F482401

General Info

Members Datasets Scaffolds Average Seq Length
824 598 1648 228

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0051865|Ga0495588_0051865_518_1297
Length 259
Sequence MQDFLIVIFACYWSYRAFIDMRETIMTDQKVAIITAGGSGMGAVSARRLAAEGYRVAILSSSGKGEALAQELGGIGVTGSNQSNDDLKRLVDTAYGKWGRVDALVNSAGHGPRAAVLDLSDDDWHKGMDVYFLNVVRPTRLVTPIMLEQKSGSIVNISTYATFEPDPLFPTSGVFRSGLAAFTKLFADKYAADNIRMNNVLPGFIDSLPETEERRLRIPMGRYGTSEEVAELVALLATDRGGYITGQNIRIDGGITRSV

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
109 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
110 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
194 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
202 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
211 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
212 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
213 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
214 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
215 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
220 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
318 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
319 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
320 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
321 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
322 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
323 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
324 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
325 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
341 2509276019 Ensifer aridi TW10 Isolate Nodule
342 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
343 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
344 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
345 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
346 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
347 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
348 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
349 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
350 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
351 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
352 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
353 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
354 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
355 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
356 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
357 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
358 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
359 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
360 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
361 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
362 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
363 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
364 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
365 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
366 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
367 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
368 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
369 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
370 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
371 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
372 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
373 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
374 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
375 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
376 2643221607 Rhizobium sp. Root73 Isolate Unclassified
377 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
378 2643221672 Variovorax sp. Root434 Isolate Unclassified
379 2643221683 Variovorax sp. Root473 Isolate Unclassified
380 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
381 2643221688 Rhizobium sp. Root482 Isolate Unclassified
382 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
383 2738541277 Variovorax sp. GV051 Isolate Unclassified
384 2738541307 Variovorax sp. GV008 Isolate Unclassified
385 2738543019 Variovorax sp. GV040 Isolate Unclassified
386 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
387 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
388 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
389 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
390 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
391 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
392 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
393 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
394 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
395 2818991446 Variovorax sp. 1180 Isolate Unclassified
396 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
397 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
398 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
399 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
400 2842677519 Variovorax sp. R-72495 Isolate Unclassified
401 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
402 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
403 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
404 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
405 2885198086 Variovorax sp. 679 Isolate Unclassified
406 2885211737 Variovorax sp. 553 Isolate Unclassified
407 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
408 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
409 2899924645 Variovorax sp. 369 Isolate Unclassified
410 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
411 2904456579 Variovorax sp. 2002 Isolate Unclassified
412 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
413 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
414 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
415 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
416 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
417 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
418 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
419 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
420 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
421 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
422 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
423 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
424 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
425 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
426 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
427 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
428 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
429 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
430 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
431 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
432 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
433 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
434 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
435 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
436 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
437 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
438 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
439 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
440 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
441 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
442 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
443 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
444 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
445 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
446 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
447 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
448 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
449 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
450 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
451 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
452 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
453 2928037797 Variovorax sp. 1126 Isolate Unclassified
454 2928044640 Variovorax sp. 1128 Isolate Unclassified
455 2928051484 Variovorax sp. 1133 Isolate Unclassified
456 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
457 2928070936 Variovorax gossypii 1167 Isolate Unclassified
458 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
459 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
460 2929520902 Variovorax beijingensis 502 Isolate Unclassified
461 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
462 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
463 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
464 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
465 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
466 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
467 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
468 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
469 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
470 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
471 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
472 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
473 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
474 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
475 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
476 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
477 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
478 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
479 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
480 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
481 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
482 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
483 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
484 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
485 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
486 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
487 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
488 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
489 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
490 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
491 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
492 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
493 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
494 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
495 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
496 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
497 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
498 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
499 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
500 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
501 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
502 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
503 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
504 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
505 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
506 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
507 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
508 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
509 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
510 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
511 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
512 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
513 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
514 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
515 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
516 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
517 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
518 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
519 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
520 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
521 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
522 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
523 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
524 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
525 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
526 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
527 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
528 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
529 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
530 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
531 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
532 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
533 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
534 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
535 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
536 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
537 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
538 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
539 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
540 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
541 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
542 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
543 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
544 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
545 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
546 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
547 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
548 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
549 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
550 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
551 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
552 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
553 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
554 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
555 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
556 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
557 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
558 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
559 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
560 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
561 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
562 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
563 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
564 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
565 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
566 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
567 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
568 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
569 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
570 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
571 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
572 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
573 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
574 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
575 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
576 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
577 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
578 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
579 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
580 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
581 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
582 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
583 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
584 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
585 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
586 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
587 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
588 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
589 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
590 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
591 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
592 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
593 641522639 Methylobacterium sp. 4-46 Isolate Nodule
594 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
595 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
596 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
597 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
598 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.08
Metatranscriptomes 0.24
Isolates 31.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.39
Nodule 27.06
Rhizoplane 2.43
Rhizosphere 38.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0051865 3300046674 Bacteria 2114
2 JGI25152J39213_1001223 3300002773 Bacteria 11753
3 JGI25152J39213_1007404 3300002773 Bacteria 2847
4 JGI25159J45721_1000950 3300002987 Bacteria 12613
5 JGI25159J45721_1012306 3300002987 Bacteria 2047
6 JGI25151J46595_10000898 3300003187 Bacteria 23405
7 JGI25151J46595_10003130 3300003187 Bacteria 9299
8 JGI25151J46595_10007717 3300003187 Bacteria 5240
9 JGI25153J46596_10002085 3300003215 Bacteria 11754
10 JGI25153J46596_10007725 3300003215 Bacteria 5236
11 rootL2_10181565 3300003322 Bacteria 1858
12 JGI25160J50197_1001299 3300003354 Bacteria 12612
13 JGI25160J50197_1009477 3300003354 Bacteria 3606
14 Ga0006562J51391_1029811 3300003578 Bacteria 7262
15 Ga0055535_1000067 3300003761 Bacteria 115376
16 Ga0055542_1000013 3300003762 Bacteria 387560
17 Ga0055526_1002433 3300003771 Bacteria 12612
18 Ga0055526_1005055 3300003771 Bacteria 7703
19 Ga0055537_1001026 3300003773 Bacteria 12612
20 Ga0055524_1001612 3300003775 Bacteria 12612
21 Ga0055524_1003424 3300003775 Bacteria 7703
22 Ga0055536_1000487 3300003781 Bacteria 27545
23 Ga0055536_1007738 3300003781 Bacteria 4751
24 Ga0055536_1013822 3300003781 Bacteria 2879
25 Ga0055534_1000037 3300003784 Bacteria 107072
26 Ga0055534_1000908 3300003784 Bacteria 13353
27 Ga0055534_1001625 3300003784 Bacteria 8708
28 Ga0055528_1001733 3300003790 Bacteria 12612
29 Ga0055528_1005679 3300003790 Bacteria 5755
30 Ga0055530_10002136 3300003791 Bacteria 13118
31 Ga0055530_10015817 3300003791 Bacteria 2441
32 Ga0055540_1000823 3300003792 Bacteria 20882
33 Ga0055540_1006303 3300003792 Bacteria 4744
34 Ga0055540_1013757 3300003792 Bacteria 2452
35 Ga0055540_1034205 3300003792 Bacteria 1146
36 Ga0055531_10005993 3300003794 Bacteria 6979
37 Ga0055531_10009907 3300003794 Bacteria 4817
38 Ga0055531_10010080 3300003794 Bacteria 4744
39 Ga0055543_1005104 3300004625 Bacteria 3418
40 Ga0065165_1009841 3300005262 Bacteria 4218
41 Ga0065704_10324882 3300005289 Bacteria 847
42 Ga0068869_100190663 3300005334 Bacteria 1612
43 Ga0068869_100347677 3300005334 Bacteria 1208
44 Ga0070666_10156048 3300005335 Bacteria 1594
45 Ga0068868_100043666 3300005338 Bacteria 3502
46 Ga0070668_100015373 3300005347 Bacteria 5720
47 Ga0070668_100045071 3300005347 Bacteria 3384
48 Ga0070669_100105164 3300005353 Bacteria 2135
49 Ga0070669_100289816 3300005353 Bacteria 1314
50 Ga0070675_100034456 3300005354 Bacteria 4109
51 Ga0070675_100103910 3300005354 Bacteria 2396
52 Ga0070671_100172953 3300005355 Bacteria 1827
53 Ga0070688_100177975 3300005365 Bacteria 1473
54 Ga0070667_100083298 3300005367 Bacteria 2740
55 Ga0070667_100146824 3300005367 Bacteria 2069
56 Ga0070667_100424524 3300005367 Bacteria 1212
57 Ga0070710_10022606 3300005437 Bacteria 3292
58 Ga0070663_100107109 3300005455 Bacteria 2095
59 Ga0070678_100003439 3300005456 Bacteria 8833
60 Ga0070678_100005449 3300005456 Bacteria 7360
61 Ga0070662_100094896 3300005457 Bacteria 2247
62 Ga0070662_100479431 3300005457 Bacteria 1035
63 Ga0068867_100246563 3300005459 Bacteria 1451
64 Ga0070679_100109735 3300005530 Bacteria 2745
65 Ga0070684_100056906 3300005535 Bacteria 3413
66 Ga0068853_100019590 3300005539 Bacteria 5613
67 Ga0068853_100049473 3300005539 Bacteria 3612
68 Ga0070672_100077916 3300005543 Bacteria 2651
69 Ga0070686_100141236 3300005544 Bacteria 1677
70 Ga0070665_100009533 3300005548 Bacteria 9820
71 Ga0070665_100294481 3300005548 Bacteria 1625
72 Ga0068855_100127427 3300005563 Bacteria 2910
73 Ga0068857_100269099 3300005577 Bacteria 1566
74 Ga0068854_100048619 3300005578 Bacteria 3027
75 Ga0068856_100099399 3300005614 Bacteria 2900
76 Ga0068856_100111769 3300005614 Bacteria 2730
77 Ga0068852_100245679 3300005616 Bacteria 1712
78 Ga0068852_100269137 3300005616 Bacteria 1639
79 Ga0068852_100507308 3300005616 Bacteria 1202
80 Ga0068852_100525153 3300005616 Bacteria 1181
81 Ga0068859_100182109 3300005617 Bacteria 2184
82 Ga0068864_100018241 3300005618 Bacteria 5858
83 Ga0068864_100693080 3300005618 Bacteria 995
84 Ga0068866_10218935 3300005718 Bacteria 1148
85 Ga0068851_10001681 3300005834 Bacteria 9682
86 Ga0068870_10235403 3300005840 Bacteria 1128
87 Ga0068858_100001489 3300005842 Bacteria 24134
88 Ga0068860_100183890 3300005843 Bacteria 2020
89 Ga0068862_100025253 3300005844 Bacteria 4988
90 Ga0068862_100701101 3300005844 Bacteria 981
91 Ga0081538_10007055 3300005981 Bacteria 9771
92 Ga0075365_10043132 3300006038 Bacteria 2952
93 Ga0075365_10192395 3300006038 Bacteria 1428
94 Ga0075365_10420655 3300006038 Bacteria 943
95 Ga0075363_100070152 3300006048 Bacteria 1902
96 Ga0075364_10037368 3300006051 Bacteria 3143
97 Ga0075364_10045505 3300006051 Bacteria 2856
98 Ga0075364_10242829 3300006051 Bacteria 1223
99 Ga0075432_10039526 3300006058 Bacteria 1645
100 Ga0070712_100425742 3300006175 Bacteria 1101
101 Ga0075362_10020584 3300006177 Bacteria 2758
102 Ga0075362_10046773 3300006177 Bacteria 1925
103 Ga0075362_10054037 3300006177 Bacteria 1804
104 Ga0075367_10002621 3300006178 Bacteria 8266
105 Ga0075367_10021684 3300006178 Bacteria 3594
106 Ga0075367_10028619 3300006178 Bacteria 3180
107 Ga0075367_10093933 3300006178 Bacteria 1827
108 Ga0075367_10160066 3300006178 Bacteria 1400
109 Ga0075367_10208135 3300006178 Bacteria 1223
110 Ga0075367_10240140 3300006178 Bacteria 1135
111 Ga0075369_10053512 3300006186 Bacteria 1752
112 Ga0075366_10006580 3300006195 Bacteria 6376
113 Ga0075366_10007047 3300006195 Bacteria 6186
114 Ga0075366_10010247 3300006195 Bacteria 5258
115 Ga0075366_10018411 3300006195 Bacteria 4031
116 Ga0075366_10062813 3300006195 Bacteria 2207
117 Ga0075366_10092085 3300006195 Bacteria 1816
118 Ga0097621_100036702 3300006237 Bacteria 3922
119 Ga0097621_100482354 3300006237 Bacteria 1121
120 Ga0075370_10001866 3300006353 Bacteria 9446
121 Ga0075370_10006203 3300006353 Bacteria 5998
122 Ga0075370_10031708 3300006353 Bacteria 2951
123 Ga0075370_10037403 3300006353 Bacteria 2729
124 Ga0075370_10053410 3300006353 Bacteria 2293
125 Ga0075370_10245531 3300006353 Bacteria 1060
126 Ga0068871_100023492 3300006358 Bacteria 4771
127 Ga0068871_100444615 3300006358 Bacteria 1161
128 Ga0075428_100275095 3300006844 Bacteria 1812
129 Ga0075434_100659518 3300006871 Bacteria 1064
130 Ga0068865_100472266 3300006881 Bacteria 1041
131 Ga0075436_100002903 3300006914 Bacteria 11762
132 Ga0097620_100182106 3300006931 Bacteria 2184
133 Ga0079104_1003374 3300006946 Bacteria 7488
134 Ga0099826_10000114 3300006948 Bacteria 36789
135 Ga0099826_10187855 3300006948 Bacteria 1143
136 Ga0099826_10280914 3300006948 Bacteria 861
137 Ga0105244_10004674 3300009036 Bacteria 9332
138 Ga0105240_10060730 3300009093 Bacteria 4712
139 Ga0105240_10143700 3300009093 Bacteria 2850
140 Ga0105240_10645968 3300009093 Bacteria 1160
141 Ga0105245_10135384 3300009098 Bacteria 2315
142 Ga0105245_10234927 3300009098 Bacteria 1775
143 Ga0105247_10364511 3300009101 Bacteria 1020
144 Ga0105243_10001445 3300009148 Bacteria 20884
145 Ga0105243_10006352 3300009148 Bacteria 9127
146 Ga0105243_10835665 3300009148 Bacteria 911
147 Ga0105241_10225799 3300009174 Bacteria 1576
148 Ga0105242_10404024 3300009176 Bacteria 1276
149 Ga0105248_10024764 3300009177 Bacteria 6674
150 Ga0105248_10108637 3300009177 Bacteria 3128
151 Ga0105237_10003155 3300009545 Bacteria 19840
152 Ga0105238_10131140 3300009551 Bacteria 2484
153 Ga0105238_10194092 3300009551 Bacteria 2006
154 Ga0105239_10033149 3300010375 Bacteria 5673
155 Ga0105239_10049769 3300010375 Bacteria 4595
156 Ga0105239_10907639 3300010375 Bacteria 1011
157 Ga0105246_10026796 3300011119 Bacteria 3771
158 Ga0105246_10206474 3300011119 Bacteria 1531
159 Ga0105246_10352694 3300011119 Bacteria 1206
160 Ga0157347_1000082 3300012502 Bacteria 4232
161 Ga0157373_10251065 3300013100 Bacteria 1251
162 Ga0157373_10430870 3300013100 Bacteria 947
163 Ga0157371_10065553 3300013102 Bacteria 2572
164 Ga0157370_10006015 3300013104 Bacteria 13501
165 Ga0157370_10352584 3300013104 Bacteria 1356
166 Ga0157370_10489909 3300013104 Bacteria 1129
167 Ga0157369_10016911 3300013105 Bacteria 8196
168 Ga0157378_10021253 3300013297 Bacteria 5708
169 Ga0163162_10355855 3300013306 Bacteria 1597
170 Ga0157372_10306515 3300013307 Bacteria 1848
171 Ga0157375_10123109 3300013308 Bacteria 2706
172 Ga0157375_11009522 3300013308 Bacteria 971
173 Ga0182008_10001553 3300014497 Bacteria 15269
174 Ga0182008_10006065 3300014497 Bacteria 6799
175 Ga0157379_10329821 3300014968 Bacteria 1394
176 Ga0157376_10073897 3300014969 Bacteria 2905
177 Ga0157376_10700614 3300014969 Bacteria 1018
178 Ga0182006_1000791 3300015261 Bacteria 21274
179 Ga0182007_10000665 3300015262 Bacteria 19713
180 Ga0182007_10051712 3300015262 Bacteria 1355
181 Ga0182005_1061693 3300015265 Bacteria 1024
182 Ga0163161_10000205 3300017792 Bacteria 54153
183 Ga0163161_10030538 3300017792 Bacteria 3836
184 Ga0163161_10042384 3300017792 Bacteria 3274
185 Ga0197907_10077284 3300020069 Bacteria 2018
186 Ga0214542_1028809 3300021321 Bacteria 2350
187 Ga0214543_1000011 3300021327 Bacteria 344093
188 Ga0213875_10004685 3300021388 Bacteria 7451
189 Ga0228711_1000007 3300022739 Bacteria 202413
190 Ga0228710_1012407 3300022740 Bacteria 10574
191 Ga0209436_117909 3300025208 Bacteria 1022
192 Ga0209672_100764 3300025228 Bacteria 15454
193 Ga0209147_102341 3300025229 Bacteria 4866
194 Ga0209258_100020 3300025242 Bacteria 565241
195 Ga0207425_1000201 3300025245 Bacteria 47830
196 Ga0207425_1010860 3300025245 Bacteria 2199
197 Ga0209148_1000031 3300025254 Bacteria 564601
198 Ga0209129_1000055 3300025258 Bacteria 261708
199 Ga0209129_1001550 3300025258 Bacteria 12644
200 Ga0209129_1011486 3300025258 Bacteria 2109
201 Ga0209565_1000131 3300025263 Bacteria 107341
202 Ga0209565_1000390 3300025263 Bacteria 37251
203 Ga0209565_1000908 3300025263 Bacteria 15955
204 Ga0209673_1000170 3300025273 Bacteria 133933
205 Ga0209673_1001037 3300025273 Bacteria 32517
206 Ga0209673_1002836 3300025273 Bacteria 11117
207 Ga0209130_1000214 3300025284 Bacteria 76202
208 Ga0209130_1001286 3300025284 Bacteria 17342
209 Ga0209675_1000055 3300025291 Bacteria 193129
210 Ga0209675_1000187 3300025291 Bacteria 68276
211 Ga0209675_1001222 3300025291 Bacteria 15521
212 Ga0209675_1005316 3300025291 Bacteria 5423
213 Ga0209676_1000040 3300025292 Bacteria 438184
214 Ga0209676_1000346 3300025292 Bacteria 87684
215 Ga0209676_1002868 3300025292 Bacteria 11365
216 Ga0209676_1004505 3300025292 Bacteria 7731
217 Ga0209676_1037606 3300025292 Bacteria 1394
218 Ga0209025_1000065 3300025294 Bacteria 300915
219 Ga0209025_1000510 3300025294 Bacteria 74231
220 Ga0209025_1008592 3300025294 Bacteria 7313
221 Ga0209025_1034248 3300025294 Bacteria 2324
222 Ga0209564_1000254 3300025295 Bacteria 113032
223 Ga0209564_1000410 3300025295 Bacteria 76208
224 Ga0209758_1000042 3300025297 Bacteria 407145
225 Ga0209758_1016734 3300025297 Bacteria 3704
226 Ga0209050_1000021 3300025298 Bacteria 574406
227 Ga0209050_1002455 3300025298 Bacteria 15833
228 Ga0209050_1002960 3300025298 Bacteria 13275
229 Ga0209050_1010106 3300025298 Bacteria 4701
230 Ga0209050_1052444 3300025298 Bacteria 1021
231 Ga0209256_1000056 3300025299 Bacteria 283044
232 Ga0209256_1000148 3300025299 Bacteria 147639
233 Ga0209256_1014417 3300025299 Bacteria 2846
234 Ga0207426_1000055 3300025302 Bacteria 374450
235 Ga0207426_1000079 3300025302 Bacteria 314709
236 Ga0209051_1000028 3300025303 Bacteria 404269
237 Ga0209051_1000126 3300025303 Bacteria 142582
238 Ga0209051_1000358 3300025303 Bacteria 67255
239 Ga0209051_1000730 3300025303 Bacteria 35662
240 Ga0209051_1009211 3300025303 Bacteria 5113
241 Ga0209257_1000043 3300025304 Bacteria 512127
242 Ga0209257_1000214 3300025304 Bacteria 136547
243 Ga0209257_1002680 3300025304 Bacteria 17063
244 Ga0209257_1009897 3300025304 Bacteria 4974
245 Ga0209257_1059961 3300025304 Bacteria 1037
246 Ga0207656_10099350 3300025321 Bacteria 1332
247 Ga0207656_10196139 3300025321 Bacteria 974
248 Ga0207655_1001433 3300025728 Bacteria 22106
249 Ga0207692_10518621 3300025898 Bacteria 758
250 Ga0207642_10170769 3300025899 Bacteria 1176
251 Ga0207654_10088687 3300025911 Bacteria 1880
252 Ga0207695_10029483 3300025913 Bacteria 6061
253 Ga0207695_10035154 3300025913 Bacteria 5438
254 Ga0207695_10633577 3300025913 Bacteria 950
255 Ga0207671_10011914 3300025914 Bacteria 7031
256 Ga0207693_10177394 3300025915 Bacteria 1677
257 Ga0207663_10428463 3300025916 Bacteria 1017
258 Ga0207652_10617521 3300025921 Bacteria 971
259 Ga0207681_10067164 3300025923 Bacteria 2485
260 Ga0207694_10487503 3300025924 Bacteria 1031
261 Ga0207659_10092244 3300025926 Bacteria 2264
262 Ga0207659_10115197 3300025926 Bacteria 2050
263 Ga0207687_10017378 3300025927 Bacteria 4735
264 Ga0207687_10043970 3300025927 Bacteria 3080
265 Ga0207700_10230743 3300025928 Bacteria 1574
266 Ga0207706_10004477 3300025933 Bacteria 13126
267 Ga0207706_10021002 3300025933 Bacteria 5865
268 Ga0207706_10039800 3300025933 Bacteria 4168
269 Ga0207686_10143646 3300025934 Bacteria 1653
270 Ga0207709_10000141 3300025935 Bacteria 101455
271 Ga0207709_10001560 3300025935 Bacteria 15713
272 Ga0207709_10036708 3300025935 Bacteria 2906
273 Ga0207669_10353160 3300025937 Bacteria 1137
274 Ga0207704_10034439 3300025938 Bacteria 2890
275 Ga0207704_10074453 3300025938 Bacteria 2167
276 Ga0207665_10289121 3300025939 Bacteria 1222
277 Ga0207665_10313355 3300025939 Bacteria 1176
278 Ga0207691_10179467 3300025940 Bacteria 1851
279 Ga0207661_10010656 3300025944 Bacteria 6624
280 Ga0207667_10072977 3300025949 Bacteria 3567
281 Ga0207667_10764267 3300025949 Bacteria 965
282 Ga0207668_10021315 3300025972 Bacteria 4132
283 Ga0207640_10126288 3300025981 Bacteria 1842
284 Ga0207640_10183916 3300025981 Bacteria 1569
285 Ga0207658_10199594 3300025986 Bacteria 1669
286 Ga0207658_10407428 3300025986 Bacteria 1196
287 Ga0207677_10211946 3300026023 Bacteria 1548
288 Ga0207703_10015842 3300026035 Bacteria 5882
289 Ga0207639_10044624 3300026041 Bacteria 3334
290 Ga0207639_10049344 3300026041 Bacteria 3191
291 Ga0207678_10207652 3300026067 Bacteria 1675
292 Ga0207678_10558331 3300026067 Bacteria 1002
293 Ga0207702_10032531 3300026078 Bacteria 4352
294 Ga0207702_10070190 3300026078 Bacteria 3013
295 Ga0207648_10072098 3300026089 Bacteria 3010
296 Ga0207648_10152783 3300026089 Bacteria 2037
297 Ga0207676_10014887 3300026095 Bacteria 5602
298 Ga0207674_10016550 3300026116 Bacteria 8067
299 Ga0207674_10107542 3300026116 Bacteria 2766
300 Ga0207674_10114171 3300026116 Bacteria 2673
301 Ga0207683_10008390 3300026121 Bacteria 8839
302 Ga0207683_10025391 3300026121 Bacteria 5111
303 Ga0207683_10083894 3300026121 Bacteria 2832
304 Ga0207683_10160856 3300026121 Bacteria 2030
305 Ga0207698_10417286 3300026142 Bacteria 1287
306 Ga0209281_1000483 3300027111 Bacteria 55407
307 Ga0209281_1001582 3300027111 Bacteria 12387
308 Ga0209282_1001687 3300027666 Bacteria 12300
309 Ga0209282_1002141 3300027666 Bacteria 11269
310 Ga0209813_10017116 3300027866 Bacteria 1986
311 Ga0268266_10028909 3300028379 Bacteria 4710
312 Ga0268266_10247458 3300028379 Bacteria 1648
313 Ga0268265_10015392 3300028380 Bacteria 5235
314 Ga0268264_10308962 3300028381 Bacteria 1491
315 Ga0268264_10729974 3300028381 Bacteria 986
316 Ga0307517_10085067 3300028786 Bacteria 2654
317 Ga0307515_10031067 3300028794 Bacteria 8927
318 Ga0307515_10180921 3300028794 Bacteria 2058
319 Ga0307511_10000961 3300030521 Bacteria 30536
320 Ga0316183_1112507 3300030742 Bacteria 960
321 Ga0316181_1124668 3300030744 Bacteria 2713
322 Ga0307513_10283186 3300031456 Bacteria 1434
323 Ga0307408_100006816 3300031548 Bacteria 7573
324 Ga0307408_100080466 3300031548 Bacteria 2433
325 Ga0307508_10148920 3300031616 Bacteria 1945
326 Ga0307514_10001974 3300031649 Bacteria 22331
327 Ga0316576_10003896 3300031727 Bacteria 8843
328 Ga0307516_10257143 3300031730 Bacteria 1438
329 Ga0307405_10080151 3300031731 Bacteria 2131
330 Ga0307405_10421624 3300031731 Bacteria 1050
331 Ga0307410_10106850 3300031852 Bacteria 2018
332 Ga0307406_10001006 3300031901 Bacteria 15666
333 Ga0307406_10359934 3300031901 Bacteria 1140
334 Ga0307407_10267355 3300031903 Bacteria 1179
335 Ga0307412_10177022 3300031911 Bacteria 1600
336 Ga0307412_10277353 3300031911 Bacteria 1314
337 Ga0307412_10527062 3300031911 Bacteria 988
338 Ga0315914_1009665 3300031967 Bacteria 12303
339 Ga0307416_100131999 3300032002 Bacteria 2250
340 Ga0307416_101414466 3300032002 Bacteria 801
341 Ga0307414_10006219 3300032004 Bacteria 6639
342 Ga0307414_10070678 3300032004 Bacteria 2514
343 Ga0307414_10072811 3300032004 Bacteria 2483
344 Ga0307411_10555511 3300032005 Bacteria 980
345 Ga0307411_10736360 3300032005 Bacteria 862
346 Ga0315913_1008343 3300033430 Bacteria 12301
347 Ga0315915_1006342 3300033464 Bacteria 14466
348 Ga0316574_0155192 3300035398 Bacteria 1475
349 Ga0373937_0357839 3300036401 Bacteria 1383
350 Ga0373937_0510910 3300036401 Bacteria 1142
351 Ga0395900_0895766 3300037418 Bacteria 811
352 Ga0436364_0210196 3300037853 Bacteria 2013
353 Ga0436364_0404370 3300037853 Bacteria 29235
354 Ga0436364_1340931 3300037853 Bacteria 2270
355 Ga0400483_060809 3300039062 Bacteria 10157
356 Ga0400483_087861 3300039062 Bacteria 8819
357 Ga0436365_0681628 3300039437 Bacteria 1797
358 Ga0439436_0001962 3300041404 Bacteria 6095
359 Ga0439436_0016108 3300041404 Bacteria 2246
360 Ga0439438_057151 3300041405 Bacteria 982
361 Ga0439465_0002963 3300041413 Bacteria 5555
362 Ga0439465_0015064 3300041413 Bacteria 2413
363 Ga0451853_1571767 3300041512 Bacteria 861
364 Ga0439431_0125834 3300041997 Bacteria 717
365 Ga0439449_0008483 3300042007 Bacteria 3905
366 Ga0439462_0028348 3300042015 Bacteria 1480
367 Ga0450919_010458 3300042121 Bacteria 1059
368 Ga0450920_051829 3300042122 Bacteria 824
369 Ga0450921_000336 3300042123 Bacteria 2117
370 Ga0450923_000617 3300042125 Bacteria 4098
371 Ga0450896_012486 3300042133 Bacteria 1202
372 Ga0450898_003971 3300042134 Bacteria 2160
373 Ga0450906_000845 3300042145 Bacteria 6748
374 Ga0450907_002806 3300042146 Bacteria 3224
375 Ga0439446_0023769 3300042156 Bacteria 1745
376 Ga0450908_005980 3300042184 Bacteria 2323
377 Ga0439434_0003116 3300042435 Bacteria 4874
378 Ga0450918_000408 3300042531 Bacteria 9312
379 Ga0450893_0004992 3300042532 Bacteria 2120
380 Ga0466971_0312183 3300044719 Bacteria 756
381 Ga0466968_0016756 3300044735 Bacteria 2921
382 Ga0466957_0049819 3300044842 Bacteria 2547
383 Ga0451576_0003026 3300045051 Bacteria 23739
384 Ga0466958_0466776 3300045836 Bacteria 818
385 Ga0466967_0035653 3300045976 Bacteria 4237
386 Ga0466967_0045574 3300045976 Bacteria 3811
387 Ga0466967_0103781 3300045976 Bacteria 2601
388 Ga0495627_005656 3300046453 Bacteria 4995
389 Ga0495590_0011560 3300046457 Bacteria 3296
390 Ga0495607_0000463 3300046501 Bacteria 40722
391 Ga0495608_0328025 3300046511 Bacteria 945
392 Ga0495610_0004895 3300046512 Bacteria 9729
393 Ga0495610_0071812 3300046512 Bacteria 1613
394 Ga0495616_0000588 3300046513 Bacteria 27347
395 Ga0495631_0000096 3300046518 Bacteria 58530
396 Ga0495632_0080102 3300046519 Bacteria 1558
397 Ga0495637_0010154 3300046520 Bacteria 4565
398 Ga0495654_0013821 3300046530 Bacteria 4309
399 Ga0495609_0210225 3300046538 Bacteria 811
400 Ga0495621_0045319 3300046539 Bacteria 1557
401 Ga0495597_0040631 3300046542 Bacteria 2079
402 Ga0495633_0135237 3300046558 Bacteria 1140
403 Ga0495668_0207462 3300046616 Bacteria 1073
404 Ga0495625_0021809 3300046660 Bacteria 4920
405 Ga0495625_0025462 3300046660 Bacteria 4488
406 Ga0495625_0042063 3300046660 Bacteria 3323
407 Ga0495659_0023718 3300046664 Bacteria 2087
408 Ga0495661_0267009 3300046665 Bacteria 867
409 Ga0495588_0076003 3300046674 Bacteria 1750
410 Ga0495599_0309976 3300046678 Bacteria 952
411 Ga0495658_0015427 3300046683 Bacteria 3919
412 Ga0495658_0375900 3300046683 Bacteria 904
413 Ga0495670_0018917 3300046691 Bacteria 3395
414 Ga0495670_0296505 3300046691 Bacteria 866
415 Ga0495671_0005310 3300046692 Bacteria 7561
416 Ga0495649_0014678 3300046694 Bacteria 4479
417 Ga0495660_0236434 3300046810 Bacteria 853
418 Ga0495674_0179934 3300047319 Bacteria 1761
419 Ga0495674_0417334 3300047319 Bacteria 1082
420 Ga0495687_000128 3300047443 Bacteria 116626
421 Ga0495687_007505 3300047443 Bacteria 6409
422 Ga0495687_021279 3300047443 Bacteria 3141
423 Ga0495614_0004256 3300048089 Bacteria 6449
424 Ga0495626_0032759 3300048091 Bacteria 2493
425 Ga0496100_0134928 3300048903 Bacteria 1743
426 Ga0496100_0195068 3300048903 Bacteria 1472
427 Ga0496101_0035253 3300048904 Bacteria 3538
428 Ga0496101_0050152 3300048904 Bacteria 3003
429 Ga0496102_0153277 3300048905 Bacteria 2166
430 Ga0496103_0327037 3300048906 Bacteria 986
431 Ga0496104_0241338 3300048907 Bacteria 1719
432 Ga0496105_0034634 3300048908 Bacteria 4154
433 Ga0496106_0288533 3300048909 Bacteria 1315
434 Ga0496107_0049994 3300048910 Bacteria 3013
435 Ga0496108_0034581 3300048911 Bacteria 4199
436 Ga0496108_0217620 3300048911 Bacteria 1659
437 Ga0496109_0046225 3300048912 Bacteria 3954
438 Ga0496110_0088085 3300048913 Bacteria 2772
439 Ga0496113_0324586 3300048916 Bacteria 1234
440 Ga0496114_0102388 3300048917 Bacteria 2446
441 Ga0496114_0376652 3300048917 Bacteria 1256
442 Ga0496116_0152567 3300048919 Bacteria 1280
443 Ga0496117_0039496 3300048920 Bacteria 3483
444 Ga0496117_0058337 3300048920 Bacteria 2674
445 Ga0496117_0186163 3300048920 Bacteria 1188
446 Ga0496117_0203540 3300048920 Bacteria 1116
447 Ga0496117_0215494 3300048920 Bacteria 1073
448 Ga0496121_0009583 3300048924 Bacteria 11094
449 Ga0496122_0103919 3300048925 Bacteria 1889
450 Ga0496122_0149037 3300048925 Bacteria 1448
451 Ga0496123_0018956 3300048926 Bacteria 5443
452 Ga0496123_0040113 3300048926 Bacteria 3266
453 Ga0496124_0004098 3300048927 Bacteria 17235
454 Ga0496124_0029982 3300048927 Bacteria 4837
455 Ga0496124_0143135 3300048927 Bacteria 1884
456 Ga0496126_0288811 3300048929 Bacteria 1357
457 Ga0495682_0146446 3300049460 Bacteria 843
458 Ga0501033_0120957 3300049570 Bacteria 1900
459 Ga0501033_0460617 3300049570 Bacteria 882
460 Ga0501037_0453169 3300049573 Bacteria 875
461 Ga0501038_0229581 3300049574 Bacteria 1478
462 Ga0501039_0460845 3300049575 Bacteria 998
463 Ga0501040_0063186 3300049576 Bacteria 2547
464 Ga0501041_0458255 3300049577 Bacteria 810
465 Ga0501042_0090090 3300049578 Bacteria 2201
466 Ga0501043_0076263 3300049579 Bacteria 2634
467 Ga0501046_0176585 3300049580 Bacteria 1600
468 Ga0501048_0040465 3300049582 Bacteria 3340
469 Ga0501068_0012238 3300049584 Bacteria 4854
470 Ga0501069_0005883 3300049585 Bacteria 6390
471 Ga0501073_0340765 3300049589 Bacteria 1035
472 Ga0501074_0097711 3300049590 Bacteria 2102
473 Ga0501076_0010141 3300049592 Bacteria 6977
474 Ga0501077_0005561 3300049593 Bacteria 7672
475 Ga0501083_0162524 3300049744 Bacteria 1461
476 Ga0501262_001136 3300049759 Bacteria 3021
477 Ga0501035_0100861 3300049822 Bacteria 2534
478 Ga0501045_0158498 3300049824 Bacteria 1684
479 nmdc:mga03683_1260_c1 3300050489 Bacteria 7504
480 nmdc:mga03683_68849_c1 3300050489 Bacteria 1509
481 nmdc:mga03n38_225707_c1 3300050490 Bacteria 980
482 nmdc:mga03n38_35493_c1 3300050490 Bacteria 2136
483 nmdc:mga03n38_70504_c1 3300050490 Bacteria 1616
484 nmdc:mga03n38_91724_c1 3300050490 Bacteria 1448
485 nmdc:mga00v17_11599_c2 3300050491 Bacteria 2054
486 nmdc:mga00v17_18699_c1 3300050491 Bacteria 3941
487 nmdc:mga00v17_352618_c1 3300050491 Bacteria 957
488 nmdc:mga00v17_538379_c1 3300050491 Bacteria 755
489 nmdc:mga0yw44_147713_c1 3300050492 Bacteria 1532
490 nmdc:mga0yw44_178098_c1 3300050492 Bacteria 1398
491 nmdc:mga0yw44_238707_c1 3300050492 Bacteria 1208
492 nmdc:mga0k408_130542_c1 3300050493 Bacteria 1492
493 nmdc:mga0k408_15478_c1 3300050493 Bacteria 4218
494 nmdc:mga0k408_16327_c1 3300050493 Bacteria 4119
495 nmdc:mga0k408_21047_c1 3300050493 Bacteria 3660
496 nmdc:mga0k408_214821_c1 3300050493 Bacteria 1148
497 nmdc:mga0k408_4308_c1 3300050493 Bacteria 7559
498 nmdc:mga0k408_46106_c1 3300050493 Bacteria 2517
499 nmdc:mga0k408_5617_c2 3300050493 Bacteria 5377
500 nmdc:mga06z11_13296_c1 3300050494 Bacteria 3609
501 nmdc:mga06z11_2108_c1 3300050494 Bacteria 7550
502 nmdc:mga06z11_291177_c1 3300050494 Bacteria 969
503 nmdc:mga06z11_8606_c1 3300050494 Bacteria 4265
504 nmdc:mga06z11_89996_c1 3300050494 Bacteria 1664
505 nmdc:mga04h51_60951_c1 3300050495 Bacteria 1293
506 nmdc:mga07m45_1191_c1 3300050496 Bacteria 11728
507 nmdc:mga07m45_19691_c1 3300050496 Bacteria 3357
508 nmdc:mga07m45_231590_c1 3300050496 Bacteria 1075
509 nmdc:mga07m45_39023_c1 3300050496 Bacteria 2653
510 nmdc:mga07m45_4200_c1 3300050496 Bacteria 7041
511 nmdc:mga07m45_45632_c1 3300050496 Bacteria 2461
512 nmdc:mga07m45_4959_c1 3300050496 Bacteria 6566
513 nmdc:mga07m45_84192_c1 3300050496 Bacteria 1818
514 nmdc:mga07m45_98379_c1 3300050496 Bacteria 1680
515 nmdc:mga0n895_159763_c1 3300050512 Bacteria 2285
516 nmdc:mga0n895_44244_c1 3300050512 Bacteria 4342
517 nmdc:mga08x19_9598_c1 3300050514 Bacteria 5793
518 nmdc:mga0sz30_29817_c1 3300050516 Bacteria 2251
519 Ga0495601_0155252 3300053077 Bacteria 1495
520 Ga0500610_0006834 3300053079 Bacteria 4826
521 Ga0500610_0008235 3300053079 Bacteria 4527
522 Ga0500635_0044050 3300053080 Bacteria 1504
523 Ga0500643_000900 3300053087 Bacteria 18833
524 Ga0500644_0025659 3300053088 Bacteria 1816
525 Ga0500646_0012102 3300053090 Bacteria 2225
526 Ga0500583_0091460 3300053092 Bacteria 1481
527 Ga0500583_0106035 3300053092 Bacteria 1380
528 Ga0500651_0002243 3300053093 Bacteria 10132
529 Ga0500560_108509 3300053107 Bacteria 931
530 Ga0500562_009212 3300053108 Bacteria 2496
531 Ga0500562_014627 3300053108 Bacteria 2010
532 Ga0500569_065970 3300053109 Bacteria 1129
533 Ga0500571_000053 3300053110 Bacteria 35478
534 Ga0500593_000279 3300053117 Bacteria 20807
535 Ga0500594_0002718 3300053118 Bacteria 3850
536 Ga0500607_002002 3300053121 Bacteria 17208
537 Ga0500607_026418 3300053121 Bacteria 3228
538 Ga0500608_015334 3300053122 Bacteria 3441
539 Ga0500608_044640 3300053122 Bacteria 2128
540 Ga0500626_027061 3300053128 Bacteria 2582
541 Ga0500642_0223803 3300053130 Bacteria 871
542 Ga0500655_000279 3300053133 Bacteria 11789
543 Ga0500655_012349 3300053133 Bacteria 1552
544 Ga0500658_0000099 3300053134 Bacteria 39743
545 Ga0500658_0000893 3300053134 Bacteria 12228
546 Ga0500658_0019594 3300053134 Bacteria 2547
547 Ga0500559_0135732 3300053136 Bacteria 1150
548 Ga0500564_015614 3300053138 Bacteria 3431
549 Ga0500568_0000397 3300053139 Bacteria 33277
550 Ga0500568_0018037 3300053139 Bacteria 3101
551 Ga0500568_0059744 3300053139 Bacteria 1478
552 Ga0500574_002258 3300053141 Bacteria 3129
553 Ga0500604_0005920 3300053151 Bacteria 3231
554 Ga0500616_0006937 3300053153 Bacteria 7303
555 Ga0500616_0013141 3300053153 Bacteria 4819
556 Ga0500627_0001116 3300053158 Bacteria 7343
557 Ga0500638_008034 3300053162 Bacteria 4468
558 Ga0500636_0004556 3300053177 Bacteria 7859
559 Ga0500565_012013 3300053734 Bacteria 913
560 Ga0501084_0552030 3300054114 Bacteria 973
561 Ga0501082_0062338 3300060353 Bacteria 3210
562 Ga0530510_0012056 3300061734 Bacteria 6064
563 Ga0530510_0523221 3300061734 Bacteria 900
564 2509107472 2508501122 Bacteria 6292184
565 2509375807 2509276019 Bacteria 6802256
566 2510303338 2510065057 Bacteria 6649661
567 2511501844 2511231052 Bacteria 6974333
568 2512533282 2512047086 Bacteria 6850303
569 2512971223 2512875026 Bacteria 6861065
570 2513584703 2513237086 Bacteria 7265287
571 2513603932 2513237089 Bacteria 6553624
572 2513615413 2513237091 Bacteria 6900273
573 2513881201 2513237140 Bacteria 7076289
574 2513905657 2513237143 Bacteria 6664116
575 2513989019 2513237156 Bacteria 6402557
576 2513997139 2513237159 Bacteria 6810126
577 2514006157 2513237160 Bacteria 6650282
578 2515608707 2515154107 Bacteria 6795637
579 2516893139 2516653046 Bacteria 6989037
580 2517569896 2517487022 Bacteria 7227575
581 2524448889 2524023207 Bacteria 6813453
582 2545675582 2545555834 Bacteria 8130841
583 2551679560 2551306084 Bacteria 8942552
584 2551686646 2551306085 Bacteria 7347181
585 2551696277 2551306086 Bacteria 6843938
586 2551697484 2551306087 Bacteria 7351905
587 2551713823 2551306089 Bacteria 7162724
588 2551717863 2551306090 Bacteria 7953713
589 2551719343 2551306090 Bacteria 7953713
590 2551727824 2551306091 Bacteria 7086830
591 2551736600 2551306092 Bacteria 6992595
592 2551742996 2551306093 Bacteria 7064773
593 2558867667 2558860100 Bacteria 8458965
594 2558868075 2558860100 Bacteria 8458965
595 2585166063 2582581283 Bacteria 6030556
596 2585268086 2582581306 Bacteria 6450535
597 2585386812 2582581865 Bacteria 6644329
598 2599622326 2599185214 Bacteria 8209958
599 2599674582 2599185226 Bacteria 8233575
600 2599680267 2599185227 Bacteria 8246414
601 2599692283 2599185229 Bacteria 8216126
602 2644049107 2643221607 Bacteria 6314006
603 2644205280 2643221636 Bacteria 6583769
604 2644396812 2643221672 Bacteria 6322190
605 2644469507 2643221683 Bacteria 5749203
606 2644482141 2643221686 Bacteria 6310811
607 2644491746 2643221688 Bacteria 5260751
608 2644501783 2643221689 Bacteria 6042950
609 2738719421 2738541277 Bacteria 7458140
610 2738884582 2738541307 Bacteria 8606193
611 2739282848 2738543019 Bacteria 7459457
612 2802719170 2802428858 Bacteria 6636079
613 2802728674 2802428859 Bacteria 6667919
614 2802734932 2802428860 Bacteria 6525526
615 2802739113 2802428861 Bacteria 6534206
616 2802745013 2802428862 Bacteria 6633353
617 2802752288 2802428863 Bacteria 6410669
618 2807407815 2806310737 Bacteria 5751088
619 2807456118 2806310745 Bacteria 5742165
620 2808942647 2808606379 Bacteria 5022697
621 2819599024 2818991446 Bacteria 7757362
622 2831270813 2831265667 Bacteria 7184833
623 2837654690 2837651117 Bacteria 3772164
624 2838058860 2838054893 Bacteria 7451788
625 2842522618 2842521101 Bacteria 6569494
626 2842681549 2842677519 Bacteria 5615038
627 2850081067 2850079185 Bacteria 6848280
628 2855825940 2855825444 Bacteria 6785811
629 2855841290 2855839649 Bacteria 7135830
630 2858802268 2858800743 Bacteria 6603254
631 2885202377 2885198086 Bacteria 7212419
632 2885216030 2885211737 Bacteria 7212420
633 2894821119 2894817345 Bacteria 4892941
634 2895516717 2895511927 Bacteria 6802080
635 2899929846 2899924645 Bacteria 7487985
636 2904451722 2904449895 Bacteria 6927402
637 2904461789 2904456579 Bacteria 6819253
638 2904546505 2904541872 Bacteria 8915136
639 2915985539 2915980308 Bacteria 6624279
640 2915990352 2915986958 Bacteria 6739310
641 2916000737 2915993759 Bacteria 7016183
642 2916002778 2916000859 Bacteria 6865702
643 2916014503 2916007675 Bacteria 6898660
644 2916017357 2916014648 Bacteria 6946486
645 2916024024 2916021584 Bacteria 6854472
646 2916034302 2916028427 Bacteria 6748433
647 2916036726 2916035215 Bacteria 6755766
648 2916044294 2916041962 Bacteria 6820487
649 2916052232 2916048683 Bacteria 6543552
650 2916055551 2916055098 Bacteria 6758838
651 2916065293 2916061851 Bacteria 6737736
652 2916069813 2916068649 Bacteria 6943657
653 2916079585 2916076590 Bacteria 6596108
654 2919464567 2919462493 Bacteria 5817112
655 2919682987 2919679072 Bacteria 4629602
656 2920766143 2920760137 Bacteria 7427611
657 2921212596 2921208531 Bacteria 6745326
658 2921242352 2921237296 Bacteria 6876710
659 2921246565 2921244191 Bacteria 6568419
660 2921255183 2921250672 Bacteria 6677771
661 2921259609 2921257292 Bacteria 6808382
662 2921266960 2921263974 Bacteria 6864552
663 2921287360 2921282425 Bacteria 6826397
664 2921294132 2921289301 Bacteria 7316391
665 2921304037 2921296804 Bacteria 7176999
666 2924146003 2924144063 Bacteria 6883928
667 2924154539 2924150972 Bacteria 7169444
668 2924163068 2924158325 Bacteria 7188855
669 2924170302 2924165586 Bacteria 7260590
670 2924173301 2924172951 Bacteria 6749356
671 2924186120 2924179722 Bacteria 6843264
672 2924189852 2924186466 Bacteria 6876637
673 2924196550 2924193448 Bacteria 6955718
674 2924205834 2924200457 Bacteria 6757188
675 2924212996 2924207177 Bacteria 6917007
676 2924218074 2924214083 Bacteria 7080103
677 2924228425 2924221636 Bacteria 7113495
678 2924231435 2924228884 Bacteria 6633132
679 2928042213 2928037797 Bacteria 7273642
680 2928049982 2928044640 Bacteria 7271509
681 2928054562 2928051484 Bacteria 7773759
682 2928070150 2928064002 Bacteria 7419480
683 2928074231 2928070936 Bacteria 8062541
684 2928086466 2928084124 Bacteria 7159212
685 2929165951 2929160207 Bacteria 9075316
686 2929526626 2929520902 Bacteria 6765052
687 2936999579 2936996657 Bacteria 6298727
688 2937005979 2937002841 Bacteria 6934057
689 2937015330 2937009748 Bacteria 6746052
690 2937019346 2937016420 Bacteria 6782579
691 2937028921 2937023124 Bacteria 6815156
692 2937033658 2937029754 Bacteria 6424026
693 2937036484 2937036028 Bacteria 6846469
694 2937047506 2937042894 Bacteria 6741576
695 2937052084 2937049772 Bacteria 6757901
696 2937063471 2937056579 Bacteria 7107896
697 2937065853 2937063883 Bacteria 7199456
698 2937077838 2937071275 Bacteria 6984483
699 2937083789 2937078374 Bacteria 6610289
700 2937087030 2937084907 Bacteria 6618516
701 2937092806 2937091812 Bacteria 6979387
702 2937101178 2937098957 Bacteria 7249374
703 2937108004 2937106411 Bacteria 6947143
704 2937115228 2937113482 Bacteria 6505872
705 2937123345 2937119839 Bacteria 6597547
706 2937129118 2937126314 Bacteria 6771275
707 2941503614 2941499720 Bacteria 7599444
708 2945915630 2945909444 Bacteria 7065066
709 2945974989 2945972063 Bacteria 6086495
710 2945988959 2945984333 Bacteria 7358892
711 2954770173 2954767861 Bacteria 5535784
712 2957381469 2957375807 Bacteria 6425588
713 2957387517 2957382221 Bacteria 6737050
714 2957391801 2957388812 Bacteria 6778072
715 2957396636 2957395598 Bacteria 6822399
716 2957404889 2957402308 Bacteria 6741770
717 2957410926 2957408893 Bacteria 6558585
718 2957420148 2957415311 Bacteria 6991633
719 2957424146 2957422303 Bacteria 7172205
720 2957436600 2957430029 Bacteria 7022557
721 2957439396 2957437181 Bacteria 6568994
722 2957445711 2957443900 Bacteria 6869977
723 2957451893 2957450854 Bacteria 6765715
724 2957464166 2957457609 Bacteria 6967680
725 2957467834 2957464669 Bacteria 6568877
726 2957472441 2957471148 Bacteria 6797643
727 2957480709 2957478035 Bacteria 6756658
728 2957491402 2957484790 Bacteria 6703082
729 2957496648 2957491536 Bacteria 6695180
730 2957503738 2957498199 Bacteria 7126688
731 2957512470 2957505466 Bacteria 7253085
732 2960590090 2960584000 Bacteria 6864594
733 2960597323 2960591022 Bacteria 6622873
734 2960598269 2960597568 Bacteria 6550735
735 2960609654 2960603979 Bacteria 6898737
736 2960615168 2960610863 Bacteria 6691244
737 2960620877 2960617483 Bacteria 6727748
738 2960626589 2960624210 Bacteria 6875384
739 2960635928 2960631154 Bacteria 6732508
740 2960645113 2960637947 Bacteria 7296468
741 2960649023 2960645483 Bacteria 7211087
742 2960659235 2960652885 Bacteria 7083688
743 2960662172 2960660292 Bacteria 7041660
744 2960672951 2960667422 Bacteria 6763020
745 2960679716 2960674078 Bacteria 6609048
746 2960687275 2960680706 Bacteria 6624464
747 2960689924 2960687367 Bacteria 6535474
748 2960694330 2960693952 Bacteria 6749742
749 2964611744 2964607997 Bacteria 7101408
750 2964616934 2964615318 Bacteria 6809089
751 2964622733 2964621998 Bacteria 6834995
752 2964631100 2964628898 Bacteria 7083044
753 2964637562 2964636051 Bacteria 7091832
754 2964646455 2964643177 Bacteria 6820887
755 2964651676 2964649959 Bacteria 6675118
756 2964661616 2964656573 Bacteria 7100150
757 2964669897 2964663802 Bacteria 7019362
758 2964676190 2964670856 Bacteria 6851364
759 2964684395 2964678106 Bacteria 6792020
760 2964686884 2964685014 Bacteria 6839111
761 2964694390 2964691889 Bacteria 6802758
762 2964701585 2964698721 Bacteria 6765331
763 2964710995 2964705432 Bacteria 7114648
764 2964714161 2964712639 Bacteria 6695970
765 2964726442 2964719344 Bacteria 7286602
766 2967666991 2967664464 Bacteria 6948836
767 2967673618 2967671571 Bacteria 7021409
768 2967685348 2967678726 Bacteria 7264382
769 2967690108 2967686174 Bacteria 6678622
770 2967697458 2967693043 Bacteria 6804451
771 2967700300 2967699805 Bacteria 6854538
772 2967709057 2967706974 Bacteria 7186053
773 2967716828 2967714385 Bacteria 7000047
774 2967726377 2967721400 Bacteria 7073753
775 2967732727 2967728569 Bacteria 6641507
776 2967740051 2967735183 Bacteria 6827012
777 2967746311 2967742019 Bacteria 6794534
778 2967753741 2967748971 Bacteria 6733771
779 2967758698 2967755722 Bacteria 6814706
780 2967768575 2967762386 Bacteria 6923502
781 2967770923 2967769361 Bacteria 6587838
782 2967780312 2967775926 Bacteria 6738189
783 2970020391 2970019648 Bacteria 7072033
784 2970030835 2970026789 Bacteria 6785236
785 2970034442 2970033650 Bacteria 7118744
786 2970046914 2970040964 Bacteria 6731123
787 2970048936 2970047711 Bacteria 7088379
788 2970057092 2970054988 Bacteria 6611507
789 2970066178 2970061556 Bacteria 7099761
790 2970070853 2970068827 Bacteria 7123112
791 2970079268 2970076120 Bacteria 6697332
792 2970083694 2970082768 Bacteria 6183754
793 2970090448 2970088815 Bacteria 6933825
794 2970099196 2970095765 Bacteria 6936963
795 2970107448 2970102677 Bacteria 6812532
796 2970111648 2970109326 Bacteria 6863976
797 2970121535 2970116247 Bacteria 6501857
798 2970129255 2970122695 Bacteria 6625855
799 2970133420 2970129317 Bacteria 6806560
800 2970137065 2970136068 Bacteria 7207982
801 2970149631 2970143518 Bacteria 6446480
802 2970156258 2970149975 Bacteria 6779706
803 2970161617 2970156795 Bacteria 7168044
804 2970169791 2970164137 Bacteria 6861252
805 2970176621 2970170962 Bacteria 6876229
806 2970180544 2970177841 Bacteria 6768001
807 2970189337 2970184632 Bacteria 7054431
808 2970198099 2970191845 Bacteria 7032787
809 2977521422 2977516862 Bacteria 6940108
810 2977529301 2977523885 Bacteria 6960446
811 2977537681 2977530762 Bacteria 6951399
812 2977542566 2977537788 Bacteria 6929320
813 2977547756 2977544691 Bacteria 6875412
814 2977556387 2977551784 Bacteria 7125765
815 2977560935 2977558990 Bacteria 6863948
816 2977567916 2977565890 Bacteria 6901543
817 2977575185 2977572785 Bacteria 6763888
818 2977584240 2977579622 Bacteria 6772100
819 641646261 641522639 Bacteria 7737025
820 648741258 648276728 Bacteria 6968865
821 8003993795 8003992118 Bacteria 7266902
822 8004001261 8003999396 Bacteria 7063185
823 8056118377 8056115690 Bacteria 5527654
824 8056123982 8056120720 Bacteria 5758328
825 Ga0495588_0051865
826 JGI25152J39213_1001223
827 JGI25152J39213_1007404
828 JGI25159J45721_1000950
829 JGI25159J45721_1012306
830 JGI25151J46595_10000898
831 JGI25151J46595_10003130
832 JGI25151J46595_10007717
833 JGI25153J46596_10002085
834 JGI25153J46596_10007725
835 rootL2_10181565
836 JGI25160J50197_1001299
837 JGI25160J50197_1009477
838 Ga0006562J51391_1029811
839 Ga0055535_1000067
840 Ga0055542_1000013
841 Ga0055526_1002433
842 Ga0055526_1005055
843 Ga0055537_1001026
844 Ga0055524_1001612
845 Ga0055524_1003424
846 Ga0055536_1000487
847 Ga0055536_1007738
848 Ga0055536_1013822
849 Ga0055534_1000037
850 Ga0055534_1000908
851 Ga0055534_1001625
852 Ga0055528_1001733
853 Ga0055528_1005679
854 Ga0055530_10002136
855 Ga0055530_10015817
856 Ga0055540_1000823
857 Ga0055540_1006303
858 Ga0055540_1013757
859 Ga0055540_1034205
860 Ga0055531_10005993
861 Ga0055531_10009907
862 Ga0055531_10010080
863 Ga0055543_1005104
864 Ga0065165_1009841
865 Ga0065704_10324882
866 Ga0068869_100190663
867 Ga0068869_100347677
868 Ga0070666_10156048
869 Ga0068868_100043666
870 Ga0070668_100015373
871 Ga0070668_100045071
872 Ga0070669_100105164
873 Ga0070669_100289816
874 Ga0070675_100034456
875 Ga0070675_100103910
876 Ga0070671_100172953
877 Ga0070688_100177975
878 Ga0070667_100083298
879 Ga0070667_100146824
880 Ga0070667_100424524
881 Ga0070710_10022606
882 Ga0070663_100107109
883 Ga0070678_100003439
884 Ga0070678_100005449
885 Ga0070662_100094896
886 Ga0070662_100479431
887 Ga0068867_100246563
888 Ga0070679_100109735
889 Ga0070684_100056906
890 Ga0068853_100019590
891 Ga0068853_100049473
892 Ga0070672_100077916
893 Ga0070686_100141236
894 Ga0070665_100009533
895 Ga0070665_100294481
896 Ga0068855_100127427
897 Ga0068857_100269099
898 Ga0068854_100048619
899 Ga0068856_100099399
900 Ga0068856_100111769
901 Ga0068852_100245679
902 Ga0068852_100269137
903 Ga0068852_100507308
904 Ga0068852_100525153
905 Ga0068859_100182109
906 Ga0068864_100018241
907 Ga0068864_100693080
908 Ga0068866_10218935
909 Ga0068851_10001681
910 Ga0068870_10235403
911 Ga0068858_100001489
912 Ga0068860_100183890
913 Ga0068862_100025253
914 Ga0068862_100701101
915 Ga0081538_10007055
916 Ga0075365_10043132
917 Ga0075365_10192395
918 Ga0075365_10420655
919 Ga0075363_100070152
920 Ga0075364_10037368
921 Ga0075364_10045505
922 Ga0075364_10242829
923 Ga0075432_10039526
924 Ga0070712_100425742
925 Ga0075362_10020584
926 Ga0075362_10046773
927 Ga0075362_10054037
928 Ga0075367_10002621
929 Ga0075367_10021684
930 Ga0075367_10028619
931 Ga0075367_10093933
932 Ga0075367_10160066
933 Ga0075367_10208135
934 Ga0075367_10240140
935 Ga0075369_10053512
936 Ga0075366_10006580
937 Ga0075366_10007047
938 Ga0075366_10010247
939 Ga0075366_10018411
940 Ga0075366_10062813
941 Ga0075366_10092085
942 Ga0097621_100036702
943 Ga0097621_100482354
944 Ga0075370_10001866
945 Ga0075370_10006203
946 Ga0075370_10031708
947 Ga0075370_10037403
948 Ga0075370_10053410
949 Ga0075370_10245531
950 Ga0068871_100023492
951 Ga0068871_100444615
952 Ga0075428_100275095
953 Ga0075434_100659518
954 Ga0068865_100472266
955 Ga0075436_100002903
956 Ga0097620_100182106
957 Ga0079104_1003374
958 Ga0099826_10000114
959 Ga0099826_10187855
960 Ga0099826_10280914
961 Ga0105244_10004674
962 Ga0105240_10060730
963 Ga0105240_10143700
964 Ga0105240_10645968
965 Ga0105245_10135384
966 Ga0105245_10234927
967 Ga0105247_10364511
968 Ga0105243_10001445
969 Ga0105243_10006352
970 Ga0105243_10835665
971 Ga0105241_10225799
972 Ga0105242_10404024
973 Ga0105248_10024764
974 Ga0105248_10108637
975 Ga0105237_10003155
976 Ga0105238_10131140
977 Ga0105238_10194092
978 Ga0105239_10033149
979 Ga0105239_10049769
980 Ga0105239_10907639
981 Ga0105246_10026796
982 Ga0105246_10206474
983 Ga0105246_10352694
984 Ga0157347_1000082
985 Ga0157373_10251065
986 Ga0157373_10430870
987 Ga0157371_10065553
988 Ga0157370_10006015
989 Ga0157370_10352584
990 Ga0157370_10489909
991 Ga0157369_10016911
992 Ga0157378_10021253
993 Ga0163162_10355855
994 Ga0157372_10306515
995 Ga0157375_10123109
996 Ga0157375_11009522
997 Ga0182008_10001553
998 Ga0182008_10006065
999 Ga0157379_10329821
1000 Ga0157376_10073897
1001 Ga0157376_10700614
1002 Ga0182006_1000791
1003 Ga0182007_10000665
1004 Ga0182007_10051712
1005 Ga0182005_1061693
1006 Ga0163161_10000205
1007 Ga0163161_10030538
1008 Ga0163161_10042384
1009 Ga0197907_10077284
1010 Ga0214542_1028809
1011 Ga0214543_1000011
1012 Ga0213875_10004685
1013 Ga0228711_1000007
1014 Ga0228710_1012407
1015 Ga0209436_117909
1016 Ga0209672_100764
1017 Ga0209147_102341
1018 Ga0209258_100020
1019 Ga0207425_1000201
1020 Ga0207425_1010860
1021 Ga0209148_1000031
1022 Ga0209129_1000055
1023 Ga0209129_1001550
1024 Ga0209129_1011486
1025 Ga0209565_1000131
1026 Ga0209565_1000390
1027 Ga0209565_1000908
1028 Ga0209673_1000170
1029 Ga0209673_1001037
1030 Ga0209673_1002836
1031 Ga0209130_1000214
1032 Ga0209130_1001286
1033 Ga0209675_1000055
1034 Ga0209675_1000187
1035 Ga0209675_1001222
1036 Ga0209675_1005316
1037 Ga0209676_1000040
1038 Ga0209676_1000346
1039 Ga0209676_1002868
1040 Ga0209676_1004505
1041 Ga0209676_1037606
1042 Ga0209025_1000065
1043 Ga0209025_1000510
1044 Ga0209025_1008592
1045 Ga0209025_1034248
1046 Ga0209564_1000254
1047 Ga0209564_1000410
1048 Ga0209758_1000042
1049 Ga0209758_1016734
1050 Ga0209050_1000021
1051 Ga0209050_1002455
1052 Ga0209050_1002960
1053 Ga0209050_1010106
1054 Ga0209050_1052444
1055 Ga0209256_1000056
1056 Ga0209256_1000148
1057 Ga0209256_1014417
1058 Ga0207426_1000055
1059 Ga0207426_1000079
1060 Ga0209051_1000028
1061 Ga0209051_1000126
1062 Ga0209051_1000358
1063 Ga0209051_1000730
1064 Ga0209051_1009211
1065 Ga0209257_1000043
1066 Ga0209257_1000214
1067 Ga0209257_1002680
1068 Ga0209257_1009897
1069 Ga0209257_1059961
1070 Ga0207656_10099350
1071 Ga0207656_10196139
1072 Ga0207655_1001433
1073 Ga0207692_10518621
1074 Ga0207642_10170769
1075 Ga0207654_10088687
1076 Ga0207695_10029483
1077 Ga0207695_10035154
1078 Ga0207695_10633577
1079 Ga0207671_10011914
1080 Ga0207693_10177394
1081 Ga0207663_10428463
1082 Ga0207652_10617521
1083 Ga0207681_10067164
1084 Ga0207694_10487503
1085 Ga0207659_10092244
1086 Ga0207659_10115197
1087 Ga0207687_10017378
1088 Ga0207687_10043970
1089 Ga0207700_10230743
1090 Ga0207706_10004477
1091 Ga0207706_10021002
1092 Ga0207706_10039800
1093 Ga0207686_10143646
1094 Ga0207709_10000141
1095 Ga0207709_10001560
1096 Ga0207709_10036708
1097 Ga0207669_10353160
1098 Ga0207704_10034439
1099 Ga0207704_10074453
1100 Ga0207665_10289121
1101 Ga0207665_10313355
1102 Ga0207691_10179467
1103 Ga0207661_10010656
1104 Ga0207667_10072977
1105 Ga0207667_10764267
1106 Ga0207668_10021315
1107 Ga0207640_10126288
1108 Ga0207640_10183916
1109 Ga0207658_10199594
1110 Ga0207658_10407428
1111 Ga0207677_10211946
1112 Ga0207703_10015842
1113 Ga0207639_10044624
1114 Ga0207639_10049344
1115 Ga0207678_10207652
1116 Ga0207678_10558331
1117 Ga0207702_10032531
1118 Ga0207702_10070190
1119 Ga0207648_10072098
1120 Ga0207648_10152783
1121 Ga0207676_10014887
1122 Ga0207674_10016550
1123 Ga0207674_10107542
1124 Ga0207674_10114171
1125 Ga0207683_10008390
1126 Ga0207683_10025391
1127 Ga0207683_10083894
1128 Ga0207683_10160856
1129 Ga0207698_10417286
1130 Ga0209281_1000483
1131 Ga0209281_1001582
1132 Ga0209282_1001687
1133 Ga0209282_1002141
1134 Ga0209813_10017116
1135 Ga0268266_10028909
1136 Ga0268266_10247458
1137 Ga0268265_10015392
1138 Ga0268264_10308962
1139 Ga0268264_10729974
1140 Ga0307517_10085067
1141 Ga0307515_10031067
1142 Ga0307515_10180921
1143 Ga0307511_10000961
1144 Ga0316183_1112507
1145 Ga0316181_1124668
1146 Ga0307513_10283186
1147 Ga0307408_100006816
1148 Ga0307408_100080466
1149 Ga0307508_10148920
1150 Ga0307514_10001974
1151 Ga0316576_10003896
1152 Ga0307516_10257143
1153 Ga0307405_10080151
1154 Ga0307405_10421624
1155 Ga0307410_10106850
1156 Ga0307406_10001006
1157 Ga0307406_10359934
1158 Ga0307407_10267355
1159 Ga0307412_10177022
1160 Ga0307412_10277353
1161 Ga0307412_10527062
1162 Ga0315914_1009665
1163 Ga0307416_100131999
1164 Ga0307416_101414466
1165 Ga0307414_10006219
1166 Ga0307414_10070678
1167 Ga0307414_10072811
1168 Ga0307411_10555511
1169 Ga0307411_10736360
1170 Ga0315913_1008343
1171 Ga0315915_1006342
1172 Ga0316574_0155192
1173 Ga0373937_0357839
1174 Ga0373937_0510910
1175 Ga0395900_0895766
1176 Ga0436364_0210196
1177 Ga0436364_0404370
1178 Ga0436364_1340931
1179 Ga0400483_060809
1180 Ga0400483_087861
1181 Ga0436365_0681628
1182 Ga0439436_0001962
1183 Ga0439436_0016108
1184 Ga0439438_057151
1185 Ga0439465_0002963
1186 Ga0439465_0015064
1187 Ga0451853_1571767
1188 Ga0439431_0125834
1189 Ga0439449_0008483
1190 Ga0439462_0028348
1191 Ga0450919_010458
1192 Ga0450920_051829
1193 Ga0450921_000336
1194 Ga0450923_000617
1195 Ga0450896_012486
1196 Ga0450898_003971
1197 Ga0450906_000845
1198 Ga0450907_002806
1199 Ga0439446_0023769
1200 Ga0450908_005980
1201 Ga0439434_0003116
1202 Ga0450918_000408
1203 Ga0450893_0004992
1204 Ga0466971_0312183
1205 Ga0466968_0016756
1206 Ga0466957_0049819
1207 Ga0451576_0003026
1208 Ga0466958_0466776
1209 Ga0466967_0035653
1210 Ga0466967_0045574
1211 Ga0466967_0103781
1212 Ga0495627_005656
1213 Ga0495590_0011560
1214 Ga0495607_0000463
1215 Ga0495608_0328025
1216 Ga0495610_0004895
1217 Ga0495610_0071812
1218 Ga0495616_0000588
1219 Ga0495631_0000096
1220 Ga0495632_0080102
1221 Ga0495637_0010154
1222 Ga0495654_0013821
1223 Ga0495609_0210225
1224 Ga0495621_0045319
1225 Ga0495597_0040631
1226 Ga0495633_0135237
1227 Ga0495668_0207462
1228 Ga0495625_0021809
1229 Ga0495625_0025462
1230 Ga0495625_0042063
1231 Ga0495659_0023718
1232 Ga0495661_0267009
1233 Ga0495588_0076003
1234 Ga0495599_0309976
1235 Ga0495658_0015427
1236 Ga0495658_0375900
1237 Ga0495670_0018917
1238 Ga0495670_0296505
1239 Ga0495671_0005310
1240 Ga0495649_0014678
1241 Ga0495660_0236434
1242 Ga0495674_0179934
1243 Ga0495674_0417334
1244 Ga0495687_000128
1245 Ga0495687_007505
1246 Ga0495687_021279
1247 Ga0495614_0004256
1248 Ga0495626_0032759
1249 Ga0496100_0134928
1250 Ga0496100_0195068
1251 Ga0496101_0035253
1252 Ga0496101_0050152
1253 Ga0496102_0153277
1254 Ga0496103_0327037
1255 Ga0496104_0241338
1256 Ga0496105_0034634
1257 Ga0496106_0288533
1258 Ga0496107_0049994
1259 Ga0496108_0034581
1260 Ga0496108_0217620
1261 Ga0496109_0046225
1262 Ga0496110_0088085
1263 Ga0496113_0324586
1264 Ga0496114_0102388
1265 Ga0496114_0376652
1266 Ga0496116_0152567
1267 Ga0496117_0039496
1268 Ga0496117_0058337
1269 Ga0496117_0186163
1270 Ga0496117_0203540
1271 Ga0496117_0215494
1272 Ga0496121_0009583
1273 Ga0496122_0103919
1274 Ga0496122_0149037
1275 Ga0496123_0018956
1276 Ga0496123_0040113
1277 Ga0496124_0004098
1278 Ga0496124_0029982
1279 Ga0496124_0143135
1280 Ga0496126_0288811
1281 Ga0495682_0146446
1282 Ga0501033_0120957
1283 Ga0501033_0460617
1284 Ga0501037_0453169
1285 Ga0501038_0229581
1286 Ga0501039_0460845
1287 Ga0501040_0063186
1288 Ga0501041_0458255
1289 Ga0501042_0090090
1290 Ga0501043_0076263
1291 Ga0501046_0176585
1292 Ga0501048_0040465
1293 Ga0501068_0012238
1294 Ga0501069_0005883
1295 Ga0501073_0340765
1296 Ga0501074_0097711
1297 Ga0501076_0010141
1298 Ga0501077_0005561
1299 Ga0501083_0162524
1300 Ga0501262_001136
1301 Ga0501035_0100861
1302 Ga0501045_0158498
1303 nmdc:mga03683_1260_c1
1304 nmdc:mga03683_68849_c1
1305 nmdc:mga03n38_225707_c1
1306 nmdc:mga03n38_35493_c1
1307 nmdc:mga03n38_70504_c1
1308 nmdc:mga03n38_91724_c1
1309 nmdc:mga00v17_11599_c2
1310 nmdc:mga00v17_18699_c1
1311 nmdc:mga00v17_352618_c1
1312 nmdc:mga00v17_538379_c1
1313 nmdc:mga0yw44_147713_c1
1314 nmdc:mga0yw44_178098_c1
1315 nmdc:mga0yw44_238707_c1
1316 nmdc:mga0k408_130542_c1
1317 nmdc:mga0k408_15478_c1
1318 nmdc:mga0k408_16327_c1
1319 nmdc:mga0k408_21047_c1
1320 nmdc:mga0k408_214821_c1
1321 nmdc:mga0k408_4308_c1
1322 nmdc:mga0k408_46106_c1
1323 nmdc:mga0k408_5617_c2
1324 nmdc:mga06z11_13296_c1
1325 nmdc:mga06z11_2108_c1
1326 nmdc:mga06z11_291177_c1
1327 nmdc:mga06z11_8606_c1
1328 nmdc:mga06z11_89996_c1
1329 nmdc:mga04h51_60951_c1
1330 nmdc:mga07m45_1191_c1
1331 nmdc:mga07m45_19691_c1
1332 nmdc:mga07m45_231590_c1
1333 nmdc:mga07m45_39023_c1
1334 nmdc:mga07m45_4200_c1
1335 nmdc:mga07m45_45632_c1
1336 nmdc:mga07m45_4959_c1
1337 nmdc:mga07m45_84192_c1
1338 nmdc:mga07m45_98379_c1
1339 nmdc:mga0n895_159763_c1
1340 nmdc:mga0n895_44244_c1
1341 nmdc:mga08x19_9598_c1
1342 nmdc:mga0sz30_29817_c1
1343 Ga0495601_0155252
1344 Ga0500610_0006834
1345 Ga0500610_0008235
1346 Ga0500635_0044050
1347 Ga0500643_000900
1348 Ga0500644_0025659
1349 Ga0500646_0012102
1350 Ga0500583_0091460
1351 Ga0500583_0106035
1352 Ga0500651_0002243
1353 Ga0500560_108509
1354 Ga0500562_009212
1355 Ga0500562_014627
1356 Ga0500569_065970
1357 Ga0500571_000053
1358 Ga0500593_000279
1359 Ga0500594_0002718
1360 Ga0500607_002002
1361 Ga0500607_026418
1362 Ga0500608_015334
1363 Ga0500608_044640
1364 Ga0500626_027061
1365 Ga0500642_0223803
1366 Ga0500655_000279
1367 Ga0500655_012349
1368 Ga0500658_0000099
1369 Ga0500658_0000893
1370 Ga0500658_0019594
1371 Ga0500559_0135732
1372 Ga0500564_015614
1373 Ga0500568_0000397
1374 Ga0500568_0018037
1375 Ga0500568_0059744
1376 Ga0500574_002258
1377 Ga0500604_0005920
1378 Ga0500616_0006937
1379 Ga0500616_0013141
1380 Ga0500627_0001116
1381 Ga0500638_008034
1382 Ga0500636_0004556
1383 Ga0500565_012013
1384 Ga0501084_0552030
1385 Ga0501082_0062338
1386 Ga0530510_0012056
1387 Ga0530510_0523221
1388 2509107472
1389 2509375807
1390 2510303338
1391 2511501844
1392 2512533282
1393 2512971223
1394 2513584703
1395 2513603932
1396 2513615413
1397 2513881201
1398 2513905657
1399 2513989019
1400 2513997139
1401 2514006157
1402 2515608707
1403 2516893139
1404 2517569896
1405 2524448889
1406 2545675582
1407 2551679560
1408 2551686646
1409 2551696277
1410 2551697484
1411 2551713823
1412 2551717863
1413 2551719343
1414 2551727824
1415 2551736600
1416 2551742996
1417 2558867667
1418 2558868075
1419 2585166063
1420 2585268086
1421 2585386812
1422 2599622326
1423 2599674582
1424 2599680267
1425 2599692283
1426 2644049107
1427 2644205280
1428 2644396812
1429 2644469507
1430 2644482141
1431 2644491746
1432 2644501783
1433 2738719421
1434 2738884582
1435 2739282848
1436 2802719170
1437 2802728674
1438 2802734932
1439 2802739113
1440 2802745013
1441 2802752288
1442 2807407815
1443 2807456118
1444 2808942647
1445 2819599024
1446 2831270813
1447 2837654690
1448 2838058860
1449 2842522618
1450 2842681549
1451 2850081067
1452 2855825940
1453 2855841290
1454 2858802268
1455 2885202377
1456 2885216030
1457 2894821119
1458 2895516717
1459 2899929846
1460 2904451722
1461 2904461789
1462 2904546505
1463 2915985539
1464 2915990352
1465 2916000737
1466 2916002778
1467 2916014503
1468 2916017357
1469 2916024024
1470 2916034302
1471 2916036726
1472 2916044294
1473 2916052232
1474 2916055551
1475 2916065293
1476 2916069813
1477 2916079585
1478 2919464567
1479 2919682987
1480 2920766143
1481 2921212596
1482 2921242352
1483 2921246565
1484 2921255183
1485 2921259609
1486 2921266960
1487 2921287360
1488 2921294132
1489 2921304037
1490 2924146003
1491 2924154539
1492 2924163068
1493 2924170302
1494 2924173301
1495 2924186120
1496 2924189852
1497 2924196550
1498 2924205834
1499 2924212996
1500 2924218074
1501 2924228425
1502 2924231435
1503 2928042213
1504 2928049982
1505 2928054562
1506 2928070150
1507 2928074231
1508 2928086466
1509 2929165951
1510 2929526626
1511 2936999579
1512 2937005979
1513 2937015330
1514 2937019346
1515 2937028921
1516 2937033658
1517 2937036484
1518 2937047506
1519 2937052084
1520 2937063471
1521 2937065853
1522 2937077838
1523 2937083789
1524 2937087030
1525 2937092806
1526 2937101178
1527 2937108004
1528 2937115228
1529 2937123345
1530 2937129118
1531 2941503614
1532 2945915630
1533 2945974989
1534 2945988959
1535 2954770173
1536 2957381469
1537 2957387517
1538 2957391801
1539 2957396636
1540 2957404889
1541 2957410926
1542 2957420148
1543 2957424146
1544 2957436600
1545 2957439396
1546 2957445711
1547 2957451893
1548 2957464166
1549 2957467834
1550 2957472441
1551 2957480709
1552 2957491402
1553 2957496648
1554 2957503738
1555 2957512470
1556 2960590090
1557 2960597323
1558 2960598269
1559 2960609654
1560 2960615168
1561 2960620877
1562 2960626589
1563 2960635928
1564 2960645113
1565 2960649023
1566 2960659235
1567 2960662172
1568 2960672951
1569 2960679716
1570 2960687275
1571 2960689924
1572 2960694330
1573 2964611744
1574 2964616934
1575 2964622733
1576 2964631100
1577 2964637562
1578 2964646455
1579 2964651676
1580 2964661616
1581 2964669897
1582 2964676190
1583 2964684395
1584 2964686884
1585 2964694390
1586 2964701585
1587 2964710995
1588 2964714161
1589 2964726442
1590 2967666991
1591 2967673618
1592 2967685348
1593 2967690108
1594 2967697458
1595 2967700300
1596 2967709057
1597 2967716828
1598 2967726377
1599 2967732727
1600 2967740051
1601 2967746311
1602 2967753741
1603 2967758698
1604 2967768575
1605 2967770923
1606 2967780312
1607 2970020391
1608 2970030835
1609 2970034442
1610 2970046914
1611 2970048936
1612 2970057092
1613 2970066178
1614 2970070853
1615 2970079268
1616 2970083694
1617 2970090448
1618 2970099196
1619 2970107448
1620 2970111648
1621 2970121535
1622 2970129255
1623 2970133420
1624 2970137065
1625 2970149631
1626 2970156258
1627 2970161617
1628 2970169791
1629 2970176621
1630 2970180544
1631 2970189337
1632 2970198099
1633 2977521422
1634 2977529301
1635 2977537681
1636 2977542566
1637 2977547756
1638 2977556387
1639 2977560935
1640 2977567916
1641 2977575185
1642 2977584240
1643 641646261
1644 648741258
1645 8003993795
1646 8004001261
1647 8056118377
1648 8056123982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

216

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

35

256

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o6v-assembly1.cif.gz_D crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase (ec 1.1.1.100) from brucella suis 0.9476 7 225
4o6v-assembly1.cif.gz_A crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase (ec 1.1.1.100) from brucella suis 0.9306 7 225
4o6v-assembly1.cif.gz_D crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase (ec 1.1.1.100) from brucella suis 0.9192 7 225
5ovl-assembly1.cif.gz_C crystal structure of maba bound to nadp+ from m. smegmatis 0.9105 7 225
4ag3-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with nadph at 1.8a resolution 0.9073 7 224
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9313 64 222 3.40.50.720
4o6vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 7 225 3.40.50.720
5ovlC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9105 7 225 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9077 71 222 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.904 44 221 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A529ZHY1-F1-model_v4 deleted 0.9666 73 225
AF-A0A436A7E7-F1-model_v4 deleted 0.9603 43 225
AF-A0A6N8ZK97-F1-model_v4 deleted 0.9569 42 222
AF-A0A436A7E7-F1-model_v4 deleted 0.9552 43 225
AF-A0A327YGQ2-F1-model_v4 deleted 0.9498 7 225

Map