F482516

General Info

Members Datasets Scaffolds Average Seq Length
827 304 1654 318

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10309464|Ga0207677_103094642
Length 386
Sequence MGRKLVSCFSFSCCFVFPAPNHSKFTCSAGLAAALIRTPFHLKLSLSLYVVCSGLLHPAFGLARRICIRVFMLIKKAADIRSSEVTPKSWYMDRRKFLTGSALAGAALVGEQLWSPSTVVQANDKIPNLQKSSFSTNEKQTPYKDITNYNNYYEFSTDKYEPASLAAKFKTRPWTVTIDGAVKKKQKLDVDSIIALAAPEERIYRHRCVEGWSIVVPWIGFSLSELIKKCDPLPKARFVEFTTLFDMAQMPGQQTSVLRWPYTEGLRMDEAMHPLTLLCFGLYGEVLPNQNGAPLRIVVPWKYGFKSAKAIVKISFVENQPPTAWNDATPREYGFYSNVNPHVDHPRWSQAKERRLGEFLKRDTLMFNGYDQVASMYSGMDLKKYF

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
186 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
198 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
304 2952252522 Salinicola sp. DM10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.69
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.87
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10309464 3300026023 Bacteria 1308
2 JGI24741J21665_1010457 3300001915 Bacteria 1659
3 JGI24752J21851_1001843 3300001976 Bacteria 2833
4 JGI24737J22298_10031499 3300001990 Bacteria 1655
5 JGI24743J22301_10008285 3300001991 Bacteria 1821
6 JGI24751J29686_10002036 3300002459 Bacteria 4111
7 Ga0065715_10003717 3300005293 Bacteria 7453
8 Ga0070658_10328489 3300005327 Bacteria 1307
9 Ga0070683_100004307 3300005329 Bacteria 11694
10 Ga0070683_100139263 3300005329 Bacteria 2298
11 Ga0070683_100157724 3300005329 Bacteria 2152
12 Ga0070690_100015084 3300005330 Bacteria 4601
13 Ga0070690_100022283 3300005330 Bacteria 3874
14 Ga0070670_100023390 3300005331 Bacteria 5319
15 Ga0070670_100122833 3300005331 Bacteria 2240
16 Ga0068869_100002236 3300005334 Bacteria 11639
17 Ga0068869_100011446 3300005334 Bacteria 5818
18 Ga0068869_100017411 3300005334 Bacteria 4869
19 Ga0070680_100035734 3300005336 Bacteria 4012
20 Ga0070680_100240240 3300005336 Bacteria 1531
21 Ga0070682_100009553 3300005337 Bacteria 5490
22 Ga0070682_100230036 3300005337 Bacteria 1325
23 Ga0068868_100007545 3300005338 Bacteria 7747
24 Ga0068868_100075740 3300005338 Bacteria 2689
25 Ga0068868_100108423 3300005338 Bacteria 2254
26 Ga0070660_100006852 3300005339 Bacteria 7904
27 Ga0070689_100003196 3300005340 Bacteria 10846
28 Ga0070687_100001672 3300005343 Bacteria 7952
29 Ga0070687_100031206 3300005343 Bacteria 2613
30 Ga0070687_100123236 3300005343 Bacteria 1486
31 Ga0070661_100017652 3300005344 Bacteria 5064
32 Ga0070668_100007682 3300005347 Bacteria 8003
33 Ga0070668_100188989 3300005347 Bacteria 1686
34 Ga0070669_100004996 3300005353 Bacteria 9582
35 Ga0070675_100351827 3300005354 Bacteria 1306
36 Ga0070671_100062703 3300005355 Bacteria 3095
37 Ga0070671_100160363 3300005355 Bacteria 1901
38 Ga0070671_100450640 3300005355 Bacteria 1104
39 Ga0070674_100173321 3300005356 Bacteria 1647
40 Ga0070674_100386839 3300005356 Bacteria 1139
41 Ga0070673_100157983 3300005364 Bacteria 1926
42 Ga0070688_100005261 3300005365 Bacteria 6804
43 Ga0070659_100004378 3300005366 Bacteria 10084
44 Ga0070659_100062481 3300005366 Bacteria 2944
45 Ga0070667_100286470 3300005367 Bacteria 1480
46 Ga0070703_10000180 3300005406 Bacteria 30778
47 Ga0070709_10000239 3300005434 Bacteria 35494
48 Ga0070709_10020149 3300005434 Bacteria 3866
49 Ga0070709_10027108 3300005434 Bacteria 3404
50 Ga0070709_10050061 3300005434 Bacteria 2615
51 Ga0070709_10109437 3300005434 Bacteria 1855
52 Ga0070709_10132179 3300005434 Bacteria 1705
53 Ga0070714_100000856 3300005435 Bacteria 21568
54 Ga0070714_100008832 3300005435 Bacteria 7880
55 Ga0070714_100073890 3300005435 Bacteria 2955
56 Ga0070714_100239011 3300005435 Bacteria 1676
57 Ga0070714_100291501 3300005435 Bacteria 1519
58 Ga0070714_100333963 3300005435 Bacteria 1420
59 Ga0070714_100367445 3300005435 Bacteria 1354
60 Ga0070714_100564080 3300005435 Bacteria 1091
61 Ga0070713_100000360 3300005436 Bacteria 29345
62 Ga0070713_100004242 3300005436 Bacteria 9582
63 Ga0070713_100014312 3300005436 Bacteria 5885
64 Ga0070713_100026872 3300005436 Bacteria 4525
65 Ga0070713_100032544 3300005436 Bacteria 4166
66 Ga0070713_100051288 3300005436 Bacteria 3411
67 Ga0070713_100117931 3300005436 Bacteria 2323
68 Ga0070713_100193065 3300005436 Bacteria 1836
69 Ga0070713_100206262 3300005436 Bacteria 1777
70 Ga0070713_100292702 3300005436 Bacteria 1497
71 Ga0070710_10010491 3300005437 Bacteria 4553
72 Ga0070710_10022643 3300005437 Bacteria 3290
73 Ga0070710_10095494 3300005437 Bacteria 1761
74 Ga0070711_100001201 3300005439 Bacteria 13994
75 Ga0070711_100007569 3300005439 Bacteria 6607
76 Ga0070711_100008970 3300005439 Bacteria 6137
77 Ga0070711_100019872 3300005439 Bacteria 4319
78 Ga0070711_100022589 3300005439 Bacteria 4079
79 Ga0070711_100194108 3300005439 Bacteria 1562
80 Ga0070700_100164844 3300005441 Bacteria 1529
81 Ga0070694_100070239 3300005444 Bacteria 2411
82 Ga0070708_100001697 3300005445 Bacteria 16926
83 Ga0070708_100003461 3300005445 Bacteria 12350
84 Ga0070708_100039370 3300005445 Bacteria 4135
85 Ga0070708_100041680 3300005445 Bacteria 4026
86 Ga0070708_100048506 3300005445 Bacteria 3754
87 Ga0070708_100078984 3300005445 Bacteria 2975
88 Ga0070708_100150725 3300005445 Bacteria 2162
89 Ga0070663_100012971 3300005455 Bacteria 5293
90 Ga0070678_100059690 3300005456 Bacteria 2804
91 Ga0070678_100104462 3300005456 Bacteria 2203
92 Ga0070662_100008630 3300005457 Bacteria 6650
93 Ga0070662_100080309 3300005457 Bacteria 2427
94 Ga0070681_10000180 3300005458 Bacteria 48456
95 Ga0070681_10000891 3300005458 Bacteria 25234
96 Ga0070681_10011218 3300005458 Bacteria 8862
97 Ga0070681_10029839 3300005458 Bacteria 5474
98 Ga0070681_10039754 3300005458 Bacteria 4715
99 Ga0070681_10129675 3300005458 Bacteria 2454
100 Ga0070681_10157642 3300005458 Bacteria 2194
101 Ga0070681_10166835 3300005458 Bacteria 2124
102 Ga0070681_10293504 3300005458 Bacteria 1536
103 Ga0068867_100016541 3300005459 Bacteria 5238
104 Ga0070685_10001839 3300005466 Bacteria 11058
105 Ga0070706_100001253 3300005467 Bacteria 27172
106 Ga0070706_100001796 3300005467 Bacteria 22211
107 Ga0070706_100005474 3300005467 Bacteria 12095
108 Ga0070706_100021239 3300005467 Bacteria 5980
109 Ga0070706_100074273 3300005467 Bacteria 3147
110 Ga0070706_100208210 3300005467 Bacteria 1826
111 Ga0070706_100394516 3300005467 Bacteria 1288
112 Ga0070706_100399084 3300005467 Bacteria 1280
113 Ga0070707_100049046 3300005468 Bacteria 4047
114 Ga0070707_100101068 3300005468 Bacteria 2794
115 Ga0070707_100102563 3300005468 Bacteria 2772
116 Ga0070707_100106905 3300005468 Bacteria 2714
117 Ga0070707_100108953 3300005468 Bacteria 2686
118 Ga0070707_100190273 3300005468 Bacteria 2001
119 Ga0070707_100229757 3300005468 Bacteria 1806
120 Ga0070707_100408554 3300005468 Bacteria 1318
121 Ga0070698_100000377 3300005471 Bacteria 46568
122 Ga0070698_100151436 3300005471 Bacteria 2267
123 Ga0070698_100157953 3300005471 Bacteria 2213
124 Ga0070698_100181737 3300005471 Bacteria 2041
125 Ga0070698_100283212 3300005471 Bacteria 1589
126 Ga0070699_100018218 3300005518 Bacteria 6034
127 Ga0070699_100020126 3300005518 Bacteria 5752
128 Ga0070699_100034476 3300005518 Bacteria 4374
129 Ga0070699_100059226 3300005518 Bacteria 3317
130 Ga0070699_100086358 3300005518 Bacteria 2738
131 Ga0070679_100006223 3300005530 Bacteria 11117
132 Ga0070679_100006981 3300005530 Bacteria 10539
133 Ga0070679_100342173 3300005530 Bacteria 1444
134 Ga0070684_100020140 3300005535 Bacteria 5535
135 Ga0070684_100028928 3300005535 Bacteria 4691
136 Ga0070684_100035533 3300005535 Bacteria 4265
137 Ga0070684_100036580 3300005535 Bacteria 4207
138 Ga0070684_100036678 3300005535 Bacteria 4201
139 Ga0070684_100047392 3300005535 Bacteria 3724
140 Ga0070697_100000871 3300005536 Bacteria 22677
141 Ga0070697_100001846 3300005536 Bacteria 16183
142 Ga0070697_100002169 3300005536 Bacteria 15041
143 Ga0070697_100003516 3300005536 Bacteria 12038
144 Ga0070697_100140374 3300005536 Bacteria 2032
145 Ga0070697_100241448 3300005536 Bacteria 1543
146 Ga0068853_100018638 3300005539 Bacteria 5746
147 Ga0068853_100031938 3300005539 Bacteria 4457
148 Ga0068853_100033227 3300005539 Bacteria 4375
149 Ga0068853_100084737 3300005539 Bacteria 2777
150 Ga0068853_100129469 3300005539 Bacteria 2258
151 Ga0068853_100354835 3300005539 Bacteria 1365
152 Ga0068853_100375032 3300005539 Bacteria 1328
153 Ga0070672_100041793 3300005543 Bacteria 3527
154 Ga0070672_100286362 3300005543 Bacteria 1394
155 Ga0070696_100098539 3300005546 Bacteria 2091
156 Ga0070693_100017771 3300005547 Bacteria 3704
157 Ga0070693_100120184 3300005547 Bacteria 1628
158 Ga0070693_100209676 3300005547 Bacteria 1271
159 Ga0070693_100314526 3300005547 Bacteria 1060
160 Ga0070704_100211243 3300005549 Bacteria 1572
161 Ga0068855_100000731 3300005563 Bacteria 40322
162 Ga0068855_100005009 3300005563 Bacteria 16169
163 Ga0068855_100014042 3300005563 Bacteria 9654
164 Ga0068855_100092940 3300005563 Bacteria 3478
165 Ga0068855_100109461 3300005563 Bacteria 3173
166 Ga0068855_100166953 3300005563 Bacteria 2494
167 Ga0068855_100524597 3300005563 Bacteria 1284
168 Ga0068855_100676905 3300005563 Bacteria 1106
169 Ga0070664_100000087 3300005564 Bacteria 58652
170 Ga0070664_100018211 3300005564 Bacteria 5764
171 Ga0068857_100000022 3300005577 Bacteria 87864
172 Ga0068857_100011580 3300005577 Bacteria 7673
173 Ga0068857_100021339 3300005577 Bacteria 5701
174 Ga0068854_100012974 3300005578 Bacteria 5459
175 Ga0068854_100090623 3300005578 Bacteria 2274
176 Ga0068854_100100998 3300005578 Bacteria 2163
177 Ga0068854_100109871 3300005578 Bacteria 2078
178 Ga0068854_100128820 3300005578 Bacteria 1930
179 Ga0068856_100000410 3300005614 Bacteria 47268
180 Ga0068856_100000739 3300005614 Bacteria 35433
181 Ga0068856_100001181 3300005614 Bacteria 27502
182 Ga0068856_100002578 3300005614 Bacteria 18679
183 Ga0068856_100011083 3300005614 Bacteria 8755
184 Ga0068856_100076126 3300005614 Bacteria 3324
185 Ga0068856_100130317 3300005614 Bacteria 2519
186 Ga0068856_100138123 3300005614 Bacteria 2443
187 Ga0070702_100002904 3300005615 Bacteria 7544
188 Ga0068852_100025109 3300005616 Bacteria 4824
189 Ga0068852_100030012 3300005616 Bacteria 4471
190 Ga0068852_100058943 3300005616 Bacteria 3328
191 Ga0068852_100115664 3300005616 Bacteria 2446
192 Ga0068852_100359463 3300005616 Bacteria 1424
193 Ga0068859_100001880 3300005617 Bacteria 21381
194 Ga0068859_100022587 3300005617 Bacteria 6308
195 Ga0068859_100035721 3300005617 Bacteria 4987
196 Ga0068859_100039246 3300005617 Bacteria 4750
197 Ga0068859_100527612 3300005617 Bacteria 1275
198 Ga0068864_100000346 3300005618 Bacteria 40844
199 Ga0068864_100004418 3300005618 Bacteria 11548
200 Ga0068864_100325986 3300005618 Bacteria 1443
201 Ga0068866_10006316 3300005718 Bacteria 4932
202 Ga0068866_10013291 3300005718 Bacteria 3609
203 Ga0068851_10003700 3300005834 Bacteria 6829
204 Ga0068851_10071913 3300005834 Bacteria 1791
205 Ga0068851_10085639 3300005834 Bacteria 1652
206 Ga0068870_10006161 3300005840 Bacteria 5273
207 Ga0068870_10146559 3300005840 Bacteria 1386
208 Ga0068863_100042162 3300005841 Bacteria 4336
209 Ga0068863_100098461 3300005841 Bacteria 2777
210 Ga0068863_100133670 3300005841 Bacteria 2369
211 Ga0068858_100000464 3300005842 Bacteria 42303
212 Ga0068858_100000877 3300005842 Bacteria 31159
213 Ga0068858_100001474 3300005842 Bacteria 24214
214 Ga0068858_100012040 3300005842 Bacteria 8154
215 Ga0068858_100021337 3300005842 Bacteria 6050
216 Ga0068860_100011844 3300005843 Bacteria 8597
217 Ga0068860_100253005 3300005843 Bacteria 1716
218 Ga0068862_100018758 3300005844 Bacteria 5764
219 Ga0068862_100037296 3300005844 Bacteria 4119
220 Ga0081455_10010159 3300005937 Bacteria 9586
221 Ga0081538_10002864 3300005981 Bacteria 16489
222 Ga0081540_1050442 3300005983 Bacteria 2067
223 Ga0081539_10001013 3300005985 Bacteria 51835
224 Ga0070717_10001456 3300006028 Bacteria 16333
225 Ga0070717_10001633 3300006028 Bacteria 15571
226 Ga0070717_10003367 3300006028 Bacteria 11417
227 Ga0070717_10008634 3300006028 Bacteria 7618
228 Ga0070717_10013932 3300006028 Bacteria 6176
229 Ga0070717_10019612 3300006028 Bacteria 5307
230 Ga0070717_10021416 3300006028 Bacteria 5094
231 Ga0070717_10034415 3300006028 Bacteria 4095
232 Ga0070717_10050326 3300006028 Bacteria 3424
233 Ga0070717_10052853 3300006028 Bacteria 3348
234 Ga0070717_10140344 3300006028 Bacteria 2084
235 Ga0070717_10144123 3300006028 Bacteria 2056
236 Ga0070717_10223028 3300006028 Bacteria 1657
237 Ga0070717_10252366 3300006028 Bacteria 1559
238 Ga0070717_10270196 3300006028 Bacteria 1506
239 Ga0070717_10303809 3300006028 Bacteria 1419
240 Ga0070717_10387639 3300006028 Bacteria 1254
241 Ga0070717_10413497 3300006028 Bacteria 1213
242 Ga0070716_100008033 3300006173 Bacteria 5224
243 Ga0070716_100017755 3300006173 Bacteria 3694
244 Ga0070716_100041651 3300006173 Bacteria 2560
245 Ga0070716_100048472 3300006173 Bacteria 2401
246 Ga0070716_100070336 3300006173 Bacteria 2054
247 Ga0070716_100077073 3300006173 Bacteria 1978
248 Ga0070716_100153214 3300006173 Bacteria 1485
249 Ga0070716_100180045 3300006173 Bacteria 1387
250 Ga0070712_100000078 3300006175 Bacteria 50716
251 Ga0070712_100000144 3300006175 Bacteria 37241
252 Ga0070712_100000417 3300006175 Bacteria 24349
253 Ga0070712_100001771 3300006175 Bacteria 13214
254 Ga0070712_100003621 3300006175 Bacteria 9527
255 Ga0070712_100112627 3300006175 Bacteria 2033
256 Ga0070712_100360849 3300006175 Bacteria 1191
257 Ga0097621_100000919 3300006237 Bacteria 20591
258 Ga0097621_100007579 3300006237 Bacteria 7778
259 Ga0097621_100045073 3300006237 Bacteria 3561
260 Ga0068871_100000052 3300006358 Bacteria 64030
261 Ga0068871_100015072 3300006358 Bacteria 5777
262 Ga0068871_100243629 3300006358 Bacteria 1564
263 Ga0075433_10001306 3300006852 Bacteria 18252
264 Ga0075434_100000857 3300006871 Bacteria 24283
265 Ga0075434_100039047 3300006871 Bacteria 4704
266 Ga0075434_100047457 3300006871 Bacteria 4263
267 Ga0075434_100197010 3300006871 Unclassified 2034
268 Ga0075434_100247452 3300006871 Bacteria 1802
269 Ga0068865_100010163 3300006881 Bacteria 5851
270 Ga0068865_100012955 3300006881 Bacteria 5258
271 Ga0068865_100093535 3300006881 Bacteria 2186
272 Ga0075436_100016201 3300006914 Bacteria 5104
273 Ga0075436_100024840 3300006914 Bacteria 4121
274 Ga0097620_100001880 3300006931 Bacteria 21381
275 Ga0097620_100022589 3300006931 Bacteria 6308
276 Ga0097620_100035721 3300006931 Bacteria 4987
277 Ga0097620_100039246 3300006931 Bacteria 4750
278 Ga0097620_100527611 3300006931 Bacteria 1275
279 Ga0075435_100000556 3300007076 Bacteria 22959
280 Ga0075435_100386839 3300007076 Bacteria 1202
281 Ga0099794_10004350 3300007265 Bacteria 5548
282 Ga0099794_10028890 3300007265 Bacteria 2581
283 Ga0099794_10053067 3300007265 Bacteria 1954
284 Ga0099794_10057610 3300007265 Bacteria 1883
285 Ga0099794_10108124 3300007265 Bacteria 1392
286 Ga0099795_10085357 3300007788 Bacteria 1215
287 Ga0105240_10007121 3300009093 Bacteria 16294
288 Ga0105240_10021394 3300009093 Bacteria 8604
289 Ga0105240_10045364 3300009093 Bacteria 5577
290 Ga0105240_10080666 3300009093 Bacteria 4001
291 Ga0105240_10095763 3300009093 Bacteria 3619
292 Ga0105240_10097863 3300009093 Bacteria 3575
293 Ga0105240_10228420 3300009093 Bacteria 2164
294 Ga0105240_10563178 3300009093 Bacteria 1259
295 Ga0105245_10015611 3300009098 Bacteria 6623
296 Ga0105245_10016512 3300009098 Bacteria 6442
297 Ga0105245_10027256 3300009098 Bacteria 5035
298 Ga0105245_10345181 3300009098 Bacteria 1473
299 Ga0105247_10010373 3300009101 Bacteria 5635
300 Ga0105247_10121663 3300009101 Bacteria 1692
301 Ga0105247_10145925 3300009101 Bacteria 1555
302 Ga0114129_10017168 3300009147 Bacteria 10308
303 Ga0114129_10106941 3300009147 Bacteria 3864
304 Ga0114129_10259485 3300009147 Bacteria 2330
305 Ga0105241_10001816 3300009174 Bacteria 16204
306 Ga0105241_10073238 3300009174 Bacteria 2664
307 Ga0105241_10153634 3300009174 Bacteria 1885
308 Ga0105241_10167305 3300009174 Bacteria 1813
309 Ga0105241_10252015 3300009174 Bacteria 1497
310 Ga0105242_10064758 3300009176 Bacteria 3014
311 Ga0105242_10139336 3300009176 Bacteria 2103
312 Ga0105242_10157528 3300009176 Bacteria 1985
313 Ga0105248_10015215 3300009177 Bacteria 8478
314 Ga0105248_10103001 3300009177 Bacteria 3217
315 Ga0105248_10399286 3300009177 Bacteria 1548
316 Ga0105248_10409575 3300009177 Bacteria 1526
317 Ga0105237_10004117 3300009545 Bacteria 16957
318 Ga0105237_10016434 3300009545 Bacteria 7688
319 Ga0105237_10031400 3300009545 Bacteria 5387
320 Ga0105237_10159054 3300009545 Bacteria 2257
321 Ga0105237_10298591 3300009545 Bacteria 1614
322 Ga0105238_10000289 3300009551 Bacteria 55836
323 Ga0105238_10054347 3300009551 Bacteria 4022
324 Ga0105238_10101107 3300009551 Bacteria 2866
325 Ga0105238_10122377 3300009551 Bacteria 2581
326 Ga0105249_10007189 3300009553 Bacteria 9723
327 Ga0105249_10046101 3300009553 Bacteria 3968
328 Ga0105249_10049761 3300009553 Bacteria 3822
329 Ga0105239_10021807 3300010375 Bacteria 7060
330 Ga0105239_10036895 3300010375 Bacteria 5362
331 Ga0105239_10037949 3300010375 Bacteria 5279
332 Ga0105239_10078952 3300010375 Bacteria 3622
333 Ga0105239_10207651 3300010375 Bacteria 2195
334 Ga0105246_10000186 3300011119 Bacteria 30726
335 Ga0157373_10001268 3300013100 Bacteria 19302
336 Ga0157373_10002705 3300013100 Bacteria 13429
337 Ga0157373_10031851 3300013100 Bacteria 3797
338 Ga0157373_10043671 3300013100 Bacteria 3201
339 Ga0157371_10001319 3300013102 Bacteria 26056
340 Ga0157371_10008775 3300013102 Bacteria 8018
341 Ga0157369_10000243 3300013105 Bacteria 75602
342 Ga0157369_10008810 3300013105 Bacteria 11560
343 Ga0157369_10030947 3300013105 Bacteria 5897
344 Ga0157369_10062795 3300013105 Bacteria 4002
345 Ga0157369_10086211 3300013105 Bacteria 3354
346 Ga0157369_10141900 3300013105 Bacteria 2542
347 Ga0157369_10165544 3300013105 Bacteria 2332
348 Ga0157369_10200044 3300013105 Bacteria 2097
349 Ga0157369_10222449 3300013105 Bacteria 1975
350 Ga0157369_10274930 3300013105 Bacteria 1755
351 Ga0157369_10339496 3300013105 Bacteria 1560
352 Ga0157374_10000592 3300013296 Bacteria 32031
353 Ga0157374_10010583 3300013296 Bacteria 7939
354 Ga0157374_10011911 3300013296 Bacteria 7547
355 Ga0157374_10096189 3300013296 Bacteria 2832
356 Ga0157374_10110913 3300013296 Bacteria 2639
357 Ga0157374_10290997 3300013296 Bacteria 1614
358 Ga0157378_10000060 3300013297 Bacteria 95816
359 Ga0157378_10000401 3300013297 Bacteria 42628
360 Ga0157378_10000473 3300013297 Bacteria 38260
361 Ga0157378_10004143 3300013297 Bacteria 12801
362 Ga0157378_10153419 3300013297 Bacteria 2147
363 Ga0157378_10280610 3300013297 Bacteria 1606
364 Ga0157378_10370592 3300013297 Bacteria 1404
365 Ga0163162_10015691 3300013306 Bacteria 7401
366 Ga0163162_10309776 3300013306 Bacteria 1711
367 Ga0163162_10319513 3300013306 Bacteria 1685
368 Ga0163162_10394005 3300013306 Bacteria 1517
369 Ga0157372_10000515 3300013307 Bacteria 42626
370 Ga0157372_10000528 3300013307 Bacteria 42366
371 Ga0157372_10001520 3300013307 Bacteria 25216
372 Ga0157372_10002399 3300013307 Bacteria 20289
373 Ga0157372_10008218 3300013307 Bacteria 11092
374 Ga0157372_10017704 3300013307 Bacteria 7649
375 Ga0157372_10125910 3300013307 Bacteria 2946
376 Ga0157372_10155403 3300013307 Bacteria 2642
377 Ga0157372_10159437 3300013307 Bacteria 2607
378 Ga0157372_10220692 3300013307 Bacteria 2197
379 Ga0157375_10044223 3300013308 Bacteria 4325
380 Ga0157375_10088590 3300013308 Bacteria 3150
381 Ga0157375_10160733 3300013308 Bacteria 2388
382 Ga0163163_10004316 3300014325 Bacteria 12113
383 Ga0163163_10041804 3300014325 Bacteria 4485
384 Ga0163163_10043013 3300014325 Bacteria 4427
385 Ga0163163_10061466 3300014325 Bacteria 3722
386 Ga0163163_10203848 3300014325 Bacteria 2026
387 Ga0163163_10269433 3300014325 Bacteria 1754
388 Ga0157380_10017304 3300014326 Bacteria 5334
389 Ga0157380_10031025 3300014326 Bacteria 4099
390 Ga0157380_10159067 3300014326 Bacteria 1961
391 Ga0182008_10007630 3300014497 Bacteria 5963
392 Ga0182008_10051282 3300014497 Bacteria 2047
393 Ga0157377_10000320 3300014745 Bacteria 21845
394 Ga0157379_10001576 3300014968 Bacteria 18790
395 Ga0157379_10076789 3300014968 Bacteria 2991
396 Ga0157376_10005780 3300014969 Bacteria 8665
397 Ga0157376_10021281 3300014969 Bacteria 5037
398 Ga0157376_10160917 3300014969 Bacteria 2035
399 Ga0157376_10177276 3300014969 Bacteria 1945
400 Ga0157376_10211656 3300014969 Bacteria 1790
401 Ga0157376_10243331 3300014969 Bacteria 1677
402 Ga0157376_10587466 3300014969 Bacteria 1107
403 Ga0182007_10003904 3300015262 Bacteria 6913
404 Ga0163161_10137307 3300017792 Bacteria 1849
405 Ga0206350_11181967 3300020080 Bacteria 1025
406 Ga0224712_10109610 3300022467 Bacteria 1182
407 Ga0224712_10114939 3300022467 Bacteria 1158
408 Ga0228598_1005699 3300024227 Bacteria 2595
409 Ga0228598_1010671 3300024227 Bacteria 1828
410 Ga0207697_10009367 3300025315 Bacteria 4236
411 Ga0207656_10020929 3300025321 Bacteria 2606
412 Ga0207656_10058301 3300025321 Bacteria 1686
413 Ga0207653_10000154 3300025885 Bacteria 48375
414 Ga0207682_10005060 3300025893 Bacteria 5405
415 Ga0207692_10007181 3300025898 Bacteria 4551
416 Ga0207692_10009833 3300025898 Bacteria 4009
417 Ga0207692_10077060 3300025898 Bacteria 1773
418 Ga0207692_10119081 3300025898 Bacteria 1476
419 Ga0207692_10143437 3300025898 Bacteria 1361
420 Ga0207642_10007939 3300025899 Bacteria 3611
421 Ga0207642_10104299 3300025899 Bacteria 1430
422 Ga0207710_10117860 3300025900 Bacteria 1266
423 Ga0207688_10000597 3300025901 Bacteria 17734
424 Ga0207680_10173344 3300025903 Bacteria 1454
425 Ga0207647_10006998 3300025904 Bacteria 8180
426 Ga0207647_10008098 3300025904 Bacteria 7553
427 Ga0207647_10081576 3300025904 Bacteria 1938
428 Ga0207685_10005715 3300025905 Bacteria 3315
429 Ga0207685_10066288 3300025905 Bacteria 1448
430 Ga0207699_10000485 3300025906 Bacteria 20152
431 Ga0207699_10009722 3300025906 Bacteria 4800
432 Ga0207699_10015505 3300025906 Bacteria 3960
433 Ga0207699_10016058 3300025906 Bacteria 3906
434 Ga0207699_10021767 3300025906 Bacteria 3462
435 Ga0207699_10022889 3300025906 Bacteria 3393
436 Ga0207699_10124924 3300025906 Bacteria 1669
437 Ga0207645_10000104 3300025907 Bacteria 62309
438 Ga0207643_10000528 3300025908 Bacteria 24521
439 Ga0207705_10024493 3300025909 Bacteria 4307
440 Ga0207684_10000419 3300025910 Bacteria 56628
441 Ga0207684_10016521 3300025910 Bacteria 6336
442 Ga0207684_10068995 3300025910 Bacteria 3005
443 Ga0207684_10074338 3300025910 Bacteria 2887
444 Ga0207684_10341216 3300025910 Bacteria 1290
445 Ga0207654_10009858 3300025911 Bacteria 4858
446 Ga0207654_10034836 3300025911 Bacteria 2800
447 Ga0207654_10059968 3300025911 Bacteria 2221
448 Ga0207654_10189842 3300025911 Bacteria 1346
449 Ga0207707_10004586 3300025912 Bacteria 12139
450 Ga0207707_10011392 3300025912 Bacteria 7744
451 Ga0207707_10153921 3300025912 Bacteria 2010
452 Ga0207707_10201700 3300025912 Bacteria 1734
453 Ga0207707_10431752 3300025912 Bacteria 1128
454 Ga0207695_10000410 3300025913 Bacteria 95284
455 Ga0207695_10014311 3300025913 Bacteria 9406
456 Ga0207695_10028981 3300025913 Bacteria 6127
457 Ga0207695_10103899 3300025913 Bacteria 2832
458 Ga0207695_10180887 3300025913 Bacteria 2029
459 Ga0207671_10022279 3300025914 Bacteria 4791
460 Ga0207693_10000006 3300025915 Bacteria 185928
461 Ga0207693_10000011 3300025915 Bacteria 160684
462 Ga0207693_10001200 3300025915 Bacteria 23140
463 Ga0207693_10009111 3300025915 Bacteria 8103
464 Ga0207693_10016931 3300025915 Bacteria 5821
465 Ga0207693_10090250 3300025915 Bacteria 2402
466 Ga0207693_10148938 3300025915 Bacteria 1840
467 Ga0207693_10226822 3300025915 Bacteria 1467
468 Ga0207693_10377651 3300025915 Bacteria 1108
469 Ga0207663_10000864 3300025916 Bacteria 13769
470 Ga0207663_10002456 3300025916 Bacteria 8919
471 Ga0207663_10038544 3300025916 Bacteria 2890
472 Ga0207663_10044185 3300025916 Bacteria 2734
473 Ga0207663_10068288 3300025916 Bacteria 2282
474 Ga0207663_10393594 3300025916 Bacteria 1058
475 Ga0207660_10073621 3300025917 Bacteria 2491
476 Ga0207662_10002647 3300025918 Bacteria 9031
477 Ga0207657_10001184 3300025919 Bacteria 27712
478 Ga0207657_10011385 3300025919 Bacteria 8834
479 Ga0207649_10005097 3300025920 Bacteria 7101
480 Ga0207652_10015281 3300025921 Bacteria 6232
481 Ga0207652_10017488 3300025921 Bacteria 5867
482 Ga0207652_10121732 3300025921 Bacteria 2322
483 Ga0207652_10403751 3300025921 Bacteria 1233
484 Ga0207646_10022717 3300025922 Bacteria 5772
485 Ga0207646_10073918 3300025922 Bacteria 3045
486 Ga0207646_10079517 3300025922 Bacteria 2931
487 Ga0207646_10090516 3300025922 Bacteria 2739
488 Ga0207646_10129481 3300025922 Bacteria 2271
489 Ga0207646_10155813 3300025922 Bacteria 2060
490 Ga0207646_10157712 3300025922 Bacteria 2047
491 Ga0207646_10357849 3300025922 Bacteria 1319
492 Ga0207681_10007220 3300025923 Bacteria 6814
493 Ga0207681_10017508 3300025923 Bacteria 4499
494 Ga0207694_10002431 3300025924 Bacteria 15191
495 Ga0207694_10110946 3300025924 Bacteria 2182
496 Ga0207650_10000170 3300025925 Bacteria 77357
497 Ga0207650_10053861 3300025925 Bacteria 2983
498 Ga0207659_10240891 3300025926 Bacteria 1463
499 Ga0207659_10315484 3300025926 Bacteria 1288
500 Ga0207687_10006392 3300025927 Bacteria 7787
501 Ga0207687_10064283 3300025927 Bacteria 2601
502 Ga0207687_10113417 3300025927 Bacteria 2016
503 Ga0207700_10000226 3300025928 Bacteria 33757
504 Ga0207700_10000720 3300025928 Bacteria 19120
505 Ga0207700_10003638 3300025928 Bacteria 8988
506 Ga0207700_10003942 3300025928 Bacteria 8678
507 Ga0207700_10006793 3300025928 Bacteria 6951
508 Ga0207700_10019216 3300025928 Bacteria 4612
509 Ga0207700_10026639 3300025928 Bacteria 4034
510 Ga0207700_10120801 3300025928 Bacteria 2124
511 Ga0207700_10193476 3300025928 Bacteria 1710
512 Ga0207700_10406714 3300025928 Bacteria 1193
513 Ga0207700_10431791 3300025928 Bacteria 1158
514 Ga0207664_10000045 3300025929 Bacteria 141234
515 Ga0207664_10023009 3300025929 Bacteria 4663
516 Ga0207664_10047640 3300025929 Bacteria 3368
517 Ga0207664_10090866 3300025929 Bacteria 2502
518 Ga0207664_10162807 3300025929 Bacteria 1904
519 Ga0207664_10179586 3300025929 Bacteria 1816
520 Ga0207664_10327616 3300025929 Bacteria 1352
521 Ga0207664_10396882 3300025929 Bacteria 1226
522 Ga0207664_10409470 3300025929 Bacteria 1207
523 Ga0207644_10016560 3300025931 Bacteria 4960
524 Ga0207690_10057113 3300025932 Bacteria 2636
525 Ga0207706_10001873 3300025933 Bacteria 20609
526 Ga0207706_10014855 3300025933 Bacteria 7050
527 Ga0207706_10255235 3300025933 Bacteria 1531
528 Ga0207669_10044041 3300025937 Bacteria 2618
529 Ga0207704_10005736 3300025938 Bacteria 5739
530 Ga0207704_10006259 3300025938 Bacteria 5535
531 Ga0207665_10005003 3300025939 Bacteria 8845
532 Ga0207665_10013069 3300025939 Bacteria 5456
533 Ga0207665_10028371 3300025939 Bacteria 3697
534 Ga0207665_10060535 3300025939 Bacteria 2564
535 Ga0207665_10068511 3300025939 Bacteria 2418
536 Ga0207665_10074372 3300025939 Bacteria 2325
537 Ga0207665_10108627 3300025939 Bacteria 1946
538 Ga0207665_10118993 3300025939 Bacteria 1864
539 Ga0207665_10178344 3300025939 Bacteria 1538
540 Ga0207691_10000417 3300025940 Bacteria 42618
541 Ga0207711_10029648 3300025941 Bacteria 4616
542 Ga0207711_10030858 3300025941 Bacteria 4522
543 Ga0207711_10250952 3300025941 Bacteria 1625
544 Ga0207689_10002439 3300025942 Bacteria 17321
545 Ga0207689_10006208 3300025942 Bacteria 10586
546 Ga0207689_10019498 3300025942 Bacteria 5716
547 Ga0207661_10000817 3300025944 Bacteria 20387
548 Ga0207661_10173838 3300025944 Bacteria 1877
549 Ga0207661_10182404 3300025944 Bacteria 1835
550 Ga0207661_10241982 3300025944 Bacteria 1601
551 Ga0207679_10000080 3300025945 Bacteria 84997
552 Ga0207679_10091647 3300025945 Bacteria 2352
553 Ga0207679_10424394 3300025945 Bacteria 1174
554 Ga0207667_10000252 3300025949 Bacteria 75421
555 Ga0207667_10000509 3300025949 Bacteria 51354
556 Ga0207667_10073216 3300025949 Bacteria 3560
557 Ga0207667_10087177 3300025949 Bacteria 3230
558 Ga0207651_10011661 3300025960 Bacteria 4930
559 Ga0207712_10021550 3300025961 Bacteria 4232
560 Ga0207668_10009146 3300025972 Bacteria 5923
561 Ga0207640_10029014 3300025981 Bacteria 3390
562 Ga0207640_10059338 3300025981 Bacteria 2525
563 Ga0207640_10095861 3300025981 Bacteria 2067
564 Ga0207640_10126198 3300025981 Bacteria 1842
565 Ga0207640_10135874 3300025981 Bacteria 1785
566 Ga0207640_10258691 3300025981 Bacteria 1355
567 Ga0207658_10036613 3300025986 Bacteria 3519
568 Ga0207677_10004192 3300026023 Bacteria 7715
569 Ga0207677_10023171 3300026023 Bacteria 3829
570 Ga0207677_10160473 3300026023 Bacteria 1746
571 Ga0207703_10001571 3300026035 Bacteria 20697
572 Ga0207703_10001699 3300026035 Bacteria 19791
573 Ga0207703_10015930 3300026035 Bacteria 5863
574 Ga0207703_10094531 3300026035 Bacteria 2520
575 Ga0207703_10306577 3300026035 Bacteria 1450
576 Ga0207639_10002578 3300026041 Bacteria 12167
577 Ga0207639_10038421 3300026041 Bacteria 3560
578 Ga0207639_10086420 3300026041 Bacteria 2497
579 Ga0207639_10251185 3300026041 Bacteria 1542
580 Ga0207678_10000912 3300026067 Bacteria 27031
581 Ga0207708_10033220 3300026075 Bacteria 3919
582 Ga0207702_10000120 3300026078 Bacteria 91853
583 Ga0207702_10000375 3300026078 Bacteria 50994
584 Ga0207702_10000932 3300026078 Bacteria 30177
585 Ga0207702_10017396 3300026078 Bacteria 5948
586 Ga0207702_10027846 3300026078 Bacteria 4695
587 Ga0207702_10065213 3300026078 Bacteria 3119
588 Ga0207702_10096227 3300026078 Bacteria 2603
589 Ga0207641_10001162 3300026088 Bacteria 26474
590 Ga0207641_10160178 3300026088 Bacteria 2046
591 Ga0207641_10268337 3300026088 Bacteria 1601
592 Ga0207648_10001893 3300026089 Bacteria 22866
593 Ga0207676_10000478 3300026095 Bacteria 33685
594 Ga0207676_10001493 3300026095 Bacteria 17281
595 Ga0207676_10086988 3300026095 Bacteria 2555
596 Ga0207676_10214808 3300026095 Bacteria 1709
597 Ga0207676_10223055 3300026095 Bacteria 1680
598 Ga0207674_10000056 3300026116 Bacteria 113265
599 Ga0207674_10003557 3300026116 Bacteria 19010
600 Ga0207674_10016331 3300026116 Bacteria 8132
601 Ga0207674_10186592 3300026116 Bacteria 2024
602 Ga0207674_10297635 3300026116 Bacteria 1562
603 Ga0207675_100118803 3300026118 Bacteria 2500
604 Ga0207683_10002198 3300026121 Bacteria 17157
605 Ga0207698_10041124 3300026142 Bacteria 3441
606 Ga0207698_10045079 3300026142 Bacteria 3319
607 Ga0207698_10172868 3300026142 Bacteria 1904
608 Ga0207698_10381429 3300026142 Bacteria 1341
609 Ga0209588_1007669 3300027671 Bacteria 3183
610 Ga0209588_1019478 3300027671 Bacteria 2118
611 Ga0209588_1048966 3300027671 Bacteria 1368
612 Ga0265354_1000177 3300028016 Bacteria 11765
613 Ga0265356_1000750 3300028017 Bacteria 5504
614 Ga0265356_1002947 3300028017 Bacteria 2188
615 Ga0268266_10016192 3300028379 Bacteria 6376
616 Ga0268265_10005039 3300028380 Bacteria 9064
617 Ga0268265_10412669 3300028380 Bacteria 1251
618 Ga0268264_10009243 3300028381 Bacteria 8161
619 Ga0268264_10012129 3300028381 Bacteria 7095
620 Ga0268264_10029210 3300028381 Bacteria 4515
621 Ga0268264_10153535 3300028381 Bacteria 2067
622 Ga0268264_10276184 3300028381 Bacteria 1572
623 Ga0265338_10009412 3300028800 Bacteria 11652
624 Ga0265338_10081182 3300028800 Bacteria 2720
625 Ga0265338_10106401 3300028800 Bacteria 2271
626 Ga0307511_10025810 3300030521 Bacteria 5402
627 Ga0265762_1005906 3300030760 Bacteria 2192
628 Ga0265762_1007487 3300030760 Bacteria 1947
629 Ga0265765_1000183 3300030879 Bacteria 4173
630 Ga0265760_10000360 3300031090 Bacteria 12697
631 Ga0265760_10000370 3300031090 Bacteria 12538
632 Ga0265760_10002267 3300031090 Bacteria 5628
633 Ga0265760_10010054 3300031090 Bacteria 2699
634 Ga0265339_10049076 3300031249 Bacteria 2313
635 Ga0265339_10082869 3300031249 Bacteria 1692
636 Ga0265339_10100936 3300031249 Bacteria 1502
637 Ga0265316_10074929 3300031344 Bacteria 2603
638 Ga0316575_10035494 3300031665 Bacteria 1960
639 Ga0316579_10001577 3300031691 Bacteria 8320
640 Ga0265314_10041502 3300031711 Bacteria 3292
641 Ga0316578_10017564 3300031728 Bacteria 3897
642 Ga0307516_10000679 3300031730 Bacteria 46117
643 Ga0307411_10238557 3300032005 Bacteria 1422
644 Ga0316583_10067490 3300032133 Bacteria 1251
645 Ga0307510_10016638 3300033180 Bacteria 8681
646 Ga0373926_0023988 3300035083 Bacteria 2121
647 Ga0373944_0063463 3300035089 Bacteria 1189
648 Ga0373923_0009214 3300035111 Bacteria 3555
649 Ga0373936_0000633 3300035113 Bacteria 12135
650 Ga0373945_0001385 3300035116 Bacteria 7361
651 Ga0373945_0010568 3300035116 Bacteria 3042
652 Ga0373953_0156772 3300035117 Bacteria 978
653 Ga0373954_0074547 3300035118 Bacteria 1615
654 Ga0373956_0035597 3300035119 Bacteria 2196
655 Ga0373957_0005694 3300035120 Bacteria 3878
656 Ga0373943_0000037 3300035170 Bacteria 45150
657 Ga0373943_0052022 3300035170 Bacteria 2018
658 Ga0373946_0001083 3300035171 Bacteria 9387
659 Ga0373946_0040561 3300035171 Bacteria 1905
660 Ga0373955_0029578 3300035172 Bacteria 2850
661 Ga0373955_0035681 3300035172 Bacteria 2635
662 Ga0373955_0080499 3300035172 Bacteria 1840
663 Ga0373961_0012058 3300035241 Bacteria 2157
664 Ga0373924_0000275 3300035410 Bacteria 15798
665 Ga0373924_0077198 3300035410 Bacteria 1412
666 Ga0373931_0014259 3300035691 Bacteria 3882
667 Ga0373931_0086411 3300035691 Bacteria 1740
668 Ga0373931_0179619 3300035691 Bacteria 1252
669 Ga0373935_0009168 3300035692 Bacteria 5921
670 Ga0373935_0020248 3300035692 Bacteria 4063
671 Ga0373935_0021972 3300035692 Bacteria 3907
672 Ga0373935_0109533 3300035692 Bacteria 1831
673 Ga0373935_0166137 3300035692 Bacteria 1507
674 Ga0373927_0000588 3300035695 Bacteria 27700
675 Ga0373927_0019104 3300035695 Bacteria 4495
676 Ga0373927_0019481 3300035695 Bacteria 4448
677 Ga0373927_0033243 3300035695 Bacteria 3358
678 Ga0373927_0053717 3300035695 Bacteria 2606
679 Ga0373927_0089895 3300035695 Bacteria 1994
680 Ga0373933_0002877 3300035724 Bacteria 9623
681 Ga0373933_0034336 3300035724 Bacteria 2955
682 Ga0373933_0092374 3300035724 Bacteria 1869
683 Ga0373933_0202000 3300035724 Bacteria 1272
684 Ga0373947_0000500 3300035725 Bacteria 22709
685 Ga0373947_0045144 3300035725 Bacteria 2636
686 Ga0373947_0073760 3300035725 Bacteria 2098
687 Ga0373947_0183324 3300035725 Bacteria 1363
688 Ga0373937_0000178 3300036401 Bacteria 62323
689 Ga0373937_0003904 3300036401 Bacteria 12612
690 Ga0373937_0014073 3300036401 Bacteria 7055
691 Ga0373937_0014137 3300036401 Bacteria 7039
692 Ga0373937_0021549 3300036401 Bacteria 5783
693 Ga0373937_0044035 3300036401 Bacteria 4076
694 Ga0373937_0046754 3300036401 Bacteria 3958
695 Ga0373937_0178451 3300036401 Bacteria 1994
696 Ga0316582_0009804 3300036647 Bacteria 5213
697 Ga0316582_0017918 3300036647 Bacteria 4109
698 Ga0316582_0301977 3300036647 Bacteria 1100
699 Ga0316584_0152413 3300036712 Bacteria 1720
700 Ga0373925_0000835 3300037068 Bacteria 28340
701 Ga0373925_0002017 3300037068 Bacteria 16814
702 Ga0373925_0002957 3300037068 Bacteria 13417
703 Ga0373925_0016252 3300037068 Bacteria 5387
704 Ga0373925_0044091 3300037068 Bacteria 3312
705 Ga0373925_0062608 3300037068 Unclassified 2798
706 Ga0373925_0083256 3300037068 Bacteria 2436
707 Ga0373925_0336288 3300037068 Bacteria 1224
708 Ga0373925_0391745 3300037068 Bacteria 1132
709 Ga0316581_0001543 3300037588 Bacteria 5225
710 Ga0436364_0796539 3300037853 Bacteria 1649
711 Ga0436365_1156699 3300039437 Bacteria 3719
712 Ga0436363_1481147 3300039450 Bacteria 1245
713 Ga0439434_0002833 3300042435 Bacteria 5058
714 Ga0439460_0061470 3300042461 Bacteria 1147
715 Ga0451577_0000339 3300042876 Bacteria 87540
716 Ga0453683_0008465 3300044673 Bacteria 6901
717 Ga0466964_0025086 3300044706 Bacteria 2327
718 Ga0466964_0033678 3300044706 Bacteria 2042
719 Ga0453684_0000023 3300044712 Bacteria 857153
720 Ga0453684_0000065 3300044712 Bacteria 468481
721 Ga0453684_0004352 3300044712 Bacteria 30055
722 Ga0453684_0020602 3300044712 Bacteria 9929
723 Ga0453684_0044259 3300044712 Bacteria 5962
724 Ga0453684_0056603 3300044712 Bacteria 5085
725 Ga0453684_0595182 3300044712 Bacteria 1213
726 Ga0466957_0000211 3300044842 Bacteria 27323
727 Ga0466959_0044138 3300045049 Bacteria 3285
728 Ga0466958_0093546 3300045836 Bacteria 1862
729 Ga0466967_0006641 3300045976 Bacteria 8223
730 Ga0495651_0045709 3300046462 Bacteria 3392
731 Ga0495580_0000564 3300046472 Bacteria 31314
732 Ga0495580_0000627 3300046472 Bacteria 29922
733 Ga0495580_0001315 3300046472 Bacteria 21925
734 Ga0495580_0002087 3300046472 Bacteria 17539
735 Ga0495580_0038447 3300046472 Bacteria 3427
736 Ga0495580_0038822 3300046472 Bacteria 3408
737 Ga0495580_0110946 3300046472 Bacteria 1905
738 Ga0495580_0119051 3300046472 Bacteria 1833
739 Ga0495580_0189115 3300046472 Bacteria 1420
740 Ga0495582_0001088 3300046473 Bacteria 15213
741 Ga0495582_0021283 3300046473 Bacteria 3549
742 Ga0495582_0024582 3300046473 Bacteria 3297
743 Ga0495639_0030106 3300046475 Bacteria 2412
744 Ga0495639_0098686 3300046475 Bacteria 1377
745 Ga0495664_0010894 3300046477 Bacteria 5113
746 Ga0495594_0185915 3300046499 Bacteria 1183
747 Ga0495606_0072343 3300046507 Bacteria 2167
748 Ga0495630_0219713 3300046517 Bacteria 1451
749 Ga0495665_0014740 3300046531 Bacteria 4213
750 Ga0495665_0038348 3300046531 Bacteria 2555
751 Ga0495667_0041207 3300046559 Bacteria 3063
752 Ga0495668_0000484 3300046616 Bacteria 49948
753 Ga0495635_0088033 3300046663 Bacteria 2125
754 Ga0495599_0040670 3300046678 Bacteria 2919
755 Ga0495647_0061106 3300046681 Bacteria 1487
756 Ga0495658_0084200 3300046683 Bacteria 1872
757 Ga0495669_0043226 3300046684 Bacteria 2005
758 Ga0495581_0050536 3300047315 Bacteria 2401
759 Ga0495674_0363092 3300047319 Bacteria 1174
760 Ga0495675_0147294 3300047444 Bacteria 1456
761 Ga0495684_0001956 3300047471 Bacteria 16547
762 Ga0495593_0061274 3300047673 Bacteria 1968
763 Ga0495602_0055793 3300048088 Bacteria 3478
764 Ga0495602_0087931 3300048088 Bacteria 2588
765 Ga0495602_0139185 3300048088 Bacteria 1924
766 Ga0495614_0035179 3300048089 Bacteria 2153
767 Ga0496100_0024778 3300048903 Bacteria 3664
768 Ga0496102_0003082 3300048905 Bacteria 14119
769 Ga0496102_0011664 3300048905 Bacteria 7586
770 Ga0496103_0008528 3300048906 Bacteria 6090
771 Ga0496103_0034936 3300048906 Bacteria 3076
772 Ga0496103_0205101 3300048906 Bacteria 1268
773 Ga0496104_0071248 3300048907 Bacteria 3305
774 Ga0496104_0081116 3300048907 Bacteria 3093
775 Ga0496104_0575973 3300048907 Bacteria 1036
776 Ga0496105_0009596 3300048908 Bacteria 7574
777 Ga0496105_0168695 3300048908 Bacteria 1795
778 Ga0496106_0044170 3300048909 Bacteria 3344
779 Ga0496106_0233761 3300048909 Bacteria 1468
780 Ga0496107_0098228 3300048910 Bacteria 2144
781 Ga0496108_0000335 3300048911 Bacteria 39863
782 Ga0496109_0000184 3300048912 Bacteria 62326
783 Ga0496110_0001177 3300048913 Bacteria 18607
784 Ga0496110_0065785 3300048913 Bacteria 3205
785 Ga0496111_0010299 3300048914 Bacteria 6265
786 Ga0496112_0000034 3300048915 Bacteria 107237
787 Ga0496112_0002143 3300048915 Bacteria 15667
788 Ga0496112_0003090 3300048915 Bacteria 13641
789 Ga0496112_0034612 3300048915 Bacteria 4916
790 Ga0496112_0281127 3300048915 Bacteria 1611
791 Ga0496112_0422995 3300048915 Bacteria 1271
792 Ga0496113_0002525 3300048916 Bacteria 10664
793 Ga0496113_0029345 3300048916 Bacteria 3970
794 Ga0496113_0201465 3300048916 Bacteria 1582
795 Ga0496114_0135181 3300048917 Bacteria 2132
796 Ga0496115_0001768 3300048918 Bacteria 15467
797 Ga0496115_0052123 3300048918 Bacteria 3282
798 Ga0496115_0201317 3300048918 Bacteria 1645
799 Ga0496116_0023660 3300048919 Bacteria 4568
800 Ga0496117_0000375 3300048920 Bacteria 77239
801 Ga0496118_0000040 3300048921 Bacteria 304516
802 Ga0496119_0015858 3300048922 Bacteria 5769
803 Ga0496124_0021668 3300048927 Bacteria 5918
804 Ga0496125_0136330 3300048928 Bacteria 1716
805 Ga0496126_0045840 3300048929 Bacteria 4015
806 Ga0501037_0050190 3300049573 Bacteria 3054
807 Ga0501043_0207236 3300049579 Bacteria 1520
808 Ga0501047_0331893 3300049581 Bacteria 1359
809 Ga0501035_0118313 3300049822 Bacteria 2318
810 nmdc:mga05p37_230518_c1 3300050507 Bacteria 2232
811 nmdc:mga0n895_2147_c1 3300050512 Bacteria 15221
812 nmdc:mga0n895_363922_c1 3300050512 Unclassified 1464
813 nmdc:mga0n895_36713_c1 3300050512 Bacteria 4734
814 nmdc:mga0rr50_674_c1 3300050513 Bacteria 18276
815 nmdc:mga08x19_127305_c1 3300050514 Bacteria 1711
816 nmdc:mga08x19_75465_c1 3300050514 Bacteria 2204
817 nmdc:mga08x19_93933_c1 3300050514 Bacteria 1983
818 nmdc:mga0a205_296_c1 3300050515 Bacteria 36874
819 Ga0495619_0064971 3300053085 Bacteria 2434
820 Ga0500641_0000252 3300053096 Bacteria 19951
821 Ga0500616_0000655 3300053153 Bacteria 41544
822 Ga0587066_011610 3300059490 Bacteria 1296
823 Ga0587078_011670 3300059646 Bacteria 1023
824 Ga0587079_021873 3300059647 Bacteria 1155
825 Ga0587060_005001 3300060243 Bacteria 1024
826 2687578852 2687453129 Bacteria 4387428
827 2952255777 2952252522 Bacteria 4171745
828 Ga0207677_10309464
829 JGI24741J21665_1010457
830 JGI24752J21851_1001843
831 JGI24737J22298_10031499
832 JGI24743J22301_10008285
833 JGI24751J29686_10002036
834 Ga0065715_10003717
835 Ga0070658_10328489
836 Ga0070683_100004307
837 Ga0070683_100139263
838 Ga0070683_100157724
839 Ga0070690_100015084
840 Ga0070690_100022283
841 Ga0070670_100023390
842 Ga0070670_100122833
843 Ga0068869_100002236
844 Ga0068869_100011446
845 Ga0068869_100017411
846 Ga0070680_100035734
847 Ga0070680_100240240
848 Ga0070682_100009553
849 Ga0070682_100230036
850 Ga0068868_100007545
851 Ga0068868_100075740
852 Ga0068868_100108423
853 Ga0070660_100006852
854 Ga0070689_100003196
855 Ga0070687_100001672
856 Ga0070687_100031206
857 Ga0070687_100123236
858 Ga0070661_100017652
859 Ga0070668_100007682
860 Ga0070668_100188989
861 Ga0070669_100004996
862 Ga0070675_100351827
863 Ga0070671_100062703
864 Ga0070671_100160363
865 Ga0070671_100450640
866 Ga0070674_100173321
867 Ga0070674_100386839
868 Ga0070673_100157983
869 Ga0070688_100005261
870 Ga0070659_100004378
871 Ga0070659_100062481
872 Ga0070667_100286470
873 Ga0070703_10000180
874 Ga0070709_10000239
875 Ga0070709_10020149
876 Ga0070709_10027108
877 Ga0070709_10050061
878 Ga0070709_10109437
879 Ga0070709_10132179
880 Ga0070714_100000856
881 Ga0070714_100008832
882 Ga0070714_100073890
883 Ga0070714_100239011
884 Ga0070714_100291501
885 Ga0070714_100333963
886 Ga0070714_100367445
887 Ga0070714_100564080
888 Ga0070713_100000360
889 Ga0070713_100004242
890 Ga0070713_100014312
891 Ga0070713_100026872
892 Ga0070713_100032544
893 Ga0070713_100051288
894 Ga0070713_100117931
895 Ga0070713_100193065
896 Ga0070713_100206262
897 Ga0070713_100292702
898 Ga0070710_10010491
899 Ga0070710_10022643
900 Ga0070710_10095494
901 Ga0070711_100001201
902 Ga0070711_100007569
903 Ga0070711_100008970
904 Ga0070711_100019872
905 Ga0070711_100022589
906 Ga0070711_100194108
907 Ga0070700_100164844
908 Ga0070694_100070239
909 Ga0070708_100001697
910 Ga0070708_100003461
911 Ga0070708_100039370
912 Ga0070708_100041680
913 Ga0070708_100048506
914 Ga0070708_100078984
915 Ga0070708_100150725
916 Ga0070663_100012971
917 Ga0070678_100059690
918 Ga0070678_100104462
919 Ga0070662_100008630
920 Ga0070662_100080309
921 Ga0070681_10000180
922 Ga0070681_10000891
923 Ga0070681_10011218
924 Ga0070681_10029839
925 Ga0070681_10039754
926 Ga0070681_10129675
927 Ga0070681_10157642
928 Ga0070681_10166835
929 Ga0070681_10293504
930 Ga0068867_100016541
931 Ga0070685_10001839
932 Ga0070706_100001253
933 Ga0070706_100001796
934 Ga0070706_100005474
935 Ga0070706_100021239
936 Ga0070706_100074273
937 Ga0070706_100208210
938 Ga0070706_100394516
939 Ga0070706_100399084
940 Ga0070707_100049046
941 Ga0070707_100101068
942 Ga0070707_100102563
943 Ga0070707_100106905
944 Ga0070707_100108953
945 Ga0070707_100190273
946 Ga0070707_100229757
947 Ga0070707_100408554
948 Ga0070698_100000377
949 Ga0070698_100151436
950 Ga0070698_100157953
951 Ga0070698_100181737
952 Ga0070698_100283212
953 Ga0070699_100018218
954 Ga0070699_100020126
955 Ga0070699_100034476
956 Ga0070699_100059226
957 Ga0070699_100086358
958 Ga0070679_100006223
959 Ga0070679_100006981
960 Ga0070679_100342173
961 Ga0070684_100020140
962 Ga0070684_100028928
963 Ga0070684_100035533
964 Ga0070684_100036580
965 Ga0070684_100036678
966 Ga0070684_100047392
967 Ga0070697_100000871
968 Ga0070697_100001846
969 Ga0070697_100002169
970 Ga0070697_100003516
971 Ga0070697_100140374
972 Ga0070697_100241448
973 Ga0068853_100018638
974 Ga0068853_100031938
975 Ga0068853_100033227
976 Ga0068853_100084737
977 Ga0068853_100129469
978 Ga0068853_100354835
979 Ga0068853_100375032
980 Ga0070672_100041793
981 Ga0070672_100286362
982 Ga0070696_100098539
983 Ga0070693_100017771
984 Ga0070693_100120184
985 Ga0070693_100209676
986 Ga0070693_100314526
987 Ga0070704_100211243
988 Ga0068855_100000731
989 Ga0068855_100005009
990 Ga0068855_100014042
991 Ga0068855_100092940
992 Ga0068855_100109461
993 Ga0068855_100166953
994 Ga0068855_100524597
995 Ga0068855_100676905
996 Ga0070664_100000087
997 Ga0070664_100018211
998 Ga0068857_100000022
999 Ga0068857_100011580
1000 Ga0068857_100021339
1001 Ga0068854_100012974
1002 Ga0068854_100090623
1003 Ga0068854_100100998
1004 Ga0068854_100109871
1005 Ga0068854_100128820
1006 Ga0068856_100000410
1007 Ga0068856_100000739
1008 Ga0068856_100001181
1009 Ga0068856_100002578
1010 Ga0068856_100011083
1011 Ga0068856_100076126
1012 Ga0068856_100130317
1013 Ga0068856_100138123
1014 Ga0070702_100002904
1015 Ga0068852_100025109
1016 Ga0068852_100030012
1017 Ga0068852_100058943
1018 Ga0068852_100115664
1019 Ga0068852_100359463
1020 Ga0068859_100001880
1021 Ga0068859_100022587
1022 Ga0068859_100035721
1023 Ga0068859_100039246
1024 Ga0068859_100527612
1025 Ga0068864_100000346
1026 Ga0068864_100004418
1027 Ga0068864_100325986
1028 Ga0068866_10006316
1029 Ga0068866_10013291
1030 Ga0068851_10003700
1031 Ga0068851_10071913
1032 Ga0068851_10085639
1033 Ga0068870_10006161
1034 Ga0068870_10146559
1035 Ga0068863_100042162
1036 Ga0068863_100098461
1037 Ga0068863_100133670
1038 Ga0068858_100000464
1039 Ga0068858_100000877
1040 Ga0068858_100001474
1041 Ga0068858_100012040
1042 Ga0068858_100021337
1043 Ga0068860_100011844
1044 Ga0068860_100253005
1045 Ga0068862_100018758
1046 Ga0068862_100037296
1047 Ga0081455_10010159
1048 Ga0081538_10002864
1049 Ga0081540_1050442
1050 Ga0081539_10001013
1051 Ga0070717_10001456
1052 Ga0070717_10001633
1053 Ga0070717_10003367
1054 Ga0070717_10008634
1055 Ga0070717_10013932
1056 Ga0070717_10019612
1057 Ga0070717_10021416
1058 Ga0070717_10034415
1059 Ga0070717_10050326
1060 Ga0070717_10052853
1061 Ga0070717_10140344
1062 Ga0070717_10144123
1063 Ga0070717_10223028
1064 Ga0070717_10252366
1065 Ga0070717_10270196
1066 Ga0070717_10303809
1067 Ga0070717_10387639
1068 Ga0070717_10413497
1069 Ga0070716_100008033
1070 Ga0070716_100017755
1071 Ga0070716_100041651
1072 Ga0070716_100048472
1073 Ga0070716_100070336
1074 Ga0070716_100077073
1075 Ga0070716_100153214
1076 Ga0070716_100180045
1077 Ga0070712_100000078
1078 Ga0070712_100000144
1079 Ga0070712_100000417
1080 Ga0070712_100001771
1081 Ga0070712_100003621
1082 Ga0070712_100112627
1083 Ga0070712_100360849
1084 Ga0097621_100000919
1085 Ga0097621_100007579
1086 Ga0097621_100045073
1087 Ga0068871_100000052
1088 Ga0068871_100015072
1089 Ga0068871_100243629
1090 Ga0075433_10001306
1091 Ga0075434_100000857
1092 Ga0075434_100039047
1093 Ga0075434_100047457
1094 Ga0075434_100197010
1095 Ga0075434_100247452
1096 Ga0068865_100010163
1097 Ga0068865_100012955
1098 Ga0068865_100093535
1099 Ga0075436_100016201
1100 Ga0075436_100024840
1101 Ga0097620_100001880
1102 Ga0097620_100022589
1103 Ga0097620_100035721
1104 Ga0097620_100039246
1105 Ga0097620_100527611
1106 Ga0075435_100000556
1107 Ga0075435_100386839
1108 Ga0099794_10004350
1109 Ga0099794_10028890
1110 Ga0099794_10053067
1111 Ga0099794_10057610
1112 Ga0099794_10108124
1113 Ga0099795_10085357
1114 Ga0105240_10007121
1115 Ga0105240_10021394
1116 Ga0105240_10045364
1117 Ga0105240_10080666
1118 Ga0105240_10095763
1119 Ga0105240_10097863
1120 Ga0105240_10228420
1121 Ga0105240_10563178
1122 Ga0105245_10015611
1123 Ga0105245_10016512
1124 Ga0105245_10027256
1125 Ga0105245_10345181
1126 Ga0105247_10010373
1127 Ga0105247_10121663
1128 Ga0105247_10145925
1129 Ga0114129_10017168
1130 Ga0114129_10106941
1131 Ga0114129_10259485
1132 Ga0105241_10001816
1133 Ga0105241_10073238
1134 Ga0105241_10153634
1135 Ga0105241_10167305
1136 Ga0105241_10252015
1137 Ga0105242_10064758
1138 Ga0105242_10139336
1139 Ga0105242_10157528
1140 Ga0105248_10015215
1141 Ga0105248_10103001
1142 Ga0105248_10399286
1143 Ga0105248_10409575
1144 Ga0105237_10004117
1145 Ga0105237_10016434
1146 Ga0105237_10031400
1147 Ga0105237_10159054
1148 Ga0105237_10298591
1149 Ga0105238_10000289
1150 Ga0105238_10054347
1151 Ga0105238_10101107
1152 Ga0105238_10122377
1153 Ga0105249_10007189
1154 Ga0105249_10046101
1155 Ga0105249_10049761
1156 Ga0105239_10021807
1157 Ga0105239_10036895
1158 Ga0105239_10037949
1159 Ga0105239_10078952
1160 Ga0105239_10207651
1161 Ga0105246_10000186
1162 Ga0157373_10001268
1163 Ga0157373_10002705
1164 Ga0157373_10031851
1165 Ga0157373_10043671
1166 Ga0157371_10001319
1167 Ga0157371_10008775
1168 Ga0157369_10000243
1169 Ga0157369_10008810
1170 Ga0157369_10030947
1171 Ga0157369_10062795
1172 Ga0157369_10086211
1173 Ga0157369_10141900
1174 Ga0157369_10165544
1175 Ga0157369_10200044
1176 Ga0157369_10222449
1177 Ga0157369_10274930
1178 Ga0157369_10339496
1179 Ga0157374_10000592
1180 Ga0157374_10010583
1181 Ga0157374_10011911
1182 Ga0157374_10096189
1183 Ga0157374_10110913
1184 Ga0157374_10290997
1185 Ga0157378_10000060
1186 Ga0157378_10000401
1187 Ga0157378_10000473
1188 Ga0157378_10004143
1189 Ga0157378_10153419
1190 Ga0157378_10280610
1191 Ga0157378_10370592
1192 Ga0163162_10015691
1193 Ga0163162_10309776
1194 Ga0163162_10319513
1195 Ga0163162_10394005
1196 Ga0157372_10000515
1197 Ga0157372_10000528
1198 Ga0157372_10001520
1199 Ga0157372_10002399
1200 Ga0157372_10008218
1201 Ga0157372_10017704
1202 Ga0157372_10125910
1203 Ga0157372_10155403
1204 Ga0157372_10159437
1205 Ga0157372_10220692
1206 Ga0157375_10044223
1207 Ga0157375_10088590
1208 Ga0157375_10160733
1209 Ga0163163_10004316
1210 Ga0163163_10041804
1211 Ga0163163_10043013
1212 Ga0163163_10061466
1213 Ga0163163_10203848
1214 Ga0163163_10269433
1215 Ga0157380_10017304
1216 Ga0157380_10031025
1217 Ga0157380_10159067
1218 Ga0182008_10007630
1219 Ga0182008_10051282
1220 Ga0157377_10000320
1221 Ga0157379_10001576
1222 Ga0157379_10076789
1223 Ga0157376_10005780
1224 Ga0157376_10021281
1225 Ga0157376_10160917
1226 Ga0157376_10177276
1227 Ga0157376_10211656
1228 Ga0157376_10243331
1229 Ga0157376_10587466
1230 Ga0182007_10003904
1231 Ga0163161_10137307
1232 Ga0206350_11181967
1233 Ga0224712_10109610
1234 Ga0224712_10114939
1235 Ga0228598_1005699
1236 Ga0228598_1010671
1237 Ga0207697_10009367
1238 Ga0207656_10020929
1239 Ga0207656_10058301
1240 Ga0207653_10000154
1241 Ga0207682_10005060
1242 Ga0207692_10007181
1243 Ga0207692_10009833
1244 Ga0207692_10077060
1245 Ga0207692_10119081
1246 Ga0207692_10143437
1247 Ga0207642_10007939
1248 Ga0207642_10104299
1249 Ga0207710_10117860
1250 Ga0207688_10000597
1251 Ga0207680_10173344
1252 Ga0207647_10006998
1253 Ga0207647_10008098
1254 Ga0207647_10081576
1255 Ga0207685_10005715
1256 Ga0207685_10066288
1257 Ga0207699_10000485
1258 Ga0207699_10009722
1259 Ga0207699_10015505
1260 Ga0207699_10016058
1261 Ga0207699_10021767
1262 Ga0207699_10022889
1263 Ga0207699_10124924
1264 Ga0207645_10000104
1265 Ga0207643_10000528
1266 Ga0207705_10024493
1267 Ga0207684_10000419
1268 Ga0207684_10016521
1269 Ga0207684_10068995
1270 Ga0207684_10074338
1271 Ga0207684_10341216
1272 Ga0207654_10009858
1273 Ga0207654_10034836
1274 Ga0207654_10059968
1275 Ga0207654_10189842
1276 Ga0207707_10004586
1277 Ga0207707_10011392
1278 Ga0207707_10153921
1279 Ga0207707_10201700
1280 Ga0207707_10431752
1281 Ga0207695_10000410
1282 Ga0207695_10014311
1283 Ga0207695_10028981
1284 Ga0207695_10103899
1285 Ga0207695_10180887
1286 Ga0207671_10022279
1287 Ga0207693_10000006
1288 Ga0207693_10000011
1289 Ga0207693_10001200
1290 Ga0207693_10009111
1291 Ga0207693_10016931
1292 Ga0207693_10090250
1293 Ga0207693_10148938
1294 Ga0207693_10226822
1295 Ga0207693_10377651
1296 Ga0207663_10000864
1297 Ga0207663_10002456
1298 Ga0207663_10038544
1299 Ga0207663_10044185
1300 Ga0207663_10068288
1301 Ga0207663_10393594
1302 Ga0207660_10073621
1303 Ga0207662_10002647
1304 Ga0207657_10001184
1305 Ga0207657_10011385
1306 Ga0207649_10005097
1307 Ga0207652_10015281
1308 Ga0207652_10017488
1309 Ga0207652_10121732
1310 Ga0207652_10403751
1311 Ga0207646_10022717
1312 Ga0207646_10073918
1313 Ga0207646_10079517
1314 Ga0207646_10090516
1315 Ga0207646_10129481
1316 Ga0207646_10155813
1317 Ga0207646_10157712
1318 Ga0207646_10357849
1319 Ga0207681_10007220
1320 Ga0207681_10017508
1321 Ga0207694_10002431
1322 Ga0207694_10110946
1323 Ga0207650_10000170
1324 Ga0207650_10053861
1325 Ga0207659_10240891
1326 Ga0207659_10315484
1327 Ga0207687_10006392
1328 Ga0207687_10064283
1329 Ga0207687_10113417
1330 Ga0207700_10000226
1331 Ga0207700_10000720
1332 Ga0207700_10003638
1333 Ga0207700_10003942
1334 Ga0207700_10006793
1335 Ga0207700_10019216
1336 Ga0207700_10026639
1337 Ga0207700_10120801
1338 Ga0207700_10193476
1339 Ga0207700_10406714
1340 Ga0207700_10431791
1341 Ga0207664_10000045
1342 Ga0207664_10023009
1343 Ga0207664_10047640
1344 Ga0207664_10090866
1345 Ga0207664_10162807
1346 Ga0207664_10179586
1347 Ga0207664_10327616
1348 Ga0207664_10396882
1349 Ga0207664_10409470
1350 Ga0207644_10016560
1351 Ga0207690_10057113
1352 Ga0207706_10001873
1353 Ga0207706_10014855
1354 Ga0207706_10255235
1355 Ga0207669_10044041
1356 Ga0207704_10005736
1357 Ga0207704_10006259
1358 Ga0207665_10005003
1359 Ga0207665_10013069
1360 Ga0207665_10028371
1361 Ga0207665_10060535
1362 Ga0207665_10068511
1363 Ga0207665_10074372
1364 Ga0207665_10108627
1365 Ga0207665_10118993
1366 Ga0207665_10178344
1367 Ga0207691_10000417
1368 Ga0207711_10029648
1369 Ga0207711_10030858
1370 Ga0207711_10250952
1371 Ga0207689_10002439
1372 Ga0207689_10006208
1373 Ga0207689_10019498
1374 Ga0207661_10000817
1375 Ga0207661_10173838
1376 Ga0207661_10182404
1377 Ga0207661_10241982
1378 Ga0207679_10000080
1379 Ga0207679_10091647
1380 Ga0207679_10424394
1381 Ga0207667_10000252
1382 Ga0207667_10000509
1383 Ga0207667_10073216
1384 Ga0207667_10087177
1385 Ga0207651_10011661
1386 Ga0207712_10021550
1387 Ga0207668_10009146
1388 Ga0207640_10029014
1389 Ga0207640_10059338
1390 Ga0207640_10095861
1391 Ga0207640_10126198
1392 Ga0207640_10135874
1393 Ga0207640_10258691
1394 Ga0207658_10036613
1395 Ga0207677_10004192
1396 Ga0207677_10023171
1397 Ga0207677_10160473
1398 Ga0207703_10001571
1399 Ga0207703_10001699
1400 Ga0207703_10015930
1401 Ga0207703_10094531
1402 Ga0207703_10306577
1403 Ga0207639_10002578
1404 Ga0207639_10038421
1405 Ga0207639_10086420
1406 Ga0207639_10251185
1407 Ga0207678_10000912
1408 Ga0207708_10033220
1409 Ga0207702_10000120
1410 Ga0207702_10000375
1411 Ga0207702_10000932
1412 Ga0207702_10017396
1413 Ga0207702_10027846
1414 Ga0207702_10065213
1415 Ga0207702_10096227
1416 Ga0207641_10001162
1417 Ga0207641_10160178
1418 Ga0207641_10268337
1419 Ga0207648_10001893
1420 Ga0207676_10000478
1421 Ga0207676_10001493
1422 Ga0207676_10086988
1423 Ga0207676_10214808
1424 Ga0207676_10223055
1425 Ga0207674_10000056
1426 Ga0207674_10003557
1427 Ga0207674_10016331
1428 Ga0207674_10186592
1429 Ga0207674_10297635
1430 Ga0207675_100118803
1431 Ga0207683_10002198
1432 Ga0207698_10041124
1433 Ga0207698_10045079
1434 Ga0207698_10172868
1435 Ga0207698_10381429
1436 Ga0209588_1007669
1437 Ga0209588_1019478
1438 Ga0209588_1048966
1439 Ga0265354_1000177
1440 Ga0265356_1000750
1441 Ga0265356_1002947
1442 Ga0268266_10016192
1443 Ga0268265_10005039
1444 Ga0268265_10412669
1445 Ga0268264_10009243
1446 Ga0268264_10012129
1447 Ga0268264_10029210
1448 Ga0268264_10153535
1449 Ga0268264_10276184
1450 Ga0265338_10009412
1451 Ga0265338_10081182
1452 Ga0265338_10106401
1453 Ga0307511_10025810
1454 Ga0265762_1005906
1455 Ga0265762_1007487
1456 Ga0265765_1000183
1457 Ga0265760_10000360
1458 Ga0265760_10000370
1459 Ga0265760_10002267
1460 Ga0265760_10010054
1461 Ga0265339_10049076
1462 Ga0265339_10082869
1463 Ga0265339_10100936
1464 Ga0265316_10074929
1465 Ga0316575_10035494
1466 Ga0316579_10001577
1467 Ga0265314_10041502
1468 Ga0316578_10017564
1469 Ga0307516_10000679
1470 Ga0307411_10238557
1471 Ga0316583_10067490
1472 Ga0307510_10016638
1473 Ga0373926_0023988
1474 Ga0373944_0063463
1475 Ga0373923_0009214
1476 Ga0373936_0000633
1477 Ga0373945_0001385
1478 Ga0373945_0010568
1479 Ga0373953_0156772
1480 Ga0373954_0074547
1481 Ga0373956_0035597
1482 Ga0373957_0005694
1483 Ga0373943_0000037
1484 Ga0373943_0052022
1485 Ga0373946_0001083
1486 Ga0373946_0040561
1487 Ga0373955_0029578
1488 Ga0373955_0035681
1489 Ga0373955_0080499
1490 Ga0373961_0012058
1491 Ga0373924_0000275
1492 Ga0373924_0077198
1493 Ga0373931_0014259
1494 Ga0373931_0086411
1495 Ga0373931_0179619
1496 Ga0373935_0009168
1497 Ga0373935_0020248
1498 Ga0373935_0021972
1499 Ga0373935_0109533
1500 Ga0373935_0166137
1501 Ga0373927_0000588
1502 Ga0373927_0019104
1503 Ga0373927_0019481
1504 Ga0373927_0033243
1505 Ga0373927_0053717
1506 Ga0373927_0089895
1507 Ga0373933_0002877
1508 Ga0373933_0034336
1509 Ga0373933_0092374
1510 Ga0373933_0202000
1511 Ga0373947_0000500
1512 Ga0373947_0045144
1513 Ga0373947_0073760
1514 Ga0373947_0183324
1515 Ga0373937_0000178
1516 Ga0373937_0003904
1517 Ga0373937_0014073
1518 Ga0373937_0014137
1519 Ga0373937_0021549
1520 Ga0373937_0044035
1521 Ga0373937_0046754
1522 Ga0373937_0178451
1523 Ga0316582_0009804
1524 Ga0316582_0017918
1525 Ga0316582_0301977
1526 Ga0316584_0152413
1527 Ga0373925_0000835
1528 Ga0373925_0002017
1529 Ga0373925_0002957
1530 Ga0373925_0016252
1531 Ga0373925_0044091
1532 Ga0373925_0062608
1533 Ga0373925_0083256
1534 Ga0373925_0336288
1535 Ga0373925_0391745
1536 Ga0316581_0001543
1537 Ga0436364_0796539
1538 Ga0436365_1156699
1539 Ga0436363_1481147
1540 Ga0439434_0002833
1541 Ga0439460_0061470
1542 Ga0451577_0000339
1543 Ga0453683_0008465
1544 Ga0466964_0025086
1545 Ga0466964_0033678
1546 Ga0453684_0000023
1547 Ga0453684_0000065
1548 Ga0453684_0004352
1549 Ga0453684_0020602
1550 Ga0453684_0044259
1551 Ga0453684_0056603
1552 Ga0453684_0595182
1553 Ga0466957_0000211
1554 Ga0466959_0044138
1555 Ga0466958_0093546
1556 Ga0466967_0006641
1557 Ga0495651_0045709
1558 Ga0495580_0000564
1559 Ga0495580_0000627
1560 Ga0495580_0001315
1561 Ga0495580_0002087
1562 Ga0495580_0038447
1563 Ga0495580_0038822
1564 Ga0495580_0110946
1565 Ga0495580_0119051
1566 Ga0495580_0189115
1567 Ga0495582_0001088
1568 Ga0495582_0021283
1569 Ga0495582_0024582
1570 Ga0495639_0030106
1571 Ga0495639_0098686
1572 Ga0495664_0010894
1573 Ga0495594_0185915
1574 Ga0495606_0072343
1575 Ga0495630_0219713
1576 Ga0495665_0014740
1577 Ga0495665_0038348
1578 Ga0495667_0041207
1579 Ga0495668_0000484
1580 Ga0495635_0088033
1581 Ga0495599_0040670
1582 Ga0495647_0061106
1583 Ga0495658_0084200
1584 Ga0495669_0043226
1585 Ga0495581_0050536
1586 Ga0495674_0363092
1587 Ga0495675_0147294
1588 Ga0495684_0001956
1589 Ga0495593_0061274
1590 Ga0495602_0055793
1591 Ga0495602_0087931
1592 Ga0495602_0139185
1593 Ga0495614_0035179
1594 Ga0496100_0024778
1595 Ga0496102_0003082
1596 Ga0496102_0011664
1597 Ga0496103_0008528
1598 Ga0496103_0034936
1599 Ga0496103_0205101
1600 Ga0496104_0071248
1601 Ga0496104_0081116
1602 Ga0496104_0575973
1603 Ga0496105_0009596
1604 Ga0496105_0168695
1605 Ga0496106_0044170
1606 Ga0496106_0233761
1607 Ga0496107_0098228
1608 Ga0496108_0000335
1609 Ga0496109_0000184
1610 Ga0496110_0001177
1611 Ga0496110_0065785
1612 Ga0496111_0010299
1613 Ga0496112_0000034
1614 Ga0496112_0002143
1615 Ga0496112_0003090
1616 Ga0496112_0034612
1617 Ga0496112_0281127
1618 Ga0496112_0422995
1619 Ga0496113_0002525
1620 Ga0496113_0029345
1621 Ga0496113_0201465
1622 Ga0496114_0135181
1623 Ga0496115_0001768
1624 Ga0496115_0052123
1625 Ga0496115_0201317
1626 Ga0496116_0023660
1627 Ga0496117_0000375
1628 Ga0496118_0000040
1629 Ga0496119_0015858
1630 Ga0496124_0021668
1631 Ga0496125_0136330
1632 Ga0496126_0045840
1633 Ga0501037_0050190
1634 Ga0501043_0207236
1635 Ga0501047_0331893
1636 Ga0501035_0118313
1637 nmdc:mga05p37_230518_c1
1638 nmdc:mga0n895_2147_c1
1639 nmdc:mga0n895_363922_c1
1640 nmdc:mga0n895_36713_c1
1641 nmdc:mga0rr50_674_c1
1642 nmdc:mga08x19_127305_c1
1643 nmdc:mga08x19_75465_c1
1644 nmdc:mga08x19_93933_c1
1645 nmdc:mga0a205_296_c1
1646 Ga0495619_0064971
1647 Ga0500641_0000252
1648 Ga0500616_0000655
1649 Ga0587066_011610
1650 Ga0587078_011670
1651 Ga0587079_021873
1652 Ga0587060_005001
1653 2687578852
1654 2952255777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

163

325

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9521 56 313
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9512 61 313
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9276 56 313
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9194 61 313
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8048 103 264
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9545 61 313 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9125 61 313 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8289 94 251 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8016 100 265 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7944 94 251 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9842 87 232
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9796 102 271
AF-A0A7V8JR83-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.9792 69 189
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9776 87 232
AF-A0A3C0MEV3-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.9739 82 242

Map