F482517

General Info

Members Datasets Scaffolds Average Seq Length
827 201 1654 159

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10150825|Ga0207678_101508251
Length 156
Sequence MATLITAETAKFALHVAHGKLAGFDVGTKTVGVAICDAGWHFAGPLETIRRTKFTQDLAALRAIIIREHIVGLVIGLPLNMDGSDSPRTQSTRAFARNLETPFGLPILLWDERWSTQAVTRTLIDADASRARRAELVDKMAAAYILQGAIDALCMG

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10150825 3300026067 Bacteria 1985
2 JGI24736J21556_1006316 3300001904 Bacteria 1994
3 JGI24741J21665_1000431 3300001915 Bacteria 12681
4 JGI24740J21852_10007349 3300001979 Bacteria 4483
5 JGI24740J21852_10024508 3300001979 Bacteria 2046
6 JGI24740J21852_10024611 3300001979 Bacteria 2041
7 JGI24740J21852_10030124 3300001979 Bacteria 1772
8 JGI24740J21852_10037718 3300001979 Bacteria 1489
9 JGI24739J22299_10018852 3300001989 Bacteria 2475
10 JGI24739J22299_10023182 3300001989 Bacteria 2196
11 JGI24739J22299_10024484 3300001989 Bacteria 2128
12 JGI24737J22298_10002777 3300001990 Bacteria 6198
13 JGI24737J22298_10002937 3300001990 Bacteria 6041
14 JGI24737J22298_10007611 3300001990 Bacteria 3651
15 JGI24737J22298_10009306 3300001990 Bacteria 3273
16 JGI24735J21928_10005125 3300002067 Bacteria 4362
17 JGI24735J21928_10061113 3300002067 Bacteria 1082
18 JGI24738J21930_10005729 3300002075 Bacteria 2956
19 JGI24738J21930_10014966 3300002075 Bacteria 1656
20 Ga0065715_10268661 3300005293 Bacteria 1117
21 Ga0070658_10000453 3300005327 Bacteria 35538
22 Ga0070658_10008029 3300005327 Bacteria 8487
23 Ga0070658_10048009 3300005327 Bacteria 3456
24 Ga0070658_10053125 3300005327 Bacteria 3288
25 Ga0070658_10106256 3300005327 Bacteria 2322
26 Ga0070658_10175529 3300005327 Bacteria 1802
27 Ga0070658_10570838 3300005327 Bacteria 979
28 Ga0070658_10592633 3300005327 Bacteria 960
29 Ga0070658_11217679 3300005327 Bacteria 654
30 Ga0070658_11529069 3300005327 Bacteria 579
31 Ga0070676_10085622 3300005328 Bacteria 1921
32 Ga0070676_10152244 3300005328 Bacteria 1481
33 Ga0070676_10699607 3300005328 Bacteria 740
34 Ga0070683_100015500 3300005329 Bacteria 6697
35 Ga0070683_100071890 3300005329 Bacteria 3228
36 Ga0070683_100078457 3300005329 Bacteria 3089
37 Ga0070683_100148477 3300005329 Bacteria 2222
38 Ga0070683_100873468 3300005329 Bacteria 862
39 Ga0070683_100890551 3300005329 Bacteria 854
40 Ga0070690_100094817 3300005330 Bacteria 1969
41 Ga0070670_100005622 3300005331 Bacteria 10577
42 Ga0070670_100016759 3300005331 Bacteria 6288
43 Ga0070670_100029828 3300005331 Bacteria 4697
44 Ga0068869_100016057 3300005334 Bacteria 5040
45 Ga0068869_100040081 3300005334 Bacteria 3347
46 Ga0068869_100437698 3300005334 Bacteria 1082
47 Ga0070666_10001156 3300005335 Bacteria 16024
48 Ga0070666_10011825 3300005335 Bacteria 5487
49 Ga0070666_10235778 3300005335 Bacteria 1293
50 Ga0070666_10586393 3300005335 Bacteria 813
51 Ga0070666_10977316 3300005335 Bacteria 627
52 Ga0070680_100004052 3300005336 Bacteria 10965
53 Ga0070680_100007567 3300005336 Bacteria 8282
54 Ga0070680_100023246 3300005336 Bacteria 4942
55 Ga0070680_100084682 3300005336 Bacteria 2618
56 Ga0070680_100097263 3300005336 Bacteria 2441
57 Ga0070680_100133954 3300005336 Bacteria 2074
58 Ga0070680_100139505 3300005336 Bacteria 2032
59 Ga0070680_100337302 3300005336 Bacteria 1281
60 Ga0070682_100075091 3300005337 Bacteria 2173
61 Ga0070682_101205617 3300005337 Bacteria 639
62 Ga0068868_100007723 3300005338 Bacteria 7674
63 Ga0068868_100528503 3300005338 Bacteria 1037
64 Ga0068868_101538432 3300005338 Bacteria 624
65 Ga0070660_100000488 3300005339 Bacteria 26536
66 Ga0070660_100005858 3300005339 Bacteria 8508
67 Ga0070660_100022777 3300005339 Bacteria 4638
68 Ga0070660_100110223 3300005339 Bacteria 2189
69 Ga0070660_100338766 3300005339 Bacteria 1237
70 Ga0070660_100338898 3300005339 Bacteria 1237
71 Ga0070660_100422730 3300005339 Bacteria 1104
72 Ga0070660_100481314 3300005339 Bacteria 1031
73 Ga0070660_100835142 3300005339 Bacteria 776
74 Ga0070660_101081477 3300005339 Bacteria 678
75 Ga0070691_10003847 3300005341 Bacteria 6781
76 Ga0070691_10031783 3300005341 Bacteria 2477
77 Ga0070687_100635640 3300005343 Bacteria 738
78 Ga0070661_100000311 3300005344 Bacteria 39261
79 Ga0070661_100026847 3300005344 Bacteria 4144
80 Ga0070661_100029695 3300005344 Bacteria 3947
81 Ga0070661_100127645 3300005344 Bacteria 1909
82 Ga0070661_100128467 3300005344 Bacteria 1902
83 Ga0070661_100254008 3300005344 Bacteria 1357
84 Ga0070661_100569666 3300005344 Bacteria 913
85 Ga0070692_10001342 3300005345 Bacteria 8869
86 Ga0070692_10059316 3300005345 Bacteria 2011
87 Ga0070668_100022568 3300005347 Bacteria 4758
88 Ga0070668_100072861 3300005347 Bacteria 2677
89 Ga0070668_100073517 3300005347 Bacteria 2665
90 Ga0070669_100008762 3300005353 Bacteria 7219
91 Ga0070669_100011288 3300005353 Bacteria 6342
92 Ga0070669_100031470 3300005353 Bacteria 3832
93 Ga0070669_100063933 3300005353 Bacteria 2709
94 Ga0070669_100358784 3300005353 Bacteria 1185
95 Ga0070675_100132798 3300005354 Bacteria 2123
96 Ga0070675_100286987 3300005354 Bacteria 1448
97 Ga0070671_100007873 3300005355 Bacteria 8519
98 Ga0070671_100086458 3300005355 Bacteria 2623
99 Ga0070674_100004662 3300005356 Bacteria 7834
100 Ga0070674_100089368 3300005356 Bacteria 2219
101 Ga0070674_100332633 3300005356 Bacteria 1221
102 Ga0070673_100006519 3300005364 Bacteria 7592
103 Ga0070673_100010672 3300005364 Bacteria 6229
104 Ga0070673_100084369 3300005364 Bacteria 2583
105 Ga0070673_100192036 3300005364 Bacteria 1754
106 Ga0070673_100397862 3300005364 Bacteria 1231
107 Ga0070659_100000594 3300005366 Bacteria 26514
108 Ga0070659_100002859 3300005366 Bacteria 12291
109 Ga0070659_100005258 3300005366 Bacteria 9287
110 Ga0070659_100015083 3300005366 Bacteria 5779
111 Ga0070659_100018550 3300005366 Bacteria 5250
112 Ga0070659_100020293 3300005366 Bacteria 5046
113 Ga0070659_100029854 3300005366 Bacteria 4215
114 Ga0070659_100036764 3300005366 Bacteria 3817
115 Ga0070659_100047564 3300005366 Bacteria 3365
116 Ga0070659_100074184 3300005366 Bacteria 2710
117 Ga0070659_100076841 3300005366 Bacteria 2662
118 Ga0070659_100480810 3300005366 Bacteria 1057
119 Ga0070659_100775956 3300005366 Bacteria 832
120 Ga0070659_101258102 3300005366 Bacteria 655
121 Ga0070667_100004431 3300005367 Bacteria 11849
122 Ga0070667_100006873 3300005367 Bacteria 9455
123 Ga0070667_100206024 3300005367 Bacteria 1746
124 Ga0070667_100656282 3300005367 Bacteria 969
125 Ga0070709_10121355 3300005434 Bacteria 1772
126 Ga0070714_100089556 3300005435 Bacteria 2694
127 Ga0070714_100146211 3300005435 Bacteria 2126
128 Ga0070714_100251376 3300005435 Bacteria 1634
129 Ga0070713_100273403 3300005436 Bacteria 1548
130 Ga0070713_101129604 3300005436 Bacteria 758
131 Ga0070710_10806426 3300005437 Bacteria 671
132 Ga0070694_100012045 3300005444 Bacteria 5370
133 Ga0070663_100027460 3300005455 Bacteria 3866
134 Ga0070663_100069881 3300005455 Bacteria 2553
135 Ga0070663_100071789 3300005455 Bacteria 2520
136 Ga0070663_100134626 3300005455 Bacteria 1880
137 Ga0070663_100241861 3300005455 Bacteria 1425
138 Ga0070678_100788709 3300005456 Bacteria 862
139 Ga0070662_100000198 3300005457 Bacteria 35360
140 Ga0070662_100001444 3300005457 Bacteria 14651
141 Ga0070662_100003480 3300005457 Bacteria 9817
142 Ga0070662_100007528 3300005457 Bacteria 7063
143 Ga0070662_100039993 3300005457 Bacteria 3337
144 Ga0070662_100197427 3300005457 Bacteria 1595
145 Ga0070662_100291414 3300005457 Bacteria 1323
146 Ga0070662_100362901 3300005457 Bacteria 1189
147 Ga0070662_100766547 3300005457 Bacteria 819
148 Ga0070662_101429584 3300005457 Bacteria 596
149 Ga0070681_10008046 3300005458 Bacteria 10320
150 Ga0070681_10027032 3300005458 Bacteria 5769
151 Ga0068867_100005601 3300005459 Bacteria 8899
152 Ga0068867_100028368 3300005459 Bacteria 4030
153 Ga0070679_100032931 3300005530 Bacteria 5130
154 Ga0070679_100090052 3300005530 Bacteria 3056
155 Ga0070679_100179201 3300005530 Bacteria 2092
156 Ga0070679_100266185 3300005530 Bacteria 1669
157 Ga0070684_100004782 3300005535 Bacteria 10345
158 Ga0070684_100202139 3300005535 Bacteria 1810
159 Ga0068853_100011705 3300005539 Bacteria 7129
160 Ga0068853_100023018 3300005539 Bacteria 5211
161 Ga0068853_100025355 3300005539 Bacteria 4974
162 Ga0068853_100032257 3300005539 Bacteria 4436
163 Ga0068853_100040393 3300005539 Bacteria 3980
164 Ga0068853_100117776 3300005539 Bacteria 2366
165 Ga0068853_100122536 3300005539 Bacteria 2321
166 Ga0068853_100139479 3300005539 Bacteria 2176
167 Ga0068853_100397464 3300005539 Bacteria 1289
168 Ga0068853_100443737 3300005539 Bacteria 1220
169 Ga0070672_100007480 3300005543 Bacteria 7416
170 Ga0070672_100029586 3300005543 Bacteria 4109
171 Ga0070672_100125140 3300005543 Bacteria 2108
172 Ga0070672_100843518 3300005543 Bacteria 808
173 Ga0070693_100000578 3300005547 Bacteria 16207
174 Ga0070693_100139060 3300005547 Bacteria 1526
175 Ga0070693_100238151 3300005547 Bacteria 1200
176 Ga0070693_100581844 3300005547 Bacteria 806
177 Ga0070665_100002788 3300005548 Bacteria 18950
178 Ga0070665_100026017 3300005548 Bacteria 5894
179 Ga0070665_100162523 3300005548 Bacteria 2235
180 Ga0070665_100180998 3300005548 Bacteria 2108
181 Ga0070665_100235521 3300005548 Bacteria 1831
182 Ga0068855_100003204 3300005563 Bacteria 20024
183 Ga0068855_100015492 3300005563 Bacteria 9179
184 Ga0068855_100032022 3300005563 Bacteria 6278
185 Ga0068855_100060354 3300005563 Bacteria 4435
186 Ga0068855_100065023 3300005563 Bacteria 4252
187 Ga0068855_100072455 3300005563 Bacteria 4004
188 Ga0068855_100165920 3300005563 Bacteria 2503
189 Ga0068855_100170245 3300005563 Bacteria 2467
190 Ga0068855_100179878 3300005563 Bacteria 2391
191 Ga0068855_100204320 3300005563 Bacteria 2223
192 Ga0068855_100535378 3300005563 Bacteria 1269
193 Ga0068855_100695336 3300005563 Bacteria 1089
194 Ga0068855_101097836 3300005563 Bacteria 832
195 Ga0068855_101420989 3300005563 Bacteria 714
196 Ga0070664_100000259 3300005564 Bacteria 38210
197 Ga0070664_100072002 3300005564 Bacteria 2963
198 Ga0070664_100082947 3300005564 Bacteria 2764
199 Ga0070664_100097901 3300005564 Bacteria 2547
200 Ga0070664_100151368 3300005564 Bacteria 2048
201 Ga0070664_100555631 3300005564 Bacteria 1062
202 Ga0070664_100654261 3300005564 Bacteria 977
203 Ga0070664_100810455 3300005564 Bacteria 876
204 Ga0068857_100012438 3300005577 Bacteria 7409
205 Ga0068857_100023284 3300005577 Bacteria 5451
206 Ga0068857_100068418 3300005577 Bacteria 3160
207 Ga0068857_100107528 3300005577 Bacteria 2505
208 Ga0068857_100108619 3300005577 Bacteria 2493
209 Ga0068857_100127525 3300005577 Bacteria 2293
210 Ga0068857_100134121 3300005577 Bacteria 2235
211 Ga0068854_100003755 3300005578 Bacteria 9493
212 Ga0068854_100007640 3300005578 Bacteria 6916
213 Ga0068854_100036835 3300005578 Bacteria 3431
214 Ga0068854_100058228 3300005578 Bacteria 2788
215 Ga0068854_100067819 3300005578 Bacteria 2600
216 Ga0068854_100068009 3300005578 Bacteria 2597
217 Ga0068854_100069136 3300005578 Bacteria 2577
218 Ga0068854_100159497 3300005578 Bacteria 1745
219 Ga0068854_100724304 3300005578 Bacteria 861
220 Ga0068854_101161210 3300005578 Bacteria 690
221 Ga0068856_100000315 3300005614 Bacteria 53098
222 Ga0068856_100028077 3300005614 Bacteria 5492
223 Ga0068856_100104718 3300005614 Bacteria 2824
224 Ga0068856_100137277 3300005614 Bacteria 2451
225 Ga0068856_100142103 3300005614 Bacteria 2407
226 Ga0068856_100218582 3300005614 Bacteria 1921
227 Ga0068856_100233056 3300005614 Bacteria 1856
228 Ga0068856_100444647 3300005614 Bacteria 1317
229 Ga0068856_100536764 3300005614 Bacteria 1191
230 Ga0068856_100648048 3300005614 Bacteria 1077
231 Ga0068856_100967844 3300005614 Bacteria 869
232 Ga0068856_101011159 3300005614 Bacteria 850
233 Ga0070702_101095609 3300005615 Bacteria 636
234 Ga0068852_100000548 3300005616 Bacteria 24613
235 Ga0068852_100002774 3300005616 Bacteria 12130
236 Ga0068852_100003431 3300005616 Bacteria 11074
237 Ga0068852_100004378 3300005616 Bacteria 9979
238 Ga0068852_100005550 3300005616 Bacteria 9044
239 Ga0068852_100005873 3300005616 Bacteria 8821
240 Ga0068852_100008118 3300005616 Bacteria 7705
241 Ga0068852_100031820 3300005616 Bacteria 4360
242 Ga0068852_100040743 3300005616 Bacteria 3921
243 Ga0068852_100149317 3300005616 Bacteria 2172
244 Ga0068852_100209496 3300005616 Bacteria 1848
245 Ga0068852_100258278 3300005616 Bacteria 1672
246 Ga0068852_100431213 3300005616 Bacteria 1302
247 Ga0068852_100499014 3300005616 Bacteria 1211
248 Ga0068852_101174109 3300005616 Bacteria 788
249 Ga0068859_100013088 3300005617 Bacteria 8336
250 Ga0068859_100048653 3300005617 Bacteria 4259
251 Ga0068859_100054070 3300005617 Bacteria 4038
252 Ga0068864_100008682 3300005618 Bacteria 8386
253 Ga0068864_100059371 3300005618 Bacteria 3309
254 Ga0068861_100078110 3300005719 Bacteria 2584
255 Ga0068851_10014634 3300005834 Bacteria 3726
256 Ga0068851_10121527 3300005834 Bacteria 1404
257 Ga0068851_10144850 3300005834 Bacteria 1295
258 Ga0068851_10324714 3300005834 Bacteria 890
259 Ga0068851_10451565 3300005834 Bacteria 764
260 Ga0068870_10204201 3300005840 Bacteria 1200
261 Ga0068863_100025387 3300005841 Bacteria 5649
262 Ga0068863_100126825 3300005841 Bacteria 2435
263 Ga0068858_100013411 3300005842 Bacteria 7735
264 Ga0068858_100048345 3300005842 Bacteria 3943
265 Ga0068858_100073197 3300005842 Bacteria 3181
266 Ga0068858_101681154 3300005842 Bacteria 627
267 Ga0068860_100028314 3300005843 Bacteria 5392
268 Ga0068860_100029169 3300005843 Bacteria 5308
269 Ga0068860_100146029 3300005843 Bacteria 2276
270 Ga0068860_100232533 3300005843 Bacteria 1791
271 Ga0068862_100027649 3300005844 Bacteria 4775
272 Ga0068862_100085865 3300005844 Bacteria 2735
273 Ga0070717_10901505 3300006028 Bacteria 805
274 Ga0070712_100009875 3300006175 Bacteria 6017
275 Ga0097621_100045977 3300006237 Bacteria 3529
276 Ga0097621_101143612 3300006237 Bacteria 732
277 Ga0068871_100040950 3300006358 Bacteria 3713
278 Ga0068871_100536191 3300006358 Bacteria 1058
279 Ga0068871_101104449 3300006358 Bacteria 741
280 Ga0075428_100482205 3300006844 Bacteria 1327
281 Ga0075433_10022921 3300006852 Bacteria 5248
282 Ga0075434_101431764 3300006871 Bacteria 701
283 Ga0068865_100630764 3300006881 Bacteria 909
284 Ga0097620_100013089 3300006931 Bacteria 8336
285 Ga0097620_100048654 3300006931 Bacteria 4259
286 Ga0097620_100054072 3300006931 Bacteria 4038
287 Ga0075435_100281381 3300007076 Bacteria 1420
288 Ga0105240_10030088 3300009093 Bacteria 7062
289 Ga0105240_10052381 3300009093 Bacteria 5132
290 Ga0105240_10058097 3300009093 Bacteria 4830
291 Ga0105240_10142637 3300009093 Bacteria 2862
292 Ga0105240_11046103 3300009093 Bacteria 871
293 Ga0105240_11555299 3300009093 Bacteria 693
294 Ga0105245_10012098 3300009098 Bacteria 7504
295 Ga0105245_10071148 3300009098 Bacteria 3158
296 Ga0105243_10574740 3300009148 Bacteria 1081
297 Ga0105241_10035964 3300009174 Bacteria 3726
298 Ga0105241_10248274 3300009174 Bacteria 1508
299 Ga0105241_10697590 3300009174 Bacteria 926
300 Ga0105242_11316461 3300009176 Bacteria 747
301 Ga0105248_10000395 3300009177 Bacteria 50389
302 Ga0105248_10051437 3300009177 Bacteria 4622
303 Ga0105248_11183828 3300009177 Bacteria 864
304 Ga0105237_10010105 3300009545 Bacteria 10063
305 Ga0105237_10045897 3300009545 Bacteria 4397
306 Ga0105237_11876867 3300009545 Bacteria 607
307 Ga0105238_10015405 3300009551 Bacteria 7737
308 Ga0105238_10019482 3300009551 Bacteria 6910
309 Ga0105238_10127071 3300009551 Bacteria 2528
310 Ga0105238_10282670 3300009551 Bacteria 1641
311 Ga0105238_10538596 3300009551 Bacteria 1171
312 Ga0105249_10023157 3300009553 Bacteria 5570
313 Ga0105249_10139940 3300009553 Bacteria 2320
314 Ga0105249_10646879 3300009553 Bacteria 1115
315 Ga0105239_10100845 3300010375 Bacteria 3194
316 Ga0105239_11424276 3300010375 Bacteria 800
317 Ga0105246_10040992 3300011119 Bacteria 3128
318 Ga0105246_10079424 3300011119 Bacteria 2333
319 Ga0105246_10079969 3300011119 Bacteria 2325
320 Ga0157373_10015573 3300013100 Bacteria 5558
321 Ga0157373_10019829 3300013100 Bacteria 4892
322 Ga0157373_10020405 3300013100 Bacteria 4816
323 Ga0157373_10053182 3300013100 Bacteria 2879
324 Ga0157373_10074207 3300013100 Bacteria 2400
325 Ga0157373_10205747 3300013100 Bacteria 1388
326 Ga0157373_10394928 3300013100 Bacteria 991
327 Ga0157373_10403615 3300013100 Bacteria 980
328 Ga0157371_10008334 3300013102 Bacteria 8272
329 Ga0157371_10030303 3300013102 Bacteria 3903
330 Ga0157371_10080039 3300013102 Bacteria 2314
331 Ga0157371_10103101 3300013102 Bacteria 2024
332 Ga0157371_10112225 3300013102 Bacteria 1935
333 Ga0157371_10139587 3300013102 Bacteria 1726
334 Ga0157371_10166819 3300013102 Bacteria 1573
335 Ga0157371_10340797 3300013102 Bacteria 1090
336 Ga0157371_10769456 3300013102 Bacteria 724
337 Ga0157370_10012433 3300013104 Bacteria 8825
338 Ga0157370_10020331 3300013104 Bacteria 6631
339 Ga0157370_10023427 3300013104 Bacteria 6128
340 Ga0157370_10028439 3300013104 Bacteria 5498
341 Ga0157370_10046054 3300013104 Bacteria 4183
342 Ga0157370_10091919 3300013104 Bacteria 2848
343 Ga0157370_10147590 3300013104 Bacteria 2189
344 Ga0157370_10164988 3300013104 Bacteria 2060
345 Ga0157370_10396370 3300013104 Bacteria 1271
346 Ga0157370_10681809 3300013104 Bacteria 938
347 Ga0157369_10005829 3300013105 Bacteria 14326
348 Ga0157369_10009810 3300013105 Bacteria 10953
349 Ga0157369_10027229 3300013105 Bacteria 6339
350 Ga0157369_10037368 3300013105 Bacteria 5316
351 Ga0157369_10113865 3300013105 Bacteria 2873
352 Ga0157369_10311774 3300013105 Bacteria 1636
353 Ga0157369_10381148 3300013105 Bacteria 1464
354 Ga0157369_10473206 3300013105 Bacteria 1297
355 Ga0157369_11275382 3300013105 Bacteria 749
356 Ga0157369_11330785 3300013105 Bacteria 732
357 Ga0157369_11815673 3300013105 Bacteria 619
358 Ga0157369_11917440 3300013105 Bacteria 601
359 Ga0157374_10126247 3300013296 Bacteria 2473
360 Ga0157374_10822424 3300013296 Bacteria 945
361 Ga0157378_10072925 3300013297 Bacteria 3086
362 Ga0163162_10158630 3300013306 Bacteria 2383
363 Ga0163162_10246941 3300013306 Bacteria 1916
364 Ga0163162_10579383 3300013306 Bacteria 1249
365 Ga0163162_11467342 3300013306 Bacteria 777
366 Ga0157372_10040923 3300013307 Bacteria 5122
367 Ga0157372_10233799 3300013307 Bacteria 2131
368 Ga0157372_10529092 3300013307 Bacteria 1374
369 Ga0157372_10545565 3300013307 Bacteria 1352
370 Ga0157372_12580907 3300013307 Bacteria 583
371 Ga0157375_10283517 3300013308 Bacteria 1820
372 Ga0157375_10650480 3300013308 Bacteria 1210
373 Ga0157375_11658109 3300013308 Bacteria 757
374 Ga0163163_10002393 3300014325 Bacteria 15879
375 Ga0157377_10002754 3300014745 Bacteria 7825
376 Ga0157379_10388554 3300014968 Bacteria 1281
377 Ga0163161_10725466 3300017792 Bacteria 829
378 Ga0197907_11026602 3300020069 Bacteria 2447
379 Ga0206356_10045061 3300020070 Bacteria 1478
380 Ga0206356_11594584 3300020070 Bacteria 1330
381 Ga0206354_10240686 3300020081 Bacteria 1701
382 Ga0206354_11613940 3300020081 Bacteria 2895
383 Ga0206353_10081921 3300020082 Bacteria 2932
384 Ga0206353_11694684 3300020082 Bacteria 3599
385 Ga0206353_11830984 3300020082 Bacteria 4144
386 Ga0207697_10000927 3300025315 Bacteria 16534
387 Ga0207697_10026708 3300025315 Bacteria 2361
388 Ga0207697_10268756 3300025315 Bacteria 755
389 Ga0207656_10010609 3300025321 Bacteria 3457
390 Ga0207656_10014432 3300025321 Bacteria 3043
391 Ga0207656_10094149 3300025321 Bacteria 1364
392 Ga0207656_10333970 3300025321 Bacteria 755
393 Ga0207688_10006261 3300025901 Bacteria 6479
394 Ga0207688_10036545 3300025901 Bacteria 2722
395 Ga0207680_10000267 3300025903 Bacteria 24862
396 Ga0207680_10009206 3300025903 Bacteria 4884
397 Ga0207680_10203583 3300025903 Bacteria 1350
398 Ga0207680_10386282 3300025903 Bacteria 988
399 Ga0207647_10000339 3300025904 Bacteria 38180
400 Ga0207647_10001091 3300025904 Bacteria 20920
401 Ga0207647_10012640 3300025904 Bacteria 5867
402 Ga0207647_10024634 3300025904 Bacteria 3966
403 Ga0207647_10031804 3300025904 Bacteria 3394
404 Ga0207647_10033806 3300025904 Bacteria 3270
405 Ga0207647_10060339 3300025904 Bacteria 2318
406 Ga0207647_10297141 3300025904 Bacteria 920
407 Ga0207645_10005086 3300025907 Bacteria 9628
408 Ga0207645_10178329 3300025907 Bacteria 1394
409 Ga0207645_10674538 3300025907 Bacteria 702
410 Ga0207643_10046851 3300025908 Bacteria 2444
411 Ga0207705_10000449 3300025909 Bacteria 35420
412 Ga0207705_10040973 3300025909 Bacteria 3322
413 Ga0207705_10054169 3300025909 Bacteria 2891
414 Ga0207705_10066160 3300025909 Bacteria 2614
415 Ga0207705_10087043 3300025909 Bacteria 2284
416 Ga0207705_10101526 3300025909 Bacteria 2116
417 Ga0207705_10189732 3300025909 Bacteria 1553
418 Ga0207705_10267222 3300025909 Bacteria 1307
419 Ga0207705_10330257 3300025909 Bacteria 1173
420 Ga0207705_10332469 3300025909 Bacteria 1169
421 Ga0207705_10405010 3300025909 Bacteria 1055
422 Ga0207705_10413571 3300025909 Bacteria 1044
423 Ga0207705_10775236 3300025909 Bacteria 745
424 Ga0207654_10015731 3300025911 Bacteria 3931
425 Ga0207707_10044988 3300025912 Bacteria 3848
426 Ga0207707_10112172 3300025912 Bacteria 2384
427 Ga0207707_10255271 3300025912 Bacteria 1522
428 Ga0207695_10005871 3300025913 Bacteria 16113
429 Ga0207695_10030095 3300025913 Bacteria 5983
430 Ga0207695_10644172 3300025913 Bacteria 941
431 Ga0207695_10887780 3300025913 Bacteria 771
432 Ga0207671_10007910 3300025914 Bacteria 9124
433 Ga0207671_10090453 3300025914 Bacteria 2305
434 Ga0207671_10652121 3300025914 Bacteria 838
435 Ga0207693_10013827 3300025915 Bacteria 6499
436 Ga0207660_10000140 3300025917 Bacteria 43651
437 Ga0207660_10005814 3300025917 Bacteria 8004
438 Ga0207660_10049616 3300025917 Bacteria 2976
439 Ga0207660_10052738 3300025917 Bacteria 2896
440 Ga0207660_10107798 3300025917 Bacteria 2091
441 Ga0207660_10245207 3300025917 Bacteria 1413
442 Ga0207657_10001304 3300025919 Bacteria 26485
443 Ga0207657_10004393 3300025919 Bacteria 14921
444 Ga0207657_10005790 3300025919 Bacteria 12885
445 Ga0207657_10012844 3300025919 Bacteria 8239
446 Ga0207657_10014941 3300025919 Bacteria 7545
447 Ga0207657_10029019 3300025919 Bacteria 5041
448 Ga0207657_10072704 3300025919 Bacteria 2908
449 Ga0207657_10077783 3300025919 Bacteria 2795
450 Ga0207657_10113596 3300025919 Bacteria 2234
451 Ga0207657_10176305 3300025919 Bacteria 1730
452 Ga0207657_10223191 3300025919 Bacteria 1509
453 Ga0207649_10000942 3300025920 Bacteria 18202
454 Ga0207649_10008870 3300025920 Bacteria 5492
455 Ga0207649_10078946 3300025920 Bacteria 2125
456 Ga0207649_10143986 3300025920 Bacteria 1634
457 Ga0207649_10227801 3300025920 Bacteria 1331
458 Ga0207649_10248387 3300025920 Bacteria 1280
459 Ga0207649_10294533 3300025920 Bacteria 1184
460 Ga0207649_10299049 3300025920 Bacteria 1176
461 Ga0207649_10304918 3300025920 Bacteria 1165
462 Ga0207649_10346178 3300025920 Bacteria 1099
463 Ga0207649_10382849 3300025920 Bacteria 1049
464 Ga0207652_10018203 3300025921 Bacteria 5759
465 Ga0207652_10019584 3300025921 Bacteria 5568
466 Ga0207652_10203210 3300025921 Bacteria 1783
467 Ga0207652_10207558 3300025921 Bacteria 1763
468 Ga0207652_10409569 3300025921 Bacteria 1223
469 Ga0207652_10487105 3300025921 Bacteria 1111
470 Ga0207681_10010337 3300025923 Bacteria 5709
471 Ga0207681_10030957 3300025923 Bacteria 3492
472 Ga0207681_10042497 3300025923 Bacteria 3036
473 Ga0207681_10944934 3300025923 Bacteria 723
474 Ga0207694_10001620 3300025924 Bacteria 18931
475 Ga0207694_10016190 3300025924 Bacteria 5628
476 Ga0207694_10112730 3300025924 Bacteria 2164
477 Ga0207694_10150712 3300025924 Bacteria 1873
478 Ga0207694_10442145 3300025924 Bacteria 1085
479 Ga0207650_10102478 3300025925 Bacteria 2205
480 Ga0207650_10410258 3300025925 Bacteria 1123
481 Ga0207650_10735369 3300025925 Bacteria 834
482 Ga0207659_10144325 3300025926 Bacteria 1852
483 Ga0207659_10221177 3300025926 Bacteria 1523
484 Ga0207659_10473350 3300025926 Bacteria 1057
485 Ga0207659_10838848 3300025926 Bacteria 790
486 Ga0207687_10014186 3300025927 Bacteria 5213
487 Ga0207687_10387117 3300025927 Bacteria 1147
488 Ga0207664_10030978 3300025929 Bacteria 4089
489 Ga0207664_10143846 3300025929 Bacteria 2020
490 Ga0207664_10313698 3300025929 Bacteria 1382
491 Ga0207644_10020664 3300025931 Bacteria 4480
492 Ga0207644_10060756 3300025931 Bacteria 2735
493 Ga0207644_10076526 3300025931 Bacteria 2462
494 Ga0207644_11117220 3300025931 Bacteria 662
495 Ga0207690_10000257 3300025932 Bacteria 38401
496 Ga0207690_10003046 3300025932 Bacteria 10096
497 Ga0207690_10003399 3300025932 Bacteria 9510
498 Ga0207690_10005683 3300025932 Bacteria 7372
499 Ga0207690_10012331 3300025932 Bacteria 5114
500 Ga0207690_10025705 3300025932 Bacteria 3701
501 Ga0207690_10055920 3300025932 Bacteria 2660
502 Ga0207690_10067592 3300025932 Bacteria 2452
503 Ga0207690_10192148 3300025932 Bacteria 1544
504 Ga0207690_10230100 3300025932 Bacteria 1423
505 Ga0207690_10241595 3300025932 Bacteria 1391
506 Ga0207690_10319681 3300025932 Bacteria 1220
507 Ga0207690_10331204 3300025932 Bacteria 1199
508 Ga0207690_10634563 3300025932 Bacteria 874
509 Ga0207690_11028741 3300025932 Bacteria 686
510 Ga0207706_10001159 3300025933 Bacteria 26723
511 Ga0207706_10001176 3300025933 Bacteria 26479
512 Ga0207706_10021174 3300025933 Bacteria 5842
513 Ga0207706_10021580 3300025933 Bacteria 5781
514 Ga0207706_10024409 3300025933 Bacteria 5420
515 Ga0207706_10039677 3300025933 Bacteria 4174
516 Ga0207706_10057632 3300025933 Bacteria 3422
517 Ga0207706_11309203 3300025933 Bacteria 598
518 Ga0207709_10365082 3300025935 Bacteria 1094
519 Ga0207669_10006752 3300025937 Bacteria 5268
520 Ga0207669_10146093 3300025937 Bacteria 1649
521 Ga0207669_10210712 3300025937 Bacteria 1418
522 Ga0207704_10052796 3300025938 Bacteria 2466
523 Ga0207704_10086743 3300025938 Bacteria 2042
524 Ga0207704_10427121 3300025938 Bacteria 1052
525 Ga0207691_10000915 3300025940 Bacteria 29231
526 Ga0207691_10034910 3300025940 Bacteria 4673
527 Ga0207691_10070539 3300025940 Bacteria 3155
528 Ga0207711_10000427 3300025941 Bacteria 44194
529 Ga0207711_10330574 3300025941 Bacteria 1409
530 Ga0207689_10002262 3300025942 Bacteria 18047
531 Ga0207689_10014695 3300025942 Bacteria 6649
532 Ga0207689_10081906 3300025942 Bacteria 2653
533 Ga0207661_10001889 3300025944 Bacteria 14357
534 Ga0207661_10022084 3300025944 Bacteria 4783
535 Ga0207661_10185653 3300025944 Bacteria 1819
536 Ga0207661_10585429 3300025944 Bacteria 1024
537 Ga0207661_10657447 3300025944 Bacteria 963
538 Ga0207661_10905255 3300025944 Bacteria 812
539 Ga0207661_11761415 3300025944 Bacteria 565
540 Ga0207679_10000463 3300025945 Bacteria 28581
541 Ga0207679_10023121 3300025945 Bacteria 4245
542 Ga0207679_10028252 3300025945 Bacteria 3889
543 Ga0207679_10031053 3300025945 Bacteria 3736
544 Ga0207679_10043669 3300025945 Bacteria 3229
545 Ga0207679_10067768 3300025945 Bacteria 2678
546 Ga0207679_10122191 3300025945 Bacteria 2075
547 Ga0207679_10133696 3300025945 Bacteria 1994
548 Ga0207679_10249075 3300025945 Bacteria 1509
549 Ga0207679_10616151 3300025945 Bacteria 979
550 Ga0207667_10005298 3300025949 Bacteria 15727
551 Ga0207667_10017448 3300025949 Bacteria 8076
552 Ga0207667_10019488 3300025949 Bacteria 7570
553 Ga0207667_10023414 3300025949 Bacteria 6801
554 Ga0207667_10039420 3300025949 Bacteria 5035
555 Ga0207667_10104616 3300025949 Bacteria 2920
556 Ga0207667_10126501 3300025949 Bacteria 2632
557 Ga0207667_10288437 3300025949 Bacteria 1677
558 Ga0207667_10366214 3300025949 Bacteria 1470
559 Ga0207667_10702944 3300025949 Bacteria 1013
560 Ga0207667_10765080 3300025949 Bacteria 964
561 Ga0207667_11269699 3300025949 Bacteria 714
562 Ga0207651_10002434 3300025960 Bacteria 8899
563 Ga0207651_10083043 3300025960 Bacteria 2315
564 Ga0207651_10085852 3300025960 Bacteria 2285
565 Ga0207651_10137799 3300025960 Bacteria 1880
566 Ga0207651_10198061 3300025960 Bacteria 1607
567 Ga0207712_10001479 3300025961 Bacteria 16004
568 Ga0207712_10162218 3300025961 Bacteria 1739
569 Ga0207712_10411303 3300025961 Bacteria 1139
570 Ga0207668_10000193 3300025972 Bacteria 41849
571 Ga0207668_10008464 3300025972 Bacteria 6134
572 Ga0207668_10016056 3300025972 Bacteria 4665
573 Ga0207640_10014338 3300025981 Bacteria 4560
574 Ga0207640_10024074 3300025981 Bacteria 3668
575 Ga0207640_10034073 3300025981 Bacteria 3175
576 Ga0207640_10040132 3300025981 Bacteria 2967
577 Ga0207640_10066915 3300025981 Bacteria 2402
578 Ga0207640_10312103 3300025981 Bacteria 1248
579 Ga0207640_10609877 3300025981 Bacteria 925
580 Ga0207658_10010495 3300025986 Bacteria 6291
581 Ga0207658_10023874 3300025986 Bacteria 4272
582 Ga0207658_10041020 3300025986 Bacteria 3349
583 Ga0207658_10326100 3300025986 Bacteria 1330
584 Ga0207677_10010221 3300026023 Bacteria 5304
585 Ga0207677_10033514 3300026023 Bacteria 3316
586 Ga0207677_10058645 3300026023 Bacteria 2652
587 Ga0207703_10001377 3300026035 Bacteria 22204
588 Ga0207703_10005232 3300026035 Bacteria 10475
589 Ga0207703_10006290 3300026035 Bacteria 9494
590 Ga0207703_10032995 3300026035 Bacteria 4102
591 Ga0207703_10569926 3300026035 Bacteria 1069
592 Ga0207639_10000725 3300026041 Bacteria 22513
593 Ga0207639_10000899 3300026041 Bacteria 20185
594 Ga0207639_10002865 3300026041 Bacteria 11588
595 Ga0207639_10017652 3300026041 Bacteria 5060
596 Ga0207639_10018792 3300026041 Bacteria 4916
597 Ga0207639_10105598 3300026041 Bacteria 2285
598 Ga0207639_10113269 3300026041 Bacteria 2215
599 Ga0207639_10134743 3300026041 Bacteria 2049
600 Ga0207639_10195631 3300026041 Bacteria 1730
601 Ga0207639_10442302 3300026041 Bacteria 1179
602 Ga0207678_10002527 3300026067 Bacteria 16669
603 Ga0207678_10009227 3300026067 Bacteria 8682
604 Ga0207678_10018509 3300026067 Bacteria 6117
605 Ga0207678_10061160 3300026067 Bacteria 3239
606 Ga0207678_10481804 3300026067 Bacteria 1080
607 Ga0207702_10002349 3300026078 Bacteria 18050
608 Ga0207702_10057556 3300026078 Bacteria 3304
609 Ga0207702_10097762 3300026078 Bacteria 2584
610 Ga0207702_10391529 3300026078 Bacteria 1338
611 Ga0207702_10469521 3300026078 Bacteria 1223
612 Ga0207702_10547853 3300026078 Bacteria 1131
613 Ga0207702_10550813 3300026078 Bacteria 1128
614 Ga0207702_10628833 3300026078 Bacteria 1055
615 Ga0207641_10261568 3300026088 Bacteria 1620
616 Ga0207641_10415286 3300026088 Bacteria 1294
617 Ga0207641_10598431 3300026088 Bacteria 1079
618 Ga0207641_10955963 3300026088 Bacteria 852
619 Ga0207648_10008975 3300026089 Bacteria 9616
620 Ga0207648_10037482 3300026089 Bacteria 4271
621 Ga0207676_10046755 3300026095 Bacteria 3350
622 Ga0207676_10103040 3300026095 Bacteria 2370
623 Ga0207674_10001348 3300026116 Bacteria 31762
624 Ga0207674_10001919 3300026116 Bacteria 26380
625 Ga0207674_10002225 3300026116 Bacteria 24561
626 Ga0207674_10007182 3300026116 Bacteria 13002
627 Ga0207674_10008663 3300026116 Bacteria 11716
628 Ga0207674_10017244 3300026116 Bacteria 7878
629 Ga0207674_10019181 3300026116 Bacteria 7416
630 Ga0207674_10089951 3300026116 Bacteria 3062
631 Ga0207674_10829184 3300026116 Bacteria 892
632 Ga0207683_10399716 3300026121 Bacteria 1264
633 Ga0207698_10000435 3300026142 Bacteria 24060
634 Ga0207698_10001498 3300026142 Bacteria 13598
635 Ga0207698_10002732 3300026142 Bacteria 10512
636 Ga0207698_10015573 3300026142 Bacteria 5096
637 Ga0207698_10018495 3300026142 Bacteria 4749
638 Ga0207698_10035415 3300026142 Bacteria 3651
639 Ga0207698_10070417 3300026142 Bacteria 2771
640 Ga0207698_10126796 3300026142 Bacteria 2172
641 Ga0207698_10234978 3300026142 Bacteria 1666
642 Ga0207698_10242495 3300026142 Bacteria 1644
643 Ga0207698_10464626 3300026142 Bacteria 1224
644 Ga0207698_10586688 3300026142 Bacteria 1097
645 Ga0207698_11221709 3300026142 Bacteria 766
646 Ga0268266_10002440 3300028379 Bacteria 19956
647 Ga0268266_10003671 3300028379 Bacteria 15155
648 Ga0268266_10006728 3300028379 Bacteria 10483
649 Ga0268266_10092324 3300028379 Bacteria 2656
650 Ga0268265_10013759 3300028380 Bacteria 5506
651 Ga0268265_10051719 3300028380 Bacteria 3102
652 Ga0268265_10107978 3300028380 Bacteria 2264
653 Ga0268265_10201097 3300028380 Bacteria 1728
654 Ga0268264_10003251 3300028381 Bacteria 14056
655 Ga0268264_10024043 3300028381 Bacteria 4971
656 Ga0268264_10067911 3300028381 Bacteria 3010
657 Ga0268264_10381251 3300028381 Bacteria 1350
658 Ga0307513_10726486 3300031456 Bacteria 699
659 Ga0373950_0074375 3300034818 Bacteria 701
660 Ga0373939_0170129 3300035114 Bacteria 806
661 Ga0373939_0272927 3300035114 Bacteria 665
662 Ga0373953_0204686 3300035117 Bacteria 854
663 Ga0373954_0003787 3300035118 Bacteria 6453
664 Ga0373957_0036279 3300035120 Bacteria 1836
665 Ga0373960_0033677 3300035121 Bacteria 1445
666 Ga0373955_0002783 3300035172 Bacteria 7677
667 Ga0373931_0718907 3300035691 Bacteria 661
668 Ga0373933_0297028 3300035724 Bacteria 1045
669 Ga0395899_0000387 3300037312 Bacteria 52472
670 Ga0395899_0001750 3300037312 Bacteria 18054
671 Ga0395899_0005102 3300037312 Bacteria 10221
672 Ga0395899_0029629 3300037312 Bacteria 4117
673 Ga0395899_0030085 3300037312 Bacteria 4085
674 Ga0395899_0030581 3300037312 Bacteria 4049
675 Ga0395899_0077870 3300037312 Bacteria 2417
676 Ga0395899_0117816 3300037312 Bacteria 1904
677 Ga0395899_0227613 3300037312 Bacteria 1289
678 Ga0395899_0419152 3300037312 Bacteria 882
679 Ga0395899_0440026 3300037312 Bacteria 856
680 Ga0395899_0683227 3300037312 Bacteria 645
681 Ga0395900_0000130 3300037418 Bacteria 126231
682 Ga0395900_0005352 3300037418 Bacteria 13449
683 Ga0395900_0035178 3300037418 Bacteria 5159
684 Ga0395900_0037296 3300037418 Bacteria 5012
685 Ga0395900_0038572 3300037418 Bacteria 4924
686 Ga0395900_0059611 3300037418 Bacteria 3929
687 Ga0395900_0078629 3300037418 Bacteria 3389
688 Ga0395900_0086292 3300037418 Bacteria 3225
689 Ga0395900_0123286 3300037418 Bacteria 2658
690 Ga0395900_0148022 3300037418 Bacteria 2400
691 Ga0395900_0148680 3300037418 Bacteria 2394
692 Ga0395900_0201951 3300037418 Bacteria 2011
693 Ga0395900_0211079 3300037418 Bacteria 1960
694 Ga0395900_0233524 3300037418 Bacteria 1848
695 Ga0395900_0248762 3300037418 Bacteria 1780
696 Ga0395900_0316749 3300037418 Bacteria 1541
697 Ga0395900_0497371 3300037418 Bacteria 1170
698 Ga0395900_0601097 3300037418 Bacteria 1041
699 Ga0395900_0810604 3300037418 Bacteria 864
700 Ga0395898_0000274 3300037466 Bacteria 125922
701 Ga0395898_0001594 3300037466 Bacteria 30951
702 Ga0395898_0002801 3300037466 Bacteria 19982
703 Ga0395898_0025332 3300037466 Bacteria 5979
704 Ga0395898_0077740 3300037466 Bacteria 3203
705 Ga0395898_0157729 3300037466 Bacteria 2170
706 Ga0395898_0208020 3300037466 Bacteria 1867
707 Ga0395898_0297180 3300037466 Bacteria 1540
708 Ga0395898_0367301 3300037466 Bacteria 1372
709 Ga0395898_0381847 3300037466 Bacteria 1343
710 Ga0395898_0544497 3300037466 Bacteria 1102
711 Ga0395898_0729469 3300037466 Bacteria 932
712 Ga0395905_0000287 3300037471 Bacteria 73803
713 Ga0395905_0007351 3300037471 Bacteria 10967
714 Ga0395905_0028321 3300037471 Bacteria 5280
715 Ga0395905_0040866 3300037471 Bacteria 4351
716 Ga0395905_0058488 3300037471 Bacteria 3604
717 Ga0395905_0105795 3300037471 Bacteria 2642
718 Ga0395905_0125928 3300037471 Bacteria 2409
719 Ga0395905_0143254 3300037471 Bacteria 2248
720 Ga0395905_0155162 3300037471 Bacteria 2153
721 Ga0395905_0170407 3300037471 Bacteria 2045
722 Ga0395905_0247143 3300037471 Bacteria 1667
723 Ga0395905_0445505 3300037471 Bacteria 1192
724 Ga0395905_0623081 3300037471 Bacteria 981
725 Ga0395905_0653351 3300037471 Bacteria 953
726 Ga0395905_0783214 3300037471 Bacteria 856
727 Ga0395905_0906287 3300037471 Bacteria 784
728 Ga0395905_1111856 3300037471 Bacteria 693
729 Ga0395905_1406406 3300037471 Bacteria 602
730 Ga0395901_0000243 3300038443 Bacteria 68039
731 Ga0395901_0002288 3300038443 Bacteria 19530
732 Ga0395901_0004432 3300038443 Bacteria 14163
733 Ga0395901_0005970 3300038443 Bacteria 12329
734 Ga0395901_0015545 3300038443 Bacteria 7751
735 Ga0395901_0019051 3300038443 Bacteria 7017
736 Ga0395901_0037982 3300038443 Bacteria 4980
737 Ga0395901_0049214 3300038443 Bacteria 4379
738 Ga0395901_0053849 3300038443 Bacteria 4181
739 Ga0395901_0081829 3300038443 Bacteria 3372
740 Ga0395901_0083978 3300038443 Bacteria 3328
741 Ga0395901_0144235 3300038443 Bacteria 2503
742 Ga0395901_0224781 3300038443 Bacteria 1961
743 Ga0395901_0611249 3300038443 Bacteria 1098
744 Ga0395901_0754129 3300038443 Bacteria 966
745 Ga0395901_1042252 3300038443 Bacteria 791
746 Ga0395901_1224197 3300038443 Bacteria 715
747 Ga0395901_1398038 3300038443 Bacteria 658
748 Ga0439455_0013362 3300042012 Bacteria 1858
749 Ga0466966_0020215 3300044684 Bacteria 4382
750 Ga0466966_0086614 3300044684 Bacteria 1947
751 Ga0466961_0035033 3300044693 Bacteria 3223
752 Ga0466961_0044730 3300044693 Bacteria 2833
753 Ga0466963_0000327 3300044694 Bacteria 21582
754 Ga0466963_0015856 3300044694 Bacteria 4677
755 Ga0466963_0030555 3300044694 Bacteria 3477
756 Ga0466963_0032686 3300044694 Bacteria 3371
757 Ga0466963_0039904 3300044694 Bacteria 3076
758 Ga0466963_0077745 3300044694 Bacteria 2243
759 Ga0466963_0201098 3300044694 Bacteria 1393
760 Ga0466963_0224363 3300044694 Bacteria 1316
761 Ga0466964_0023682 3300044706 Bacteria 2388
762 Ga0466964_0135063 3300044706 Bacteria 1128
763 Ga0466964_0507350 3300044706 Bacteria 649
764 Ga0466971_0021745 3300044719 Bacteria 2854
765 Ga0466971_0211510 3300044719 Bacteria 917
766 Ga0466971_0333767 3300044719 Bacteria 732
767 Ga0466968_0006816 3300044735 Bacteria 4322
768 Ga0466970_0490571 3300044765 Bacteria 707
769 Ga0466957_0003051 3300044842 Bacteria 9106
770 Ga0466957_0023980 3300044842 Bacteria 3610
771 Ga0466957_0027262 3300044842 Bacteria 3394
772 Ga0466957_0316143 3300044842 Bacteria 1052
773 Ga0466957_0840317 3300044842 Bacteria 654
774 Ga0466959_0011282 3300045049 Bacteria 6413
775 Ga0466959_0339480 3300045049 Bacteria 1025
776 Ga0466958_0009863 3300045836 Bacteria 5331
777 Ga0466958_0053540 3300045836 Bacteria 2447
778 Ga0466958_0519053 3300045836 Bacteria 773
779 Ga0466967_0000053 3300045976 Bacteria 41252
780 Ga0466967_0012759 3300045976 Bacteria 6453
781 Ga0466967_0036499 3300045976 Bacteria 4196
782 Ga0466967_0061320 3300045976 Bacteria 3336
783 Ga0466967_0077283 3300045976 Bacteria 2996
784 Ga0466967_0084793 3300045976 Bacteria 2867
785 Ga0466967_0129823 3300045976 Bacteria 2338
786 Ga0466967_0136841 3300045976 Bacteria 2278
787 Ga0466967_0160742 3300045976 Bacteria 2108
788 Ga0466967_0163776 3300045976 Bacteria 2089
789 Ga0466967_0171519 3300045976 Bacteria 2041
790 Ga0466967_0276856 3300045976 Bacteria 1609
791 Ga0466967_0328353 3300045976 Bacteria 1477
792 Ga0466967_0494041 3300045976 Bacteria 1200
793 Ga0466967_0587294 3300045976 Bacteria 1099
794 Ga0466967_0633499 3300045976 Bacteria 1057
795 Ga0466967_1702578 3300045976 Bacteria 628
796 Ga0466967_1736620 3300045976 Bacteria 621
797 Ga0466967_1874264 3300045976 Bacteria 596
798 Ga0495621_0019881 3300046539 Bacteria 2197
799 Ga0495621_0078376 3300046539 Bacteria 1228
800 Ga0495668_0610830 3300046616 Bacteria 602
801 Ga0495623_0020763 3300046679 Bacteria 4245
802 Ga0495669_0000890 3300046684 Bacteria 12578
803 Ga0495669_0010005 3300046684 Bacteria 4009
804 Ga0495669_0012507 3300046684 Bacteria 3613
805 Ga0495669_0025024 3300046684 Bacteria 2602
806 Ga0495669_0124202 3300046684 Bacteria 1212
807 Ga0495670_0024831 3300046691 Bacteria 2962
808 Ga0495683_0214557 3300047323 Bacteria 861
809 Ga0495685_069177 3300047447 Bacteria 1184
810 Ga0495602_0165408 3300048088 Bacteria 1722
811 Ga0496108_1431975 3300048911 Bacteria 577
812 Ga0496109_0937502 3300048912 Bacteria 804
813 Ga0496111_0100279 3300048914 Bacteria 2127
814 Ga0496111_0243288 3300048914 Bacteria 1336
815 Ga0496112_0019543 3300048915 Bacteria 6395
816 Ga0496112_0073455 3300048915 Bacteria 3381
817 Ga0496113_0011197 3300048916 Bacteria 5970
818 Ga0496115_0002148 3300048918 Bacteria 14095
819 Ga0501071_0091226 3300049587 Bacteria 2238
820 Ga0501080_0535810 3300049742 Bacteria 1044
821 nmdc:mga0a205_1890_c1 3300050515 Bacteria 18175
822 Ga0495612_0016327 3300053078 Bacteria 2976
823 Ga0466962_0028506 3300061719 Bacteria 2674
824 Ga0466962_0054026 3300061719 Bacteria 1920
825 Ga0466962_0070681 3300061719 Bacteria 1668
826 Ga0466962_0285919 3300061719 Bacteria 814
827 Ga0466962_0483306 3300061719 Bacteria 626
828 Ga0207678_10150825
829 JGI24736J21556_1006316
830 JGI24741J21665_1000431
831 JGI24740J21852_10007349
832 JGI24740J21852_10024508
833 JGI24740J21852_10024611
834 JGI24740J21852_10030124
835 JGI24740J21852_10037718
836 JGI24739J22299_10018852
837 JGI24739J22299_10023182
838 JGI24739J22299_10024484
839 JGI24737J22298_10002777
840 JGI24737J22298_10002937
841 JGI24737J22298_10007611
842 JGI24737J22298_10009306
843 JGI24735J21928_10005125
844 JGI24735J21928_10061113
845 JGI24738J21930_10005729
846 JGI24738J21930_10014966
847 Ga0065715_10268661
848 Ga0070658_10000453
849 Ga0070658_10008029
850 Ga0070658_10048009
851 Ga0070658_10053125
852 Ga0070658_10106256
853 Ga0070658_10175529
854 Ga0070658_10570838
855 Ga0070658_10592633
856 Ga0070658_11217679
857 Ga0070658_11529069
858 Ga0070676_10085622
859 Ga0070676_10152244
860 Ga0070676_10699607
861 Ga0070683_100015500
862 Ga0070683_100071890
863 Ga0070683_100078457
864 Ga0070683_100148477
865 Ga0070683_100873468
866 Ga0070683_100890551
867 Ga0070690_100094817
868 Ga0070670_100005622
869 Ga0070670_100016759
870 Ga0070670_100029828
871 Ga0068869_100016057
872 Ga0068869_100040081
873 Ga0068869_100437698
874 Ga0070666_10001156
875 Ga0070666_10011825
876 Ga0070666_10235778
877 Ga0070666_10586393
878 Ga0070666_10977316
879 Ga0070680_100004052
880 Ga0070680_100007567
881 Ga0070680_100023246
882 Ga0070680_100084682
883 Ga0070680_100097263
884 Ga0070680_100133954
885 Ga0070680_100139505
886 Ga0070680_100337302
887 Ga0070682_100075091
888 Ga0070682_101205617
889 Ga0068868_100007723
890 Ga0068868_100528503
891 Ga0068868_101538432
892 Ga0070660_100000488
893 Ga0070660_100005858
894 Ga0070660_100022777
895 Ga0070660_100110223
896 Ga0070660_100338766
897 Ga0070660_100338898
898 Ga0070660_100422730
899 Ga0070660_100481314
900 Ga0070660_100835142
901 Ga0070660_101081477
902 Ga0070691_10003847
903 Ga0070691_10031783
904 Ga0070687_100635640
905 Ga0070661_100000311
906 Ga0070661_100026847
907 Ga0070661_100029695
908 Ga0070661_100127645
909 Ga0070661_100128467
910 Ga0070661_100254008
911 Ga0070661_100569666
912 Ga0070692_10001342
913 Ga0070692_10059316
914 Ga0070668_100022568
915 Ga0070668_100072861
916 Ga0070668_100073517
917 Ga0070669_100008762
918 Ga0070669_100011288
919 Ga0070669_100031470
920 Ga0070669_100063933
921 Ga0070669_100358784
922 Ga0070675_100132798
923 Ga0070675_100286987
924 Ga0070671_100007873
925 Ga0070671_100086458
926 Ga0070674_100004662
927 Ga0070674_100089368
928 Ga0070674_100332633
929 Ga0070673_100006519
930 Ga0070673_100010672
931 Ga0070673_100084369
932 Ga0070673_100192036
933 Ga0070673_100397862
934 Ga0070659_100000594
935 Ga0070659_100002859
936 Ga0070659_100005258
937 Ga0070659_100015083
938 Ga0070659_100018550
939 Ga0070659_100020293
940 Ga0070659_100029854
941 Ga0070659_100036764
942 Ga0070659_100047564
943 Ga0070659_100074184
944 Ga0070659_100076841
945 Ga0070659_100480810
946 Ga0070659_100775956
947 Ga0070659_101258102
948 Ga0070667_100004431
949 Ga0070667_100006873
950 Ga0070667_100206024
951 Ga0070667_100656282
952 Ga0070709_10121355
953 Ga0070714_100089556
954 Ga0070714_100146211
955 Ga0070714_100251376
956 Ga0070713_100273403
957 Ga0070713_101129604
958 Ga0070710_10806426
959 Ga0070694_100012045
960 Ga0070663_100027460
961 Ga0070663_100069881
962 Ga0070663_100071789
963 Ga0070663_100134626
964 Ga0070663_100241861
965 Ga0070678_100788709
966 Ga0070662_100000198
967 Ga0070662_100001444
968 Ga0070662_100003480
969 Ga0070662_100007528
970 Ga0070662_100039993
971 Ga0070662_100197427
972 Ga0070662_100291414
973 Ga0070662_100362901
974 Ga0070662_100766547
975 Ga0070662_101429584
976 Ga0070681_10008046
977 Ga0070681_10027032
978 Ga0068867_100005601
979 Ga0068867_100028368
980 Ga0070679_100032931
981 Ga0070679_100090052
982 Ga0070679_100179201
983 Ga0070679_100266185
984 Ga0070684_100004782
985 Ga0070684_100202139
986 Ga0068853_100011705
987 Ga0068853_100023018
988 Ga0068853_100025355
989 Ga0068853_100032257
990 Ga0068853_100040393
991 Ga0068853_100117776
992 Ga0068853_100122536
993 Ga0068853_100139479
994 Ga0068853_100397464
995 Ga0068853_100443737
996 Ga0070672_100007480
997 Ga0070672_100029586
998 Ga0070672_100125140
999 Ga0070672_100843518
1000 Ga0070693_100000578
1001 Ga0070693_100139060
1002 Ga0070693_100238151
1003 Ga0070693_100581844
1004 Ga0070665_100002788
1005 Ga0070665_100026017
1006 Ga0070665_100162523
1007 Ga0070665_100180998
1008 Ga0070665_100235521
1009 Ga0068855_100003204
1010 Ga0068855_100015492
1011 Ga0068855_100032022
1012 Ga0068855_100060354
1013 Ga0068855_100065023
1014 Ga0068855_100072455
1015 Ga0068855_100165920
1016 Ga0068855_100170245
1017 Ga0068855_100179878
1018 Ga0068855_100204320
1019 Ga0068855_100535378
1020 Ga0068855_100695336
1021 Ga0068855_101097836
1022 Ga0068855_101420989
1023 Ga0070664_100000259
1024 Ga0070664_100072002
1025 Ga0070664_100082947
1026 Ga0070664_100097901
1027 Ga0070664_100151368
1028 Ga0070664_100555631
1029 Ga0070664_100654261
1030 Ga0070664_100810455
1031 Ga0068857_100012438
1032 Ga0068857_100023284
1033 Ga0068857_100068418
1034 Ga0068857_100107528
1035 Ga0068857_100108619
1036 Ga0068857_100127525
1037 Ga0068857_100134121
1038 Ga0068854_100003755
1039 Ga0068854_100007640
1040 Ga0068854_100036835
1041 Ga0068854_100058228
1042 Ga0068854_100067819
1043 Ga0068854_100068009
1044 Ga0068854_100069136
1045 Ga0068854_100159497
1046 Ga0068854_100724304
1047 Ga0068854_101161210
1048 Ga0068856_100000315
1049 Ga0068856_100028077
1050 Ga0068856_100104718
1051 Ga0068856_100137277
1052 Ga0068856_100142103
1053 Ga0068856_100218582
1054 Ga0068856_100233056
1055 Ga0068856_100444647
1056 Ga0068856_100536764
1057 Ga0068856_100648048
1058 Ga0068856_100967844
1059 Ga0068856_101011159
1060 Ga0070702_101095609
1061 Ga0068852_100000548
1062 Ga0068852_100002774
1063 Ga0068852_100003431
1064 Ga0068852_100004378
1065 Ga0068852_100005550
1066 Ga0068852_100005873
1067 Ga0068852_100008118
1068 Ga0068852_100031820
1069 Ga0068852_100040743
1070 Ga0068852_100149317
1071 Ga0068852_100209496
1072 Ga0068852_100258278
1073 Ga0068852_100431213
1074 Ga0068852_100499014
1075 Ga0068852_101174109
1076 Ga0068859_100013088
1077 Ga0068859_100048653
1078 Ga0068859_100054070
1079 Ga0068864_100008682
1080 Ga0068864_100059371
1081 Ga0068861_100078110
1082 Ga0068851_10014634
1083 Ga0068851_10121527
1084 Ga0068851_10144850
1085 Ga0068851_10324714
1086 Ga0068851_10451565
1087 Ga0068870_10204201
1088 Ga0068863_100025387
1089 Ga0068863_100126825
1090 Ga0068858_100013411
1091 Ga0068858_100048345
1092 Ga0068858_100073197
1093 Ga0068858_101681154
1094 Ga0068860_100028314
1095 Ga0068860_100029169
1096 Ga0068860_100146029
1097 Ga0068860_100232533
1098 Ga0068862_100027649
1099 Ga0068862_100085865
1100 Ga0070717_10901505
1101 Ga0070712_100009875
1102 Ga0097621_100045977
1103 Ga0097621_101143612
1104 Ga0068871_100040950
1105 Ga0068871_100536191
1106 Ga0068871_101104449
1107 Ga0075428_100482205
1108 Ga0075433_10022921
1109 Ga0075434_101431764
1110 Ga0068865_100630764
1111 Ga0097620_100013089
1112 Ga0097620_100048654
1113 Ga0097620_100054072
1114 Ga0075435_100281381
1115 Ga0105240_10030088
1116 Ga0105240_10052381
1117 Ga0105240_10058097
1118 Ga0105240_10142637
1119 Ga0105240_11046103
1120 Ga0105240_11555299
1121 Ga0105245_10012098
1122 Ga0105245_10071148
1123 Ga0105243_10574740
1124 Ga0105241_10035964
1125 Ga0105241_10248274
1126 Ga0105241_10697590
1127 Ga0105242_11316461
1128 Ga0105248_10000395
1129 Ga0105248_10051437
1130 Ga0105248_11183828
1131 Ga0105237_10010105
1132 Ga0105237_10045897
1133 Ga0105237_11876867
1134 Ga0105238_10015405
1135 Ga0105238_10019482
1136 Ga0105238_10127071
1137 Ga0105238_10282670
1138 Ga0105238_10538596
1139 Ga0105249_10023157
1140 Ga0105249_10139940
1141 Ga0105249_10646879
1142 Ga0105239_10100845
1143 Ga0105239_11424276
1144 Ga0105246_10040992
1145 Ga0105246_10079424
1146 Ga0105246_10079969
1147 Ga0157373_10015573
1148 Ga0157373_10019829
1149 Ga0157373_10020405
1150 Ga0157373_10053182
1151 Ga0157373_10074207
1152 Ga0157373_10205747
1153 Ga0157373_10394928
1154 Ga0157373_10403615
1155 Ga0157371_10008334
1156 Ga0157371_10030303
1157 Ga0157371_10080039
1158 Ga0157371_10103101
1159 Ga0157371_10112225
1160 Ga0157371_10139587
1161 Ga0157371_10166819
1162 Ga0157371_10340797
1163 Ga0157371_10769456
1164 Ga0157370_10012433
1165 Ga0157370_10020331
1166 Ga0157370_10023427
1167 Ga0157370_10028439
1168 Ga0157370_10046054
1169 Ga0157370_10091919
1170 Ga0157370_10147590
1171 Ga0157370_10164988
1172 Ga0157370_10396370
1173 Ga0157370_10681809
1174 Ga0157369_10005829
1175 Ga0157369_10009810
1176 Ga0157369_10027229
1177 Ga0157369_10037368
1178 Ga0157369_10113865
1179 Ga0157369_10311774
1180 Ga0157369_10381148
1181 Ga0157369_10473206
1182 Ga0157369_11275382
1183 Ga0157369_11330785
1184 Ga0157369_11815673
1185 Ga0157369_11917440
1186 Ga0157374_10126247
1187 Ga0157374_10822424
1188 Ga0157378_10072925
1189 Ga0163162_10158630
1190 Ga0163162_10246941
1191 Ga0163162_10579383
1192 Ga0163162_11467342
1193 Ga0157372_10040923
1194 Ga0157372_10233799
1195 Ga0157372_10529092
1196 Ga0157372_10545565
1197 Ga0157372_12580907
1198 Ga0157375_10283517
1199 Ga0157375_10650480
1200 Ga0157375_11658109
1201 Ga0163163_10002393
1202 Ga0157377_10002754
1203 Ga0157379_10388554
1204 Ga0163161_10725466
1205 Ga0197907_11026602
1206 Ga0206356_10045061
1207 Ga0206356_11594584
1208 Ga0206354_10240686
1209 Ga0206354_11613940
1210 Ga0206353_10081921
1211 Ga0206353_11694684
1212 Ga0206353_11830984
1213 Ga0207697_10000927
1214 Ga0207697_10026708
1215 Ga0207697_10268756
1216 Ga0207656_10010609
1217 Ga0207656_10014432
1218 Ga0207656_10094149
1219 Ga0207656_10333970
1220 Ga0207688_10006261
1221 Ga0207688_10036545
1222 Ga0207680_10000267
1223 Ga0207680_10009206
1224 Ga0207680_10203583
1225 Ga0207680_10386282
1226 Ga0207647_10000339
1227 Ga0207647_10001091
1228 Ga0207647_10012640
1229 Ga0207647_10024634
1230 Ga0207647_10031804
1231 Ga0207647_10033806
1232 Ga0207647_10060339
1233 Ga0207647_10297141
1234 Ga0207645_10005086
1235 Ga0207645_10178329
1236 Ga0207645_10674538
1237 Ga0207643_10046851
1238 Ga0207705_10000449
1239 Ga0207705_10040973
1240 Ga0207705_10054169
1241 Ga0207705_10066160
1242 Ga0207705_10087043
1243 Ga0207705_10101526
1244 Ga0207705_10189732
1245 Ga0207705_10267222
1246 Ga0207705_10330257
1247 Ga0207705_10332469
1248 Ga0207705_10405010
1249 Ga0207705_10413571
1250 Ga0207705_10775236
1251 Ga0207654_10015731
1252 Ga0207707_10044988
1253 Ga0207707_10112172
1254 Ga0207707_10255271
1255 Ga0207695_10005871
1256 Ga0207695_10030095
1257 Ga0207695_10644172
1258 Ga0207695_10887780
1259 Ga0207671_10007910
1260 Ga0207671_10090453
1261 Ga0207671_10652121
1262 Ga0207693_10013827
1263 Ga0207660_10000140
1264 Ga0207660_10005814
1265 Ga0207660_10049616
1266 Ga0207660_10052738
1267 Ga0207660_10107798
1268 Ga0207660_10245207
1269 Ga0207657_10001304
1270 Ga0207657_10004393
1271 Ga0207657_10005790
1272 Ga0207657_10012844
1273 Ga0207657_10014941
1274 Ga0207657_10029019
1275 Ga0207657_10072704
1276 Ga0207657_10077783
1277 Ga0207657_10113596
1278 Ga0207657_10176305
1279 Ga0207657_10223191
1280 Ga0207649_10000942
1281 Ga0207649_10008870
1282 Ga0207649_10078946
1283 Ga0207649_10143986
1284 Ga0207649_10227801
1285 Ga0207649_10248387
1286 Ga0207649_10294533
1287 Ga0207649_10299049
1288 Ga0207649_10304918
1289 Ga0207649_10346178
1290 Ga0207649_10382849
1291 Ga0207652_10018203
1292 Ga0207652_10019584
1293 Ga0207652_10203210
1294 Ga0207652_10207558
1295 Ga0207652_10409569
1296 Ga0207652_10487105
1297 Ga0207681_10010337
1298 Ga0207681_10030957
1299 Ga0207681_10042497
1300 Ga0207681_10944934
1301 Ga0207694_10001620
1302 Ga0207694_10016190
1303 Ga0207694_10112730
1304 Ga0207694_10150712
1305 Ga0207694_10442145
1306 Ga0207650_10102478
1307 Ga0207650_10410258
1308 Ga0207650_10735369
1309 Ga0207659_10144325
1310 Ga0207659_10221177
1311 Ga0207659_10473350
1312 Ga0207659_10838848
1313 Ga0207687_10014186
1314 Ga0207687_10387117
1315 Ga0207664_10030978
1316 Ga0207664_10143846
1317 Ga0207664_10313698
1318 Ga0207644_10020664
1319 Ga0207644_10060756
1320 Ga0207644_10076526
1321 Ga0207644_11117220
1322 Ga0207690_10000257
1323 Ga0207690_10003046
1324 Ga0207690_10003399
1325 Ga0207690_10005683
1326 Ga0207690_10012331
1327 Ga0207690_10025705
1328 Ga0207690_10055920
1329 Ga0207690_10067592
1330 Ga0207690_10192148
1331 Ga0207690_10230100
1332 Ga0207690_10241595
1333 Ga0207690_10319681
1334 Ga0207690_10331204
1335 Ga0207690_10634563
1336 Ga0207690_11028741
1337 Ga0207706_10001159
1338 Ga0207706_10001176
1339 Ga0207706_10021174
1340 Ga0207706_10021580
1341 Ga0207706_10024409
1342 Ga0207706_10039677
1343 Ga0207706_10057632
1344 Ga0207706_11309203
1345 Ga0207709_10365082
1346 Ga0207669_10006752
1347 Ga0207669_10146093
1348 Ga0207669_10210712
1349 Ga0207704_10052796
1350 Ga0207704_10086743
1351 Ga0207704_10427121
1352 Ga0207691_10000915
1353 Ga0207691_10034910
1354 Ga0207691_10070539
1355 Ga0207711_10000427
1356 Ga0207711_10330574
1357 Ga0207689_10002262
1358 Ga0207689_10014695
1359 Ga0207689_10081906
1360 Ga0207661_10001889
1361 Ga0207661_10022084
1362 Ga0207661_10185653
1363 Ga0207661_10585429
1364 Ga0207661_10657447
1365 Ga0207661_10905255
1366 Ga0207661_11761415
1367 Ga0207679_10000463
1368 Ga0207679_10023121
1369 Ga0207679_10028252
1370 Ga0207679_10031053
1371 Ga0207679_10043669
1372 Ga0207679_10067768
1373 Ga0207679_10122191
1374 Ga0207679_10133696
1375 Ga0207679_10249075
1376 Ga0207679_10616151
1377 Ga0207667_10005298
1378 Ga0207667_10017448
1379 Ga0207667_10019488
1380 Ga0207667_10023414
1381 Ga0207667_10039420
1382 Ga0207667_10104616
1383 Ga0207667_10126501
1384 Ga0207667_10288437
1385 Ga0207667_10366214
1386 Ga0207667_10702944
1387 Ga0207667_10765080
1388 Ga0207667_11269699
1389 Ga0207651_10002434
1390 Ga0207651_10083043
1391 Ga0207651_10085852
1392 Ga0207651_10137799
1393 Ga0207651_10198061
1394 Ga0207712_10001479
1395 Ga0207712_10162218
1396 Ga0207712_10411303
1397 Ga0207668_10000193
1398 Ga0207668_10008464
1399 Ga0207668_10016056
1400 Ga0207640_10014338
1401 Ga0207640_10024074
1402 Ga0207640_10034073
1403 Ga0207640_10040132
1404 Ga0207640_10066915
1405 Ga0207640_10312103
1406 Ga0207640_10609877
1407 Ga0207658_10010495
1408 Ga0207658_10023874
1409 Ga0207658_10041020
1410 Ga0207658_10326100
1411 Ga0207677_10010221
1412 Ga0207677_10033514
1413 Ga0207677_10058645
1414 Ga0207703_10001377
1415 Ga0207703_10005232
1416 Ga0207703_10006290
1417 Ga0207703_10032995
1418 Ga0207703_10569926
1419 Ga0207639_10000725
1420 Ga0207639_10000899
1421 Ga0207639_10002865
1422 Ga0207639_10017652
1423 Ga0207639_10018792
1424 Ga0207639_10105598
1425 Ga0207639_10113269
1426 Ga0207639_10134743
1427 Ga0207639_10195631
1428 Ga0207639_10442302
1429 Ga0207678_10002527
1430 Ga0207678_10009227
1431 Ga0207678_10018509
1432 Ga0207678_10061160
1433 Ga0207678_10481804
1434 Ga0207702_10002349
1435 Ga0207702_10057556
1436 Ga0207702_10097762
1437 Ga0207702_10391529
1438 Ga0207702_10469521
1439 Ga0207702_10547853
1440 Ga0207702_10550813
1441 Ga0207702_10628833
1442 Ga0207641_10261568
1443 Ga0207641_10415286
1444 Ga0207641_10598431
1445 Ga0207641_10955963
1446 Ga0207648_10008975
1447 Ga0207648_10037482
1448 Ga0207676_10046755
1449 Ga0207676_10103040
1450 Ga0207674_10001348
1451 Ga0207674_10001919
1452 Ga0207674_10002225
1453 Ga0207674_10007182
1454 Ga0207674_10008663
1455 Ga0207674_10017244
1456 Ga0207674_10019181
1457 Ga0207674_10089951
1458 Ga0207674_10829184
1459 Ga0207683_10399716
1460 Ga0207698_10000435
1461 Ga0207698_10001498
1462 Ga0207698_10002732
1463 Ga0207698_10015573
1464 Ga0207698_10018495
1465 Ga0207698_10035415
1466 Ga0207698_10070417
1467 Ga0207698_10126796
1468 Ga0207698_10234978
1469 Ga0207698_10242495
1470 Ga0207698_10464626
1471 Ga0207698_10586688
1472 Ga0207698_11221709
1473 Ga0268266_10002440
1474 Ga0268266_10003671
1475 Ga0268266_10006728
1476 Ga0268266_10092324
1477 Ga0268265_10013759
1478 Ga0268265_10051719
1479 Ga0268265_10107978
1480 Ga0268265_10201097
1481 Ga0268264_10003251
1482 Ga0268264_10024043
1483 Ga0268264_10067911
1484 Ga0268264_10381251
1485 Ga0307513_10726486
1486 Ga0373950_0074375
1487 Ga0373939_0170129
1488 Ga0373939_0272927
1489 Ga0373953_0204686
1490 Ga0373954_0003787
1491 Ga0373957_0036279
1492 Ga0373960_0033677
1493 Ga0373955_0002783
1494 Ga0373931_0718907
1495 Ga0373933_0297028
1496 Ga0395899_0000387
1497 Ga0395899_0001750
1498 Ga0395899_0005102
1499 Ga0395899_0029629
1500 Ga0395899_0030085
1501 Ga0395899_0030581
1502 Ga0395899_0077870
1503 Ga0395899_0117816
1504 Ga0395899_0227613
1505 Ga0395899_0419152
1506 Ga0395899_0440026
1507 Ga0395899_0683227
1508 Ga0395900_0000130
1509 Ga0395900_0005352
1510 Ga0395900_0035178
1511 Ga0395900_0037296
1512 Ga0395900_0038572
1513 Ga0395900_0059611
1514 Ga0395900_0078629
1515 Ga0395900_0086292
1516 Ga0395900_0123286
1517 Ga0395900_0148022
1518 Ga0395900_0148680
1519 Ga0395900_0201951
1520 Ga0395900_0211079
1521 Ga0395900_0233524
1522 Ga0395900_0248762
1523 Ga0395900_0316749
1524 Ga0395900_0497371
1525 Ga0395900_0601097
1526 Ga0395900_0810604
1527 Ga0395898_0000274
1528 Ga0395898_0001594
1529 Ga0395898_0002801
1530 Ga0395898_0025332
1531 Ga0395898_0077740
1532 Ga0395898_0157729
1533 Ga0395898_0208020
1534 Ga0395898_0297180
1535 Ga0395898_0367301
1536 Ga0395898_0381847
1537 Ga0395898_0544497
1538 Ga0395898_0729469
1539 Ga0395905_0000287
1540 Ga0395905_0007351
1541 Ga0395905_0028321
1542 Ga0395905_0040866
1543 Ga0395905_0058488
1544 Ga0395905_0105795
1545 Ga0395905_0125928
1546 Ga0395905_0143254
1547 Ga0395905_0155162
1548 Ga0395905_0170407
1549 Ga0395905_0247143
1550 Ga0395905_0445505
1551 Ga0395905_0623081
1552 Ga0395905_0653351
1553 Ga0395905_0783214
1554 Ga0395905_0906287
1555 Ga0395905_1111856
1556 Ga0395905_1406406
1557 Ga0395901_0000243
1558 Ga0395901_0002288
1559 Ga0395901_0004432
1560 Ga0395901_0005970
1561 Ga0395901_0015545
1562 Ga0395901_0019051
1563 Ga0395901_0037982
1564 Ga0395901_0049214
1565 Ga0395901_0053849
1566 Ga0395901_0081829
1567 Ga0395901_0083978
1568 Ga0395901_0144235
1569 Ga0395901_0224781
1570 Ga0395901_0611249
1571 Ga0395901_0754129
1572 Ga0395901_1042252
1573 Ga0395901_1224197
1574 Ga0395901_1398038
1575 Ga0439455_0013362
1576 Ga0466966_0020215
1577 Ga0466966_0086614
1578 Ga0466961_0035033
1579 Ga0466961_0044730
1580 Ga0466963_0000327
1581 Ga0466963_0015856
1582 Ga0466963_0030555
1583 Ga0466963_0032686
1584 Ga0466963_0039904
1585 Ga0466963_0077745
1586 Ga0466963_0201098
1587 Ga0466963_0224363
1588 Ga0466964_0023682
1589 Ga0466964_0135063
1590 Ga0466964_0507350
1591 Ga0466971_0021745
1592 Ga0466971_0211510
1593 Ga0466971_0333767
1594 Ga0466968_0006816
1595 Ga0466970_0490571
1596 Ga0466957_0003051
1597 Ga0466957_0023980
1598 Ga0466957_0027262
1599 Ga0466957_0316143
1600 Ga0466957_0840317
1601 Ga0466959_0011282
1602 Ga0466959_0339480
1603 Ga0466958_0009863
1604 Ga0466958_0053540
1605 Ga0466958_0519053
1606 Ga0466967_0000053
1607 Ga0466967_0012759
1608 Ga0466967_0036499
1609 Ga0466967_0061320
1610 Ga0466967_0077283
1611 Ga0466967_0084793
1612 Ga0466967_0129823
1613 Ga0466967_0136841
1614 Ga0466967_0160742
1615 Ga0466967_0163776
1616 Ga0466967_0171519
1617 Ga0466967_0276856
1618 Ga0466967_0328353
1619 Ga0466967_0494041
1620 Ga0466967_0587294
1621 Ga0466967_0633499
1622 Ga0466967_1702578
1623 Ga0466967_1736620
1624 Ga0466967_1874264
1625 Ga0495621_0019881
1626 Ga0495621_0078376
1627 Ga0495668_0610830
1628 Ga0495623_0020763
1629 Ga0495669_0000890
1630 Ga0495669_0010005
1631 Ga0495669_0012507
1632 Ga0495669_0025024
1633 Ga0495669_0124202
1634 Ga0495670_0024831
1635 Ga0495683_0214557
1636 Ga0495685_069177
1637 Ga0495602_0165408
1638 Ga0496108_1431975
1639 Ga0496109_0937502
1640 Ga0496111_0100279
1641 Ga0496111_0243288
1642 Ga0496112_0019543
1643 Ga0496112_0073455
1644 Ga0496113_0011197
1645 Ga0496115_0002148
1646 Ga0501071_0091226
1647 Ga0501080_0535810
1648 nmdc:mga0a205_1890_c1
1649 Ga0495612_0016327
1650 Ga0466962_0028506
1651 Ga0466962_0054026
1652 Ga0466962_0070681
1653 Ga0466962_0285919
1654 Ga0466962_0483306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

19

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8855 19 150
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8781 19 151
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.871 19 150
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8583 19 150
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8505 19 151
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.879 19 156 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.866 22 151 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8602 19 159 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8504 19 156 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8389 19 152 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A258BKL7-F1-model_v4 Holliday junction resolvase RuvX 0.9682 19 94 GO:0004518
GO:0006364
AF-A0A7V3UIF6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9644 19 158 GO:0000967
GO:0004518
GO:0005829
AF-A0A3R8B1S0-F1-model_v4 Holliday junction resolvase RuvX 0.9635 8 99 GO:0000967
GO:0004518
GO:0005829
AF-A0A1F9D764-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9635 18 110 GO:0000967
GO:0004518
GO:0005829
AF-X1G2L9-F1-model_v4 YqgF/RNase H-like domain-containing protein 0.9632 20 106 GO:0000967
GO:0004518
GO:0005829

Map