
| 1613 | Ga0496110_0175364 | |||
| 1614 | Ga0496110_0402202 | |||
| 1615 | Ga0496110_1027197 | |||
| 1616 | Ga0496111_0050441 | |||
| 1617 | Ga0496111_0089111 | |||
| 1618 | Ga0496112_0000856 | |||
| 1619 | Ga0496112_0321594 | |||
| 1620 | Ga0496112_0379829 | |||
| 1621 | Ga0496113_0002091 | |||
| 1622 | Ga0496113_0060684 | |||
| 1623 | Ga0496113_0237122 | |||
| 1624 | Ga0496114_0115280 | |||
| 1625 | Ga0496114_0116764 | |||
| 1626 | Ga0496114_0426917 | |||
| 1627 | Ga0496114_0734777 | |||
| 1628 | Ga0496115_0010010 | |||
| 1629 | Ga0496115_0103986 | |||
| 1630 | Ga0496115_0208692 | |||
| 1631 | Ga0496115_0454258 | |||
| 1632 | Ga0496126_0073104 | |||
| 1633 | Ga0496126_0119671 | |||
| 1634 | Ga0496126_0385488 | |||
| 1635 | nmdc:mga05p37_17739_c1 | |||
| 1636 | nmdc:mga08y16_281472_c1 | |||
| 1637 | nmdc:mga0n895_431931_c1 | |||
| 1638 | nmdc:mga0rr50_412662_c1 | |||
| 1639 | nmdc:mga0rr50_479843_c1 | |||
| 1640 | nmdc:mga08x19_153879_c1 | |||
| 1641 | nmdc:mga08x19_158074_c1 | |||
| 1642 | nmdc:mga08x19_361036_c1 | |||
| 1643 | nmdc:mga08x19_567600_c1 | |||
| 1644 | nmdc:mga08x19_932844_c1 | |||
| 1645 | nmdc:mga0a205_268338_c1 | |||
| 1646 | nmdc:mga0a205_328002_c1 | |||
| 1647 | Ga0495601_0093640 | |||
| 1648 | Ga0495601_0301055 | |||
| 1649 | Ga0495601_0416969 | |||
| 1650 | Ga0495601_0463444 | |||
| 1651 | Ga0495612_0023842 | |||
| 1652 | Ga0495612_0047110 | |||
| 1653 | Ga0495612_0056807 | |||
| 1654 | Ga0495595_0002659 | |||
| 1655 | Ga0495595_0019682 | |||
| 1656 | Ga0495595_0024477 | |||
| 1657 | Ga0495619_0018796 | |||
| 1658 | Ga0495619_0131015 | |||
| 1659 | Ga0495619_0196856 | |||
| 1660 | Ga0495619_0216579 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rds-assembly1.cif.gz_A | structure of human nthl1 | 0.7904 | 21 | 132 |
| 7rdt-assembly1.cif.gz_A | structure of human nthl1 - linker 1 chimera | 0.7727 | 21 | 134 |
| 4ypr-assembly1.cif.gz_A | crystal structure of d144n muty bound to its anti-substrate | 0.7671 | 19 | 137 |
| 1ngn-assembly1.cif.gz_A | mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4 | 0.7602 | 15 | 133 |
| 8dwf-assembly1.cif.gz_A | glycosylase muty variant e43s in complex with dna containing d(8-oxo-g) paired with substrate adenine | 0.7576 | 19 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JZX0_85_197_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8392 | 22 | 132 | 1.10.340.30 |
| af_Q58829_25_138_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8089 | 21 | 132 | 1.10.340.30 |
| af_K7MWZ4_17_115_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8021 | 22 | 111 | 1.10.340.30 |
| af_Q58030_26_127_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.7907 | 21 | 132 | 1.10.340.30 |
| af_P0AB83_21_132_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.7905 | 20 | 144 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2FY59-F1-model_v4 | Fe-S cluster assembly protein HesB | 0.9949 | 4 | 190 |
GO:0003824
GO:0006281 |
| AF-A0A6B3CYA7-F1-model_v4 | Fe-S cluster assembly protein HesB | 0.9948 | 5 | 88 |
GO:0003824
GO:0006281 |
| AF-A0A397QJ74-F1-model_v4 | deleted | 0.9946 | 4 | 171 |
|
| AF-A0A4V6AXU0-F1-model_v4 | Fe-S cluster assembly protein HesB | 0.9933 | 4 | 190 |
GO:0003824
GO:0006284 |
| AF-A0A1H4VCL2-F1-model_v4 | Uncharacterized HhH-GPD family protein | 0.9928 | 4 | 190 |
GO:0003824
GO:0006284 |