F482201

General Info

Members Datasets Scaffolds Average Seq Length
820 446 744 110

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100422844|Ga0070663_1004228441
Length 126
Sequence MTKATRRTIATPPAQGHKRDARPAKRPSVRGSRTGRPIMALLDLLGRRWTLRIAWELREGSLTSRALRTACDDASPTVVQARLSELREAGLVELLPGDGYRLTALGQELNETFLPLYRFAERWSKR

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2791355199
10 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
11 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
12 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
13 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
14 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
15 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
16 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
17 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
18 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
19 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
20 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
21 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
22 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
23 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
24 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
25 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
26 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
27 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
28 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
29 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
30 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
31 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
32 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
33 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
34 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
35 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
36 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
37 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
38 2922368715
39 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
40 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
41 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
42 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
43 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
44 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
45 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
46 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
47 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
48 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
49 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
50 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
51 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
52 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
53 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
54 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
55 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
56 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
57 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
58 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
59 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
60 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
61 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
62 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
63 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
64 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
65 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
66 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
67 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
132 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
146 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
270 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
271 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
272 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
273 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
394 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
397 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
416 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
417 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
418 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
419 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
420 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
424 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
425 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
426 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
435 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
436 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
439 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
440 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
441 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
442 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
443 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
444 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
445 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
446 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 0
Isolates 9.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.59
Nodule 6.83
Rhizoplane 4.27
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10009457 3300003215 Bacteria 4528
2 rootL2_10122270 3300003322 Bacteria 1560
3 JGI25404J52841_10018969 3300003659 Bacteria 1490
4 JGI25404J52841_10021526 3300003659 Bacteria 1396
5 JGI25404J52841_10087605 3300003659 Bacteria 651
6 JGI25404J52841_10146277 3300003659 Bacteria 502
7 Ga0070658_10301967 3300005327 Bacteria 1365
8 Ga0070658_10454369 3300005327 Bacteria 1104
9 Ga0070658_10630521 3300005327 Bacteria 930
10 Ga0070676_11624409 3300005328 Bacteria 500
11 Ga0070683_100325152 3300005329 Bacteria 1464
12 Ga0070677_10482048 3300005333 Bacteria 669
13 Ga0068869_100121598 3300005334 Bacteria 1997
14 Ga0068869_100267954 3300005334 Bacteria 1369
15 Ga0068869_101279367 3300005334 Bacteria 646
16 Ga0070666_10215010 3300005335 Bacteria 1355
17 Ga0070666_10369250 3300005335 Bacteria 1029
18 Ga0070666_10696793 3300005335 Bacteria 745
19 Ga0070680_100017554 3300005336 Bacteria 5644
20 Ga0070680_100048802 3300005336 Bacteria 3450
21 Ga0070682_100072743 3300005337 Bacteria 2204
22 Ga0070682_100448157 3300005337 Bacteria 988
23 Ga0068868_100014062 3300005338 Bacteria 5891
24 Ga0068868_100114030 3300005338 Bacteria 2198
25 Ga0070689_101173391 3300005340 Bacteria 688
26 Ga0070687_100261716 3300005343 Bacteria 1080
27 Ga0070661_100175704 3300005344 Bacteria 1628
28 Ga0070661_100796474 3300005344 Bacteria 775
29 Ga0070668_100607299 3300005347 Bacteria 958
30 Ga0070668_100725306 3300005347 Bacteria 878
31 Ga0070668_101161077 3300005347 Bacteria 699
32 Ga0070668_101189032 3300005347 Bacteria 690
33 Ga0070668_101947008 3300005347 Bacteria 542
34 Ga0070675_101073300 3300005354 Bacteria 740
35 Ga0070671_100080455 3300005355 Bacteria 2724
36 Ga0070671_101560312 3300005355 Bacteria 585
37 Ga0070671_101989826 3300005355 Bacteria 517
38 Ga0070673_100333248 3300005364 Bacteria 1343
39 Ga0070688_100125494 3300005365 Bacteria 1724
40 Ga0070659_100654137 3300005366 Bacteria 906
41 Ga0070714_100311829 3300005435 Bacteria 1469
42 Ga0070714_102389867 3300005435 Bacteria 514
43 Ga0070713_100019375 3300005436 Bacteria 5193
44 Ga0070701_10363293 3300005438 Bacteria 908
45 Ga0070700_100211194 3300005441 Bacteria 1369
46 Ga0070708_100090073 3300005445 Bacteria 2792
47 Ga0070663_100029162 3300005455 Bacteria 3767
48 Ga0070663_100156007 3300005455 Bacteria 1754
49 Ga0070663_100244642 3300005455 Bacteria 1417
50 Ga0070663_100422844 3300005455 Bacteria 1093
51 Ga0070678_100032876 3300005456 Bacteria 3595
52 Ga0070678_100040360 3300005456 Bacteria 3302
53 Ga0070678_100136230 3300005456 Bacteria 1958
54 Ga0070662_100258360 3300005457 Bacteria 1403
55 Ga0070662_100860001 3300005457 Bacteria 773
56 Ga0070681_10075720 3300005458 Bacteria 3325
57 Ga0070681_10325818 3300005458 Bacteria 1446
58 Ga0070681_10575932 3300005458 Bacteria 1039
59 Ga0070681_10786286 3300005458 Bacteria 869
60 Ga0068867_100205532 3300005459 Bacteria 1578
61 Ga0070685_10813513 3300005466 Bacteria 690
62 Ga0070706_100578698 3300005467 Bacteria 1044
63 Ga0070706_101514664 3300005467 Bacteria 613
64 Ga0070698_102135573 3300005471 Bacteria 514
65 Ga0070699_100943203 3300005518 Bacteria 791
66 Ga0070679_100011213 3300005530 Bacteria 8545
67 Ga0070679_100020644 3300005530 Bacteria 6424
68 Ga0070679_100028212 3300005530 Bacteria 5533
69 Ga0070679_100855266 3300005530 Bacteria 853
70 Ga0070679_101345524 3300005530 Unclassified 660
71 Ga0070697_100851089 3300005536 Bacteria 808
72 Ga0068853_100033499 3300005539 Bacteria 4359
73 Ga0068853_100097575 3300005539 Bacteria 2594
74 Ga0068853_100681028 3300005539 Bacteria 980
75 Ga0068853_101055623 3300005539 Bacteria 783
76 Ga0068853_102186166 3300005539 Bacteria 536
77 Ga0070672_100721325 3300005543 Bacteria 874
78 Ga0070693_100228880 3300005547 Bacteria 1222
79 Ga0070693_100307986 3300005547 Bacteria 1070
80 Ga0070665_100038149 3300005548 Bacteria 4829
81 Ga0070665_100105625 3300005548 Bacteria 2818
82 Ga0070665_100241629 3300005548 Bacteria 1806
83 Ga0070665_100280074 3300005548 Bacteria 1669
84 Ga0070665_100748838 3300005548 Bacteria 990
85 Ga0068855_100023888 3300005563 Bacteria 7321
86 Ga0068855_101051673 3300005563 Bacteria 853
87 Ga0070664_100125780 3300005564 Bacteria 2249
88 Ga0068857_101781706 3300005577 Unclassified 602
89 Ga0068854_100640089 3300005578 Bacteria 912
90 Ga0068856_100000522 3300005614 Bacteria 42457
91 Ga0068856_100083848 3300005614 Bacteria 3166
92 Ga0068856_100298653 3300005614 Bacteria 1628
93 Ga0068856_100519715 3300005614 Bacteria 1212
94 Ga0068856_100578821 3300005614 Bacteria 1144
95 Ga0068852_100105731 3300005616 Bacteria 2550
96 Ga0068852_101031227 3300005616 Bacteria 842
97 Ga0068859_100196295 3300005617 Bacteria 2103
98 Ga0068859_100381704 3300005617 Bacteria 1504
99 Ga0068864_100643461 3300005618 Bacteria 1032
100 Ga0068866_10381933 3300005718 Bacteria 903
101 Ga0068861_100135065 3300005719 Bacteria 2006
102 Ga0068861_100796606 3300005719 Bacteria 886
103 Ga0068861_102443843 3300005719 Bacteria 525
104 Ga0068851_10244487 3300005834 Bacteria 1016
105 Ga0068870_10076743 3300005840 Bacteria 1836
106 Ga0068870_10177545 3300005840 Bacteria 1276
107 Ga0068863_100182097 3300005841 Bacteria 2017
108 Ga0068863_100598853 3300005841 Bacteria 1091
109 Ga0068863_101458158 3300005841 Bacteria 692
110 Ga0068863_102593529 3300005841 Bacteria 516
111 Ga0068858_100124003 3300005842 Bacteria 2418
112 Ga0068858_100341288 3300005842 Bacteria 1434
113 Ga0068858_101250578 3300005842 Bacteria 730
114 Ga0068860_100506624 3300005843 Bacteria 1206
115 Ga0068860_100900227 3300005843 Bacteria 901
116 Ga0068860_101047176 3300005843 Bacteria 834
117 Ga0068860_101656962 3300005843 Bacteria 662
118 Ga0068862_100107769 3300005844 Bacteria 2442
119 Ga0068862_100216805 3300005844 Bacteria 1731
120 Ga0068862_100805409 3300005844 Bacteria 917
121 Ga0068862_102096388 3300005844 Bacteria 577
122 Ga0081455_10026185 3300005937 Bacteria 5372
123 Ga0081455_10176688 3300005937 Bacteria 1621
124 Ga0081538_10099656 3300005981 Bacteria 1467
125 Ga0081540_1011981 3300005983 Bacteria 5748
126 Ga0081540_1031373 3300005983 Bacteria 2922
127 Ga0081540_1049888 3300005983 Bacteria 2084
128 Ga0081540_1100218 3300005983 Bacteria 1250
129 Ga0081539_10017936 3300005985 Bacteria 4939
130 Ga0070717_10000325 3300006028 Bacteria 31034
131 Ga0075365_10116517 3300006038 Bacteria 1840
132 Ga0075365_10129506 3300006038 Bacteria 1746
133 Ga0075365_10424752 3300006038 Bacteria 938
134 Ga0075365_10595468 3300006038 Bacteria 782
135 Ga0075365_10711359 3300006038 Bacteria 709
136 Ga0075365_11325633 3300006038 Bacteria 506
137 Ga0075368_10071172 3300006042 Bacteria 1405
138 Ga0075368_10153966 3300006042 Bacteria 961
139 Ga0075363_100030546 3300006048 Bacteria 2790
140 Ga0075363_100069487 3300006048 Bacteria 1911
141 Ga0075363_100221741 3300006048 Bacteria 1084
142 Ga0075363_100643338 3300006048 Bacteria 638
143 Ga0075364_10974869 3300006051 Bacteria 577
144 Ga0070716_100053569 3300006173 Bacteria 2301
145 Ga0070716_100084265 3300006173 Bacteria 1906
146 Ga0070712_100797821 3300006175 Bacteria 810
147 Ga0070712_100902539 3300006175 Bacteria 762
148 Ga0070712_101856912 3300006175 Bacteria 528
149 Ga0075362_10068209 3300006177 Bacteria 1619
150 Ga0075362_10089972 3300006177 Bacteria 1424
151 Ga0075362_10144625 3300006177 Bacteria 1138
152 Ga0075362_10175521 3300006177 Bacteria 1037
153 Ga0075362_10243844 3300006177 Bacteria 883
154 Ga0075362_10436629 3300006177 Bacteria 664
155 Ga0075367_10045872 3300006178 Bacteria 2566
156 Ga0075367_10066484 3300006178 Bacteria 2160
157 Ga0075367_10409112 3300006178 Bacteria 858
158 Ga0075367_10410528 3300006178 Bacteria 857
159 Ga0075367_10540681 3300006178 Bacteria 740
160 Ga0075369_10019469 3300006186 Bacteria 2771
161 Ga0075369_10026495 3300006186 Bacteria 2416
162 Ga0075366_10024339 3300006195 Bacteria 3531
163 Ga0075366_10157117 3300006195 Bacteria 1377
164 Ga0075366_10292653 3300006195 Bacteria 996
165 Ga0075366_10387093 3300006195 Unclassified 860
166 Ga0075366_10786564 3300006195 Bacteria 592
167 Ga0075370_10028156 3300006353 Bacteria 3122
168 Ga0075370_10041996 3300006353 Bacteria 2582
169 Ga0075370_10077103 3300006353 Bacteria 1912
170 Ga0075370_10337092 3300006353 Unclassified 900
171 Ga0068871_100481216 3300006358 Bacteria 1117
172 Ga0075428_101806788 3300006844 Bacteria 636
173 Ga0075428_102209334 3300006844 Bacteria 568
174 Ga0075430_100178283 3300006846 Bacteria 1768
175 Ga0075434_100011477 3300006871 Bacteria 8362
176 Ga0068865_100529464 3300006881 Bacteria 987
177 Ga0068865_102037398 3300006881 Bacteria 521
178 Ga0075436_100265403 3300006914 Bacteria 1225
179 Ga0097620_100196308 3300006931 Bacteria 2103
180 Ga0097620_100381686 3300006931 Bacteria 1504
181 Ga0099823_1010603 3300006944 Bacteria 9345
182 Ga0075435_100091989 3300007076 Bacteria 2504
183 Ga0099794_10035033 3300007265 Bacteria 2367
184 Ga0105240_10272940 3300009093 Bacteria 1946
185 Ga0105240_10368125 3300009093 Bacteria 1626
186 Ga0111539_10285806 3300009094 Bacteria 1919
187 Ga0105245_10012692 3300009098 Bacteria 7335
188 Ga0105247_10123534 3300009101 Bacteria 1680
189 Ga0114129_10177369 3300009147 Bacteria 2902
190 Ga0114129_11137135 3300009147 Bacteria 976
191 Ga0105243_11613235 3300009148 Bacteria 676
192 Ga0105241_10716595 3300009174 Bacteria 915
193 Ga0105242_10988231 3300009176 Bacteria 848
194 Ga0105248_10046694 3300009177 Bacteria 4855
195 Ga0105248_10461340 3300009177 Bacteria 1432
196 Ga0105248_10461429 3300009177 Bacteria 1432
197 Ga0105248_11066290 3300009177 Bacteria 913
198 Ga0105248_11821254 3300009177 Bacteria 690
199 Ga0105237_10303264 3300009545 Bacteria 1600
200 Ga0105237_10586768 3300009545 Bacteria 1121
201 Ga0105237_10660884 3300009545 Bacteria 1052
202 Ga0105237_12787494 3300009545 Bacteria 500
203 Ga0105238_10078299 3300009551 Bacteria 3296
204 Ga0105249_10203428 3300009553 Bacteria 1939
205 Ga0105249_10443668 3300009553 Bacteria 1335
206 Ga0099796_10062676 3300010159 Bacteria 1322
207 Ga0105239_10097211 3300010375 Bacteria 3254
208 Ga0105239_10353779 3300010375 Bacteria 1658
209 Ga0105239_10592947 3300010375 Bacteria 1264
210 Ga0105239_12035665 3300010375 Bacteria 667
211 Ga0105239_13406843 3300010375 Bacteria 517
212 Ga0105246_10983585 3300011119 Bacteria 763
213 Ga0105246_11039479 3300011119 Bacteria 744
214 Ga0105246_12501470 3300011119 Bacteria 508
215 Ga0157370_10655413 3300013104 Bacteria 959
216 Ga0157370_11874399 3300013104 Bacteria 538
217 Ga0157369_10307718 3300013105 Bacteria 1648
218 Ga0157369_10389029 3300013105 Bacteria 1447
219 Ga0157369_10705902 3300013105 Bacteria 1038
220 Ga0157374_10113473 3300013296 Bacteria 2608
221 Ga0157374_11728134 3300013296 Bacteria 650
222 Ga0157378_10018404 3300013297 Bacteria 6135
223 Ga0157378_10255636 3300013297 Bacteria 1679
224 Ga0157378_10548988 3300013297 Bacteria 1160
225 Ga0163162_10047620 3300013306 Bacteria 4296
226 Ga0163162_10463964 3300013306 Bacteria 1398
227 Ga0163162_10778708 3300013306 Bacteria 1075
228 Ga0163162_11038665 3300013306 Bacteria 927
229 Ga0163162_11398842 3300013306 Bacteria 796
230 Ga0163162_12444255 3300013306 Bacteria 601
231 Ga0163162_12915089 3300013306 Bacteria 550
232 Ga0163162_13005952 3300013306 Bacteria 542
233 Ga0157375_10013598 3300013308 Bacteria 7251
234 Ga0157375_10214579 3300013308 Bacteria 2082
235 Ga0157375_10393869 3300013308 Bacteria 1552
236 Ga0157375_10409346 3300013308 Bacteria 1522
237 Ga0157375_10429877 3300013308 Bacteria 1486
238 Ga0157375_11081242 3300013308 Bacteria 938
239 Ga0157375_11374626 3300013308 Bacteria 831
240 Ga0163163_10017597 3300014325 Bacteria 6669
241 Ga0163163_10130037 3300014325 Bacteria 2558
242 Ga0163163_11110114 3300014325 Bacteria 854
243 Ga0163163_11822697 3300014325 Bacteria 669
244 Ga0163163_11890179 3300014325 Bacteria 657
245 Ga0157380_10201667 3300014326 Bacteria 1765
246 Ga0182008_10153885 3300014497 Bacteria 1154
247 Ga0157377_10050988 3300014745 Bacteria 2333
248 Ga0157377_11629435 3300014745 Bacteria 518
249 Ga0157379_10041641 3300014968 Bacteria 4100
250 Ga0157379_10245391 3300014968 Bacteria 1625
251 Ga0157376_10215020 3300014969 Bacteria 1777
252 Ga0163161_10303652 3300017792 Bacteria 1258
253 Ga0163161_10442413 3300017792 Bacteria 1049
254 Ga0163161_11700544 3300017792 Bacteria 559
255 Ga0163161_12089195 3300017792 Bacteria 504
256 Ga0213871_10014349 3300021441 Bacteria 1877
257 Ga0209148_1015258 3300025254 Bacteria 1344
258 Ga0209758_1005984 3300025297 Bacteria 9007
259 Ga0207682_10372930 3300025893 Bacteria 673
260 Ga0207710_10112002 3300025900 Bacteria 1297
261 Ga0207710_10179041 3300025900 Bacteria 1039
262 Ga0207688_10136258 3300025901 Bacteria 1442
263 Ga0207688_10220147 3300025901 Bacteria 1143
264 Ga0207680_10160679 3300025903 Bacteria 1506
265 Ga0207680_10566378 3300025903 Bacteria 811
266 Ga0207645_10100720 3300025907 Bacteria 1863
267 Ga0207643_10504244 3300025908 Bacteria 774
268 Ga0207707_10053447 3300025912 Bacteria 3516
269 Ga0207707_10249254 3300025912 Bacteria 1543
270 Ga0207707_10450243 3300025912 Bacteria 1102
271 Ga0207707_10679020 3300025912 Bacteria 866
272 Ga0207671_11418492 3300025914 Bacteria 538
273 Ga0207693_10526066 3300025915 Bacteria 923
274 Ga0207693_10679009 3300025915 Bacteria 799
275 Ga0207663_10531104 3300025916 Bacteria 917
276 Ga0207660_10017344 3300025917 Bacteria 4783
277 Ga0207660_10029807 3300025917 Bacteria 3747
278 Ga0207660_10134958 3300025917 Bacteria 1882
279 Ga0207662_10225699 3300025918 Bacteria 1221
280 Ga0207649_10136724 3300025920 Bacteria 1672
281 Ga0207649_10360425 3300025920 Bacteria 1079
282 Ga0207652_10049994 3300025921 Bacteria 3581
283 Ga0207652_10101478 3300025921 Bacteria 2542
284 Ga0207652_10439951 3300025921 Bacteria 1175
285 Ga0207652_11201518 3300025921 Unclassified 660
286 Ga0207694_10252792 3300025924 Bacteria 1442
287 Ga0207694_10339564 3300025924 Bacteria 1242
288 Ga0207694_11355786 3300025924 Bacteria 601
289 Ga0207650_10286400 3300025925 Bacteria 1343
290 Ga0207650_11006663 3300025925 Bacteria 709
291 Ga0207659_10901429 3300025926 Bacteria 760
292 Ga0207659_11699709 3300025926 Bacteria 537
293 Ga0207659_11762149 3300025926 Bacteria 527
294 Ga0207687_10073554 3300025927 Bacteria 2447
295 Ga0207700_10018587 3300025928 Bacteria 4676
296 Ga0207664_10423502 3300025929 Bacteria 1186
297 Ga0207664_10500595 3300025929 Bacteria 1088
298 Ga0207644_10113061 3300025931 Bacteria 2056
299 Ga0207644_10840177 3300025931 Bacteria 769
300 Ga0207690_10838561 3300025932 Bacteria 761
301 Ga0207706_10889590 3300025933 Bacteria 753
302 Ga0207709_10184326 3300025935 Bacteria 1477
303 Ga0207709_10263760 3300025935 Bacteria 1264
304 Ga0207704_10175686 3300025938 Bacteria 1542
305 Ga0207704_10862334 3300025938 Bacteria 760
306 Ga0207665_10097547 3300025939 Bacteria 2046
307 Ga0207665_10176706 3300025939 Bacteria 1544
308 Ga0207691_10473402 3300025940 Bacteria 1065
309 Ga0207691_10962012 3300025940 Bacteria 713
310 Ga0207711_10047611 3300025941 Bacteria 3667
311 Ga0207711_10443845 3300025941 Bacteria 1208
312 Ga0207711_10835466 3300025941 Bacteria 857
313 Ga0207689_10037068 3300025942 Bacteria 4046
314 Ga0207689_10062358 3300025942 Bacteria 3066
315 Ga0207689_11556656 3300025942 Bacteria 551
316 Ga0207661_10512137 3300025944 Bacteria 1097
317 Ga0207679_10063126 3300025945 Bacteria 2764
318 Ga0207651_10416540 3300025960 Bacteria 1146
319 Ga0207651_11108187 3300025960 Bacteria 710
320 Ga0207668_10035874 3300025972 Bacteria 3306
321 Ga0207668_10039748 3300025972 Bacteria 3169
322 Ga0207668_10461337 3300025972 Bacteria 1086
323 Ga0207668_10543037 3300025972 Bacteria 1006
324 Ga0207668_10648666 3300025972 Bacteria 924
325 Ga0207668_11353917 3300025972 Bacteria 641
326 Ga0207640_10456117 3300025981 Bacteria 1055
327 Ga0207677_10007318 3300026023 Bacteria 6096
328 Ga0207677_10443411 3300026023 Bacteria 1111
329 Ga0207677_10496358 3300026023 Bacteria 1054
330 Ga0207677_11369830 3300026023 Bacteria 651
331 Ga0207703_10190261 3300026035 Bacteria 1817
332 Ga0207703_12109895 3300026035 Bacteria 540
333 Ga0207639_10095084 3300026041 Bacteria 2394
334 Ga0207639_10164148 3300026041 Bacteria 1875
335 Ga0207678_10018506 3300026067 Bacteria 6118
336 Ga0207678_10036446 3300026067 Bacteria 4281
337 Ga0207678_10266009 3300026067 Bacteria 1470
338 Ga0207678_10306141 3300026067 Bacteria 1366
339 Ga0207678_10320693 3300026067 Bacteria 1333
340 Ga0207678_10358339 3300026067 Bacteria 1258
341 Ga0207678_10420561 3300026067 Bacteria 1159
342 Ga0207678_10807307 3300026067 Bacteria 828
343 Ga0207708_10221292 3300026075 Bacteria 1517
344 Ga0207708_10639062 3300026075 Bacteria 905
345 Ga0207702_10000014 3300026078 Bacteria 253304
346 Ga0207702_10097706 3300026078 Bacteria 2585
347 Ga0207702_10752686 3300026078 Bacteria 962
348 Ga0207641_11169825 3300026088 Bacteria 768
349 Ga0207641_12123235 3300026088 Bacteria 562
350 Ga0207676_10742510 3300026095 Bacteria 954
351 Ga0207676_10785932 3300026095 Bacteria 928
352 Ga0207676_11601381 3300026095 Bacteria 649
353 Ga0207674_11112171 3300026116 Bacteria 759
354 Ga0207674_11263584 3300026116 Bacteria 708
355 Ga0207675_100051489 3300026118 Bacteria 3842
356 Ga0207675_100574536 3300026118 Bacteria 1128
357 Ga0207675_101537961 3300026118 Bacteria 686
358 Ga0207675_102235302 3300026118 Bacteria 562
359 Ga0207683_10010329 3300026121 Bacteria 7963
360 Ga0207683_10059461 3300026121 Bacteria 3357
361 Ga0207683_10181418 3300026121 Bacteria 1909
362 Ga0207698_10063522 3300026142 Bacteria 2890
363 Ga0207698_10231745 3300026142 Bacteria 1677
364 Ga0209389_1000016 3300027296 Bacteria 184844
365 Ga0209489_100063 3300027361 Bacteria 144408
366 Ga0209700_100012 3300027363 Bacteria 357892
367 Ga0209813_10015793 3300027866 Bacteria 2052
368 Ga0209813_10074050 3300027866 Bacteria 1113
369 Ga0209813_10096138 3300027866 Bacteria 1001
370 Ga0207428_10517963 3300027907 Bacteria 865
371 Ga0268266_10004186 3300028379 Bacteria 13903
372 Ga0268266_10035828 3300028379 Bacteria 4220
373 Ga0268266_10297237 3300028379 Bacteria 1505
374 Ga0268266_10587538 3300028379 Bacteria 1069
375 Ga0268266_11408435 3300028379 Bacteria 673
376 Ga0268266_11533360 3300028379 Bacteria 642
377 Ga0268266_12022772 3300028379 Bacteria 549
378 Ga0268265_10120393 3300028380 Bacteria 2161
379 Ga0268265_10179152 3300028380 Bacteria 1819
380 Ga0268265_10419214 3300028380 Bacteria 1242
381 Ga0268264_10181165 3300028381 Bacteria 1913
382 Ga0268264_11655039 3300028381 Bacteria 651
383 Ga0268264_11661847 3300028381 Bacteria 649
384 Ga0265334_10000205 3300028573 Bacteria 34229
385 Ga0265334_10029025 3300028573 Bacteria 2218
386 Ga0307517_10476983 3300028786 Bacteria 640
387 Ga0307517_10649604 3300028786 Bacteria 513
388 Ga0307515_10394839 3300028794 Bacteria 1011
389 Ga0307515_10414896 3300028794 Bacteria 968
390 Ga0307515_10462906 3300028794 Bacteria 882
391 Ga0265328_10311026 3300031239 Bacteria 609
392 Ga0265339_10101052 3300031249 Bacteria 1501
393 Ga0265331_10097325 3300031250 Bacteria 1357
394 Ga0265331_10099252 3300031250 Bacteria 1341
395 Ga0265331_10156540 3300031250 Bacteria 1034
396 Ga0265316_10102766 3300031344 Bacteria 2171
397 Ga0307513_10378818 3300031456 Bacteria 1155
398 Ga0307513_10454173 3300031456 Bacteria 1005
399 Ga0307509_10267924 3300031507 Bacteria 1478
400 Ga0307509_10498154 3300031507 Unclassified 903
401 Ga0307509_10712027 3300031507 Bacteria 670
402 Ga0307408_100373302 3300031548 Bacteria 1217
403 Ga0307408_100441588 3300031548 Bacteria 1127
404 Ga0307408_100660612 3300031548 Bacteria 936
405 Ga0307408_101287966 3300031548 Bacteria 685
406 Ga0265342_10093995 3300031712 Bacteria 1716
407 Ga0307516_10169761 3300031730 Bacteria 1923
408 Ga0307405_11322647 3300031731 Bacteria 628
409 Ga0307413_10527820 3300031824 Bacteria 953
410 Ga0307413_10801422 3300031824 Bacteria 792
411 Ga0307413_12189339 3300031824 Bacteria 501
412 Ga0307410_10197273 3300031852 Bacteria 1535
413 Ga0307406_10319565 3300031901 Bacteria 1200
414 Ga0307406_10432905 3300031901 Bacteria 1051
415 Ga0307406_10684557 3300031901 Bacteria 855
416 Ga0307406_12109741 3300031901 Bacteria 505
417 Ga0307412_10384165 3300031911 Bacteria 1138
418 Ga0307412_10447650 3300031911 Bacteria 1063
419 Ga0307412_11152607 3300031911 Bacteria 692
420 Ga0307409_100785057 3300031995 Bacteria 959
421 Ga0307409_101248187 3300031995 Bacteria 767
422 Ga0307409_101467526 3300031995 Bacteria 709
423 Ga0307409_102051144 3300031995 Bacteria 602
424 Ga0307416_100166359 3300032002 Bacteria 2046
425 Ga0307416_100713180 3300032002 Bacteria 1093
426 Ga0307416_101108066 3300032002 Bacteria 896
427 Ga0307416_101785369 3300032002 Bacteria 719
428 Ga0307416_102154646 3300032002 Bacteria 659
429 Ga0307411_10614805 3300032005 Bacteria 936
430 Ga0307411_11062251 3300032005 Unclassified 728
431 Ga0307411_11086952 3300032005 Bacteria 720
432 Ga0307411_11109766 3300032005 Bacteria 713
433 Ga0307415_100839027 3300032126 Bacteria 842
434 Ga0307507_10639363 3300033179 Bacteria 542
435 Ga0307510_10019452 3300033180 Bacteria 7967
436 Ga0307510_10283845 3300033180 Bacteria 1125
437 Ga0373934_0194745 3300035086 Bacteria 834
438 Ga0373936_0292374 3300035113 Bacteria 734
439 Ga0373953_0173447 3300035117 Bacteria 929
440 Ga0373953_0305569 3300035117 Bacteria 694
441 Ga0373943_0019829 3300035170 Bacteria 3096
442 Ga0373955_0302418 3300035172 Bacteria 965
443 Ga0373955_0808675 3300035172 Bacteria 576
444 Ga0373931_0702153 3300035691 Bacteria 668
445 Ga0373927_0079443 3300035695 Bacteria 2125
446 Ga0373927_0337047 3300035695 Bacteria 993
447 Ga0373933_0002307 3300035724 Bacteria 10837
448 Ga0373933_0305874 3300035724 Bacteria 1030
449 Ga0373933_0510864 3300035724 Bacteria 787
450 Ga0373947_0015251 3300035725 Bacteria 4412
451 Ga0373947_0241823 3300035725 Bacteria 1191
452 Ga0373947_0486484 3300035725 Bacteria 838
453 Ga0373947_0976646 3300035725 Bacteria 578
454 Ga0373925_0032743 3300037068 Bacteria 3827
455 Ga0373925_0043457 3300037068 Bacteria 3335
456 Ga0373925_0046639 3300037068 Bacteria 3223
457 Ga0373925_0469041 3300037068 Bacteria 1032
458 Ga0439465_0236626 3300041413 Bacteria 673
459 Ga0451791_0739765 3300041451 Bacteria 745
460 Ga0451795_1327697 3300041456 Bacteria 520
461 Ga0451798_0676178 3300041458 Bacteria 833
462 Ga0451802_1420511 3300041460 Bacteria 678
463 Ga0451802_2110330 3300041460 Bacteria 710
464 Ga0451807_1607596 3300041486 Bacteria 944
465 Ga0451837_0166180 3300041494 Bacteria 943
466 Ga0451853_2647951 3300041512 Bacteria 1802
467 Ga0451853_2941052 3300041512 Bacteria 565
468 Ga0439458_0017499 3300042157 Bacteria 1638
469 Ga0466969_0451963 3300044656 Bacteria 585
470 Ga0466972_0000177 3300044658 Bacteria 49318
471 Ga0466965_0085702 3300044683 Bacteria 1597
472 Ga0466971_0094190 3300044719 Bacteria 1373
473 Ga0466970_0075288 3300044765 Bacteria 1818
474 Ga0466958_0756378 3300045836 Bacteria 633
475 Ga0495617_012261 3300046452 Bacteria 2920
476 Ga0495603_0011257 3300046455 Bacteria 5419
477 Ga0495603_0019146 3300046455 Bacteria 4144
478 Ga0495603_0023274 3300046455 Bacteria 3751
479 Ga0495603_0240898 3300046455 Bacteria 1042
480 Ga0495629_0233421 3300046459 Bacteria 1268
481 Ga0495638_0104161 3300046460 Bacteria 1692
482 Ga0495641_0041267 3300046461 Bacteria 2144
483 Ga0495641_0216531 3300046461 Bacteria 859
484 Ga0495651_0087411 3300046462 Bacteria 2344
485 Ga0495651_0515749 3300046462 Bacteria 763
486 Ga0495653_0377238 3300046463 Bacteria 906
487 Ga0495580_0406108 3300046472 Bacteria 918
488 Ga0495582_0042207 3300046473 Bacteria 2513
489 Ga0495582_0564199 3300046473 Bacteria 659
490 Ga0495605_0024252 3300046474 Bacteria 3177
491 Ga0495605_0143211 3300046474 Bacteria 1071
492 Ga0495605_0157201 3300046474 Bacteria 1011
493 Ga0495605_0209218 3300046474 Bacteria 847
494 Ga0495605_0386999 3300046474 Bacteria 583
495 Ga0495639_0149486 3300046475 Bacteria 1126
496 Ga0495639_0203272 3300046475 Bacteria 970
497 Ga0495639_0402648 3300046475 Bacteria 691
498 Ga0495639_0657239 3300046475 Bacteria 540
499 Ga0495664_0030300 3300046477 Bacteria 3168
500 Ga0495664_0047566 3300046477 Bacteria 2546
501 Ga0495664_0276709 3300046477 Bacteria 1014
502 Ga0495664_0504460 3300046477 Bacteria 722
503 Ga0495584_0095443 3300046491 Bacteria 1501
504 Ga0495585_0110640 3300046492 Bacteria 1461
505 Ga0495585_0169275 3300046492 Bacteria 1129
506 Ga0495585_0310967 3300046492 Bacteria 772
507 Ga0495594_0452954 3300046499 Bacteria 729
508 Ga0495596_0037063 3300046500 Bacteria 1930
509 Ga0495596_0151077 3300046500 Bacteria 902
510 Ga0495596_0161249 3300046500 Bacteria 871
511 Ga0495596_0201027 3300046500 Bacteria 774
512 Ga0495607_0217623 3300046501 Bacteria 936
513 Ga0495607_0361142 3300046501 Bacteria 668
514 Ga0495607_0434386 3300046501 Bacteria 592
515 Ga0495606_0001686 3300046507 Bacteria 28531
516 Ga0495606_0012396 3300046507 Bacteria 6839
517 Ga0495608_0279694 3300046511 Bacteria 1036
518 Ga0495608_0631357 3300046511 Bacteria 641
519 Ga0495610_0123246 3300046512 Bacteria 1133
520 Ga0495616_0146426 3300046513 Bacteria 1071
521 Ga0495616_0180963 3300046513 Bacteria 937
522 Ga0495616_0242355 3300046513 Bacteria 777
523 Ga0495620_0055003 3300046515 Bacteria 1679
524 Ga0495620_0074829 3300046515 Bacteria 1379
525 Ga0495620_0080394 3300046515 Bacteria 1319
526 Ga0495628_0442221 3300046516 Bacteria 945
527 Ga0495630_0059712 3300046517 Bacteria 2861
528 Ga0495631_0033505 3300046518 Bacteria 2307
529 Ga0495632_0147623 3300046519 Bacteria 1088
530 Ga0495632_0203522 3300046519 Bacteria 900
531 Ga0495632_0330836 3300046519 Bacteria 672
532 Ga0495643_0028158 3300046522 Bacteria 3153
533 Ga0495643_0244119 3300046522 Bacteria 841
534 Ga0495644_0322078 3300046523 Bacteria 606
535 Ga0495648_0017419 3300046524 Bacteria 5134
536 Ga0495663_0100245 3300046525 Bacteria 953
537 Ga0495666_0173837 3300046526 Bacteria 996
538 Ga0495666_0392120 3300046526 Bacteria 624
539 Ga0495642_0114043 3300046528 Bacteria 1157
540 Ga0495642_0245848 3300046528 Bacteria 782
541 Ga0495652_0130491 3300046529 Bacteria 1990
542 Ga0495654_0096274 3300046530 Bacteria 1368
543 Ga0495665_0232244 3300046531 Bacteria 952
544 Ga0495586_0365121 3300046535 Bacteria 830
545 Ga0495587_0262029 3300046536 Bacteria 971
546 Ga0495587_0512512 3300046536 Bacteria 663
547 Ga0495587_0513338 3300046536 Bacteria 662
548 Ga0495609_0067233 3300046538 Bacteria 1578
549 Ga0495609_0124057 3300046538 Bacteria 1109
550 Ga0495609_0159166 3300046538 Bacteria 958
551 Ga0495597_0171117 3300046542 Bacteria 882
552 Ga0495645_0123813 3300046543 Bacteria 1818
553 Ga0495622_0029989 3300046557 Bacteria 2541
554 Ga0495622_0123645 3300046557 Bacteria 1181
555 Ga0495633_0229205 3300046558 Bacteria 849
556 Ga0495633_0281271 3300046558 Bacteria 757
557 Ga0495656_0004583 3300046615 Bacteria 4743
558 Ga0495656_0156674 3300046615 Bacteria 1104
559 Ga0495656_0357593 3300046615 Bacteria 758
560 Ga0495668_0088884 3300046616 Bacteria 1693
561 Ga0495668_0145069 3300046616 Bacteria 1299
562 Ga0495668_0215498 3300046616 Bacteria 1051
563 Ga0495668_0263938 3300046616 Bacteria 943
564 Ga0495668_0311914 3300046616 Bacteria 862
565 Ga0495668_0653876 3300046616 Bacteria 581
566 Ga0495634_0775245 3300046642 Bacteria 548
567 Ga0495611_0198249 3300046648 Bacteria 937
568 Ga0495611_0204938 3300046648 Bacteria 919
569 Ga0495625_0025297 3300046660 Bacteria 4503
570 Ga0495625_0262166 3300046660 Bacteria 1118
571 Ga0495625_0725939 3300046660 Bacteria 584
572 Ga0495635_0400549 3300046663 Bacteria 912
573 Ga0495659_0019280 3300046664 Bacteria 2282
574 Ga0495588_0106822 3300046674 Bacteria 1473
575 Ga0495588_0212477 3300046674 Bacteria 1021
576 Ga0495588_0751840 3300046674 Bacteria 510
577 Ga0495657_0166924 3300046675 Bacteria 1358
578 Ga0495623_0253437 3300046679 Unclassified 989
579 Ga0495623_0563545 3300046679 Bacteria 595
580 Ga0495646_0056633 3300046680 Bacteria 2350
581 Ga0495646_0216003 3300046680 Unclassified 1039
582 Ga0495647_0064510 3300046681 Bacteria 1452
583 Ga0495647_0149228 3300046681 Bacteria 1001
584 Ga0495658_0250475 3300046683 Bacteria 1114
585 Ga0495669_0045936 3300046684 Bacteria 1948
586 Ga0495669_0056763 3300046684 Bacteria 1765
587 Ga0495613_0095338 3300046689 Bacteria 2152
588 Ga0495613_0613575 3300046689 Bacteria 723
589 Ga0495624_0883485 3300046690 Bacteria 526
590 Ga0495670_0434409 3300046691 Bacteria 711
591 Ga0495670_0771924 3300046691 Bacteria 524
592 Ga0495671_0164094 3300046692 Bacteria 1080
593 Ga0495671_0226763 3300046692 Bacteria 904
594 Ga0495671_0613348 3300046692 Bacteria 517
595 Ga0495671_0622873 3300046692 Bacteria 513
596 Ga0495649_0012812 3300046694 Bacteria 4862
597 Ga0495649_0234754 3300046694 Bacteria 946
598 Ga0495649_0565932 3300046694 Bacteria 562
599 Ga0495589_0264624 3300046794 Bacteria 801
600 Ga0495600_0064005 3300046809 Bacteria 2404
601 Ga0495581_0253907 3300047315 Bacteria 1028
602 Ga0495581_0810433 3300047315 Bacteria 537
603 Ga0495604_0098924 3300047317 Bacteria 2148
604 Ga0495604_0664575 3300047317 Bacteria 664
605 Ga0495636_0057273 3300047318 Bacteria 1641
606 Ga0495674_0201039 3300047319 Unclassified 1653
607 Ga0495674_0969987 3300047319 Bacteria 653
608 Ga0495672_0361314 3300047320 Bacteria 672
609 Ga0495676_0057771 3300047321 Bacteria 3057
610 Ga0495676_0080205 3300047321 Bacteria 2479
611 Ga0495680_0305732 3300047322 Unclassified 1115
612 Ga0495680_0352494 3300047322 Bacteria 1024
613 Ga0495680_0462734 3300047322 Bacteria 866
614 Ga0495683_0073082 3300047323 Bacteria 1682
615 Ga0495673_0114584 3300047469 Bacteria 1074
616 Ga0495681_0398881 3300047470 Bacteria 514
617 Ga0495686_0083225 3300047472 Bacteria 1952
618 Ga0495686_0190739 3300047472 Bacteria 1182
619 Ga0495593_0352235 3300047673 Bacteria 736
620 Ga0495602_0412852 3300048088 Bacteria 960
621 Ga0495602_0528650 3300048088 Bacteria 820
622 Ga0495614_0217491 3300048089 Bacteria 868
623 Ga0495626_0090888 3300048091 Bacteria 1342
624 Ga0496100_0003516 3300048903 Bacteria 8181
625 Ga0496101_0395874 3300048904 Bacteria 1087
626 Ga0496101_1573828 3300048904 Bacteria 511
627 Ga0496102_0034702 3300048905 Bacteria 4538
628 Ga0496102_0687740 3300048905 Bacteria 946
629 Ga0496103_0270108 3300048906 Bacteria 1094
630 Ga0496104_0110050 3300048907 Bacteria 2640
631 Ga0496105_0026046 3300048908 Bacteria 4766
632 Ga0496105_0136808 3300048908 Bacteria 2018
633 Ga0496106_0242054 3300048909 Bacteria 1441
634 Ga0496106_0726011 3300048909 Bacteria 791
635 Ga0496106_1127001 3300048909 Bacteria 614
636 Ga0496107_0002052 3300048910 Bacteria 12878
637 Ga0496108_0385077 3300048911 Bacteria 1224
638 Ga0496108_0573947 3300048911 Bacteria 983
639 Ga0496109_0081672 3300048912 Bacteria 2978
640 Ga0496109_0570835 3300048912 Bacteria 1066
641 Ga0496110_1307425 3300048913 Bacteria 634
642 Ga0496111_0021303 3300048914 Bacteria 4524
643 Ga0496111_1201082 3300048914 Bacteria 537
644 Ga0496112_0118824 3300048915 Bacteria 2613
645 Ga0496112_0655210 3300048915 Bacteria 979
646 Ga0496112_1153082 3300048915 Bacteria 692
647 Ga0496112_1731025 3300048915 Bacteria 537
648 Ga0496113_0042472 3300048916 Bacteria 3360
649 Ga0496113_1425773 3300048916 Bacteria 536
650 Ga0496114_0040999 3300048917 Bacteria 3836
651 Ga0496115_0010980 3300048918 Bacteria 6781
652 Ga0496115_0046849 3300048918 Bacteria 3457
653 Ga0496118_0236045 3300048921 Bacteria 1051
654 Ga0496121_0044798 3300048924 Bacteria 3810
655 Ga0496121_0082049 3300048924 Bacteria 2550
656 Ga0496121_0119094 3300048924 Bacteria 1997
657 Ga0496121_0158250 3300048924 Bacteria 1659
658 Ga0496121_0507192 3300048924 Bacteria 764
659 Ga0496124_0124232 3300048927 Bacteria 2058
660 Ga0496124_0334023 3300048927 Bacteria 1079
661 Ga0496124_0990925 3300048927 Bacteria 502
662 Ga0496125_0173573 3300048928 Bacteria 1446
663 Ga0496125_0176361 3300048928 Bacteria 1429
664 Ga0496125_0312501 3300048928 Bacteria 957
665 Ga0496125_0533178 3300048928 Bacteria 654
666 Ga0496126_0048723 3300048929 Bacteria 3870
667 Ga0496126_0175444 3300048929 Bacteria 1823
668 Ga0496126_0197410 3300048929 Bacteria 1701
669 Ga0496126_0275698 3300048929 Bacteria 1394
670 Ga0496126_0318743 3300048929 Bacteria 1278
671 Ga0495678_184566 3300049459 Bacteria 652
672 Ga0495682_0005291 3300049460 Bacteria 5384
673 Ga0501036_0602749 3300049572 Bacteria 911
674 Ga0501039_0158956 3300049575 Bacteria 1776
675 Ga0501040_1141820 3300049576 Unclassified 565
676 Ga0501042_0158314 3300049578 Bacteria 1634
677 Ga0501067_0219605 3300049583 Bacteria 1058
678 Ga0501068_0838553 3300049584 Bacteria 604
679 Ga0501070_1295502 3300049586 Bacteria 556
680 Ga0501071_0171754 3300049587 Bacteria 1623
681 Ga0501074_0787649 3300049590 Bacteria 670
682 Ga0501235_188837 3300049669 Bacteria 553
683 nmdc:mga03683_138655_c1 3300050489 Bacteria 1092
684 nmdc:mga03683_619723_c1 3300050489 Bacteria 531
685 nmdc:mga03n38_1510_c1 3300050490 Bacteria 6717
686 nmdc:mga00v17_202351_c1 3300050491 Bacteria 1284
687 nmdc:mga00v17_367578_c1 3300050491 Bacteria 935
688 nmdc:mga00v17_693401_c1 3300050491 Bacteria 653
689 nmdc:mga0yw44_1027711_c1 3300050492 Bacteria 558
690 nmdc:mga0yw44_183758_c1 3300050492 Bacteria 1377
691 nmdc:mga0k408_145062_c1 3300050493 Bacteria 1413
692 nmdc:mga0k408_210367_c1 3300050493 Bacteria 1161
693 nmdc:mga0k408_477043_c1 3300050493 Bacteria 740
694 nmdc:mga0k408_668833_c1 3300050493 Bacteria 610
695 nmdc:mga0k408_839441_c1 3300050493 Bacteria 534
696 nmdc:mga06z11_180854_c1 3300050494 Bacteria 1216
697 nmdc:mga06z11_283960_c1 3300050494 Bacteria 981
698 nmdc:mga06z11_427832_c1 3300050494 Bacteria 798
699 nmdc:mga06z11_9242_c1 3300050494 Bacteria 4146
700 nmdc:mga04h51_114061_c1 3300050495 Bacteria 1000
701 nmdc:mga04h51_87977_c1 3300050495 Bacteria 1113
702 nmdc:mga07m45_1327_c4 3300050496 Bacteria 2702
703 nmdc:mga07m45_412518_c1 3300050496 Bacteria 784
704 nmdc:mga07m45_597371_c1 3300050496 Bacteria 637
705 nmdc:mga05p37_239403_c1 3300050507 Bacteria 2183
706 nmdc:mga0qj67_338939_c1 3300050509 Bacteria 1216
707 nmdc:mga08y16_382743_c1 3300050511 Bacteria 1442
708 nmdc:mga0n895_10129_c1 3300050512 Bacteria 8297
709 nmdc:mga0rr50_78609_c1 3300050513 Bacteria 2539
710 nmdc:mga0sz30_219186_c1 3300050516 Bacteria 846
711 nmdc:mga0sz30_59309_c1 3300050516 Bacteria 1633
712 Ga0495655_0046779 3300053083 Bacteria 1129
713 Ga0500578_0190582 3300053086 Bacteria 1259
714 Ga0500647_0136259 3300053091 Bacteria 1155
715 Ga0500583_0388232 3300053092 Bacteria 671
716 Ga0500651_0040927 3300053093 Bacteria 2920
717 Ga0500651_0116823 3300053093 Bacteria 1623
718 Ga0500641_0231654 3300053096 Bacteria 780
719 Ga0500555_059939 3300053103 Bacteria 1026
720 Ga0500558_281906 3300053106 Bacteria 528
721 Ga0500569_027872 3300053109 Bacteria 1561
722 Ga0500595_004847 3300053119 Bacteria 5952
723 Ga0500608_331117 3300053122 Bacteria 549
724 Ga0500642_0068424 3300053130 Bacteria 1611
725 Ga0500658_0056611 3300053134 Bacteria 1618
726 Ga0500658_0230499 3300053134 Bacteria 850
727 Ga0500658_0498743 3300053134 Bacteria 551
728 Ga0500559_0302836 3300053136 Bacteria 750
729 Ga0500577_0133880 3300053142 Bacteria 1041
730 Ga0500586_004396 3300053145 Bacteria 3443
731 Ga0500590_153334 3300053148 Bacteria 1036
732 Ga0500604_0130673 3300053151 Bacteria 844
733 Ga0500604_0143688 3300053151 Bacteria 808
734 Ga0500622_0315320 3300053156 Bacteria 661
735 Ga0500627_0411914 3300053158 Bacteria 574
736 Ga0500633_0379459 3300053160 Bacteria 512
737 Ga0500638_311554 3300053162 Bacteria 602
738 Ga0500636_0526123 3300053177 Bacteria 517
739 Ga0500637_0501835 3300053178 Bacteria 601
740 Ga0500645_205433 3300053730 Bacteria 530
741 Ga0500609_021098 3300053731 Bacteria 889
742 Ga0500656_062964 3300053732 Bacteria 559
743 Ga0466962_0284218 3300061719 Bacteria 817
744 Ga0530510_0992105 3300061734 Bacteria 643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10046694 Ga0105248_100466944 85
2 3300009545 Ga0105237_12787494 Ga0105237_127874942 85
3 3300013296 Ga0157374_11728134 Ga0157374_117281342 85
4 3300013306 Ga0163162_13005952 Ga0163162_130059522 85
5 3300013308 Ga0157375_11374626 Ga0157375_113746262 85
6 3300014325 Ga0163163_10017597 Ga0163163_100175978 85
7 3300014968 Ga0157379_10041641 Ga0157379_100416414 85
8 3300044656 Ga0466969_0451963 Ga0466969_0451963_199_462 86
9 3300044719 Ga0466971_0094190 Ga0466971_0094190_885_1148 86
10 3300045836 Ga0466958_0756378 Ga0466958_0756378_191_454 86
11 3300061719 Ga0466962_0284218 Ga0466962_0284218_283_546 86
12 3300005458 Ga0070681_10075720 Ga0070681_100757201 88
13 3300009545 Ga0105237_10303264 Ga0105237_103032642 88
14 3300031507 Ga0307509_10267924 Ga0307509_102679242 88
15 3300035172 Ga0373955_0808675 Ga0373955_0808675_93_362 88
16 3300035724 Ga0373933_0510864 Ga0373933_0510864_454_723 88
17 3300035725 Ga0373947_0976646 Ga0373947_0976646_87_356 88
18 3300046462 Ga0495651_0087411 Ga0495651_0087411_1213_1482 88
19 3300046463 Ga0495653_0377238 Ga0495653_0377238_475_744 88
20 3300046477 Ga0495664_0047566 Ga0495664_0047566_14_283 88
21 3300046477 Ga0495664_0276709 Ga0495664_0276709_710_979 88
22 3300046477 Ga0495664_0504460 Ga0495664_0504460_165_434 88
23 3300046511 Ga0495608_0631357 Ga0495608_0631357_70_339 88
24 3300046516 Ga0495628_0442221 Ga0495628_0442221_108_377 88
25 3300046526 Ga0495666_0173837 Ga0495666_0173837_625_900 88
26 3300046529 Ga0495652_0130491 Ga0495652_0130491_1289_1558 88
27 3300046535 Ga0495586_0365121 Ga0495586_0365121_291_560 88
28 3300046536 Ga0495587_0262029 Ga0495587_0262029_343_612 88
29 3300046536 Ga0495587_0513338 Ga0495587_0513338_78_347 88
30 3300046675 Ga0495657_0166924 Ga0495657_0166924_935_1204 88
31 3300046679 Ga0495623_0253437 Ga0495623_0253437_580_849 88
32 3300046680 Ga0495646_0056633 Ga0495646_0056633_1763_2032 88
33 3300046680 Ga0495646_0216003 Ga0495646_0216003_184_453 88
34 3300046689 Ga0495613_0613575 Ga0495613_0613575_179_460 88
35 3300047317 Ga0495604_0098924 Ga0495604_0098924_53_334 88
36 3300047319 Ga0495674_0201039 Ga0495674_0201039_569_838 88
37 3300047322 Ga0495680_0305732 Ga0495680_0305732_266_535 88
38 3300047322 Ga0495680_0352494 Ga0495680_0352494_520_789 88
39 3300048088 Ga0495602_0412852 Ga0495602_0412852_193_462 88
40 3300048088 Ga0495602_0528650 Ga0495602_0528650_500_769 88
41 3300049576 Ga0501040_1141820 Ga0501040_1141820_13_294 88
42 3300053134 Ga0500658_0498743 Ga0500658_0498743_133_408 88
43 3300053732 Ga0500656_062964 Ga0500656_062964_73_348 88
44 3300013104 Ga0157370_11874399 Ga0157370_118743992 91
45 3300049572 Ga0501036_0602749 Ga0501036_0602749_457_777 98
46 3300049575 Ga0501039_0158956 Ga0501039_0158956_661_981 98
47 3300044658 Ga0466972_0000177 Ga0466972_0000177_8152_8514 101
48 3300044683 Ga0466965_0085702 Ga0466965_0085702_550_912 101
49 3300005530 Ga0070679_101345524 Ga0070679_1013455241 102
50 3300014325 Ga0163163_11110114 Ga0163163_111101142 102
51 3300025921 Ga0207652_11201518 Ga0207652_112015181 102
52 iso_pu_bacteria 2513237104 2513716809 102
53 iso_pu_bacteria 2513237161 2514009976 102
54 iso_pu_bacteria 2617270735 2617354163 102
55 iso_pu_bacteria 2824671348 2824679441 102
56 iso_pu_bacteria 2824687955 2824696050 102
57 iso_pu_bacteria 2841966195 2841970814 102
58 iso_pu_bacteria 2841974524 2841977927 102
59 iso_pu_bacteria 2935675223 2935684084 102
60 iso_pu_bacteria 3005594810 3005601697 102
61 iso_pu_bacteria 3005718088 3005724378 102
62 3300005327 Ga0070658_10630521 Ga0070658_106305212 103
63 3300005329 Ga0070683_100325152 Ga0070683_1003251522 103
64 3300005435 Ga0070714_102389867 Ga0070714_1023898671 103
65 3300005455 Ga0070663_100029162 Ga0070663_1000291624 103
66 3300005539 Ga0068853_102186166 Ga0068853_1021861662 103
67 3300005842 Ga0068858_100124003 Ga0068858_1001240032 103
68 3300005843 Ga0068860_100900227 Ga0068860_1009002272 103
69 3300006175 Ga0070712_101856912 Ga0070712_1018569121 103
70 3300006914 Ga0075436_100265403 Ga0075436_1002654031 103
71 3300013105 Ga0157369_10705902 Ga0157369_107059022 103
72 3300025914 Ga0207671_11418492 Ga0207671_114184921 103
73 3300025920 Ga0207649_10360425 Ga0207649_103604251 103
74 3300025926 Ga0207659_11762149 Ga0207659_117621491 103
75 3300025929 Ga0207664_10500595 Ga0207664_105005952 103
76 3300025941 Ga0207711_10047611 Ga0207711_100476115 103
77 3300025944 Ga0207661_10512137 Ga0207661_105121372 103
78 3300026035 Ga0207703_10190261 Ga0207703_101902613 103
79 3300026067 Ga0207678_10018506 Ga0207678_100185064 103
80 3300026116 Ga0207674_11112171 Ga0207674_111121712 103
81 3300028381 Ga0268264_11661847 Ga0268264_116618471 103
82 3300031250 Ga0265331_10156540 Ga0265331_101565403 103
83 3300035117 Ga0373953_0305569 Ga0373953_0305569_366_677 103
84 3300037068 Ga0373925_0043457 Ga0373925_0043457_784_1095 103
85 3300046473 Ga0495582_0042207 Ga0495582_0042207_772_1083 103
86 3300046477 Ga0495664_0030300 Ga0495664_0030300_14_325 103
87 3300046511 Ga0495608_0279694 Ga0495608_0279694_641_952 103
88 3300046517 Ga0495630_0059712 Ga0495630_0059712_2526_2837 103
89 3300046543 Ga0495645_0123813 Ga0495645_0123813_861_1172 103
90 3300046681 Ga0495647_0064510 Ga0495647_0064510_692_1003 103
91 3300046689 Ga0495613_0095338 Ga0495613_0095338_26_337 103
92 3300005539 Ga0068853_100681028 Ga0068853_1006810282 104
93 3300005842 Ga0068858_101250578 Ga0068858_1012505782 104
94 3300006177 Ga0075362_10243844 Ga0075362_102438441 104
95 3300006844 Ga0075428_101806788 Ga0075428_1018067881 104
96 3300006846 Ga0075430_100178283 Ga0075430_1001782832 104
97 3300007265 Ga0099794_10035033 Ga0099794_100350332 104
98 3300009093 Ga0105240_10368125 Ga0105240_103681253 104
99 3300009098 Ga0105245_10012692 Ga0105245_100126927 104
100 3300009177 Ga0105248_10461340 Ga0105248_104613403 104
101 3300009177 Ga0105248_11066290 Ga0105248_110662902 104
102 3300009551 Ga0105238_10078299 Ga0105238_100782993 104
103 3300010159 Ga0099796_10062676 Ga0099796_100626761 104
104 3300010375 Ga0105239_10097211 Ga0105239_100972113 104
105 3300010375 Ga0105239_12035665 Ga0105239_120356652 104
106 3300013105 Ga0157369_10389029 Ga0157369_103890293 104
107 3300013296 Ga0157374_10113473 Ga0157374_101134732 104
108 3300013297 Ga0157378_10255636 Ga0157378_102556361 104
109 3300013306 Ga0163162_10047620 Ga0163162_100476204 104
110 3300013306 Ga0163162_11038665 Ga0163162_110386652 104
111 3300013306 Ga0163162_12915089 Ga0163162_129150892 104
112 3300013308 Ga0157375_10013598 Ga0157375_100135988 104
113 3300014325 Ga0163163_11822697 Ga0163163_118226972 104
114 3300014497 Ga0182008_10153885 Ga0182008_101538852 104
115 3300014745 Ga0157377_10050988 Ga0157377_100509882 104
116 3300014969 Ga0157376_10215020 Ga0157376_102150203 104
117 3300025924 Ga0207694_10252792 Ga0207694_102527923 104
118 3300025941 Ga0207711_10835466 Ga0207711_108354661 104
119 3300031249 Ga0265339_10101052 Ga0265339_101010522 104
120 3300032005 Ga0307411_10614805 Ga0307411_106148052 104
121 3300035086 Ga0373934_0194745 Ga0373934_0194745_119_457 104
122 3300035117 Ga0373953_0173447 Ga0373953_0173447_325_663 104
123 3300035170 Ga0373943_0019829 Ga0373943_0019829_1140_1463 104
124 3300035695 Ga0373927_0337047 Ga0373927_0337047_316_639 104
125 3300035724 Ga0373933_0305874 Ga0373933_0305874_181_519 104
126 3300035725 Ga0373947_0015251 Ga0373947_0015251_3809_4132 104
127 3300037068 Ga0373925_0032743 Ga0373925_0032743_1056_1376 104
128 3300037068 Ga0373925_0046639 Ga0373925_0046639_2602_2925 104
129 3300041456 Ga0451795_1327697 Ga0451795_1327697_62_382 104
130 3300041512 Ga0451853_2647951 Ga0451853_2647951_500_820 104
131 3300041512 Ga0451853_2941052 Ga0451853_2941052_11_331 104
132 3300046455 Ga0495603_0011257 Ga0495603_0011257_4528_4851 104
133 3300046455 Ga0495603_0240898 Ga0495603_0240898_300_620 104
134 3300046459 Ga0495629_0233421 Ga0495629_0233421_654_974 104
135 3300046474 Ga0495605_0143211 Ga0495605_0143211_86_406 104
136 3300046475 Ga0495639_0402648 Ga0495639_0402648_174_497 104
137 3300046475 Ga0495639_0657239 Ga0495639_0657239_19_342 104
138 3300046507 Ga0495606_0001686 Ga0495606_0001686_24305_24631 104
139 3300046538 Ga0495609_0159166 Ga0495609_0159166_452_772 104
140 3300046674 Ga0495588_0751840 Ga0495588_0751840_69_389 104
141 3300046681 Ga0495647_0149228 Ga0495647_0149228_367_690 104
142 3300047315 Ga0495581_0253907 Ga0495581_0253907_351_671 104
143 3300047319 Ga0495674_0969987 Ga0495674_0969987_252_569 104
144 3300047321 Ga0495676_0057771 Ga0495676_0057771_765_1088 104
145 3300048903 Ga0496100_0003516 Ga0496100_0003516_922_1242 104
146 3300048904 Ga0496101_0395874 Ga0496101_0395874_333_653 104
147 3300048905 Ga0496102_0034702 Ga0496102_0034702_759_1079 104
148 3300048906 Ga0496103_0270108 Ga0496103_0270108_284_604 104
149 3300048907 Ga0496104_0110050 Ga0496104_0110050_594_914 104
150 3300048908 Ga0496105_0026046 Ga0496105_0026046_3524_3844 104
151 3300048909 Ga0496106_0242054 Ga0496106_0242054_1082_1402 104
152 3300048909 Ga0496106_0726011 Ga0496106_0726011_308_625 104
153 3300048910 Ga0496107_0002052 Ga0496107_0002052_5571_5891 104
154 3300048911 Ga0496108_0385077 Ga0496108_0385077_78_398 104
155 3300048912 Ga0496109_0081672 Ga0496109_0081672_1956_2276 104
156 3300048913 Ga0496110_1307425 Ga0496110_1307425_221_538 104
157 3300048914 Ga0496111_0021303 Ga0496111_0021303_3027_3347 104
158 3300048914 Ga0496111_1201082 Ga0496111_1201082_90_416 104
159 3300048915 Ga0496112_0118824 Ga0496112_0118824_1948_2268 104
160 3300048915 Ga0496112_0655210 Ga0496112_0655210_67_393 104
161 3300048915 Ga0496112_1153082 Ga0496112_1153082_70_390 104
162 3300048916 Ga0496113_0042472 Ga0496113_0042472_2906_3226 104
163 3300048917 Ga0496114_0040999 Ga0496114_0040999_1747_2067 104
164 3300048918 Ga0496115_0010980 Ga0496115_0010980_285_605 104
165 3300048927 Ga0496124_0334023 Ga0496124_0334023_654_980 104
166 3300048928 Ga0496125_0176361 Ga0496125_0176361_53_379 104
167 3300048929 Ga0496126_0197410 Ga0496126_0197410_1311_1628 104
168 3300050509 nmdc:mga0qj67_338939_c1 nmdc:mga0qj67_338939_c1_489_842 104
169 3300053091 Ga0500647_0136259 Ga0500647_0136259_678_992 104
170 iso_pu_bacteria 2513237094 2513638646 104
171 iso_pu_bacteria 2513237102 2513702492 104
172 iso_pu_bacteria 2513237139 2513874258 104
173 iso_pu_bacteria 2617270741 2617374661 104
174 iso_pu_bacteria 2802429603 2805916024 104
175 iso_pu_bacteria 2824617872 2824626020 104
176 iso_pu_bacteria 2824626560 2824634321 104
177 iso_pu_bacteria 2824635225 2824642682 104
178 iso_pu_bacteria 2824644064 2824650609 104
179 iso_pu_bacteria 2824696289 2824699012 104
180 iso_pu_bacteria 2824714736 2824722250 104
181 iso_pu_bacteria 2824723954 2824730698 104
182 iso_pu_bacteria 2824732956 2824738951 104
183 iso_pu_bacteria 2824746037 2824753286 104
184 iso_pu_bacteria 2842038055 2842041772 104
185 iso_pu_bacteria 2842045827 2842049814 104
186 iso_pu_bacteria 2847939898 2847943303 104
187 iso_pu_bacteria 2874612657 2874620294 104
188 iso_pu_bacteria 2879099564 2879100004 104
189 iso_pu_bacteria 2881665667 2881669325 104
190 iso_pu_bacteria 2904690495 2904692671 104
191 iso_pu_bacteria 2908756301 2908757690 104
192 iso_pu_bacteria 2908775508 2908777142 104
193 iso_pu_bacteria 2922368715 2922376626 104
194 iso_pu_bacteria 2932784394 2932789686 104
195 iso_pu_bacteria 2932809354 2932818195 104
196 iso_pu_bacteria 2932818245 2932828033 104
197 iso_pu_bacteria 2932828146 2932835611 104
198 iso_pu_bacteria 2935616580 2935624615 104
199 iso_pu_bacteria 2935638405 2935647158 104
200 iso_pu_bacteria 2935665750 2935674379 104
201 iso_pu_bacteria 2935694250 2935697607 104
202 iso_pu_bacteria 2935703347 2935711368 104
203 iso_pu_bacteria 2935760218 2935764187 104
204 iso_pu_bacteria 2935801545 2935809846 104
205 iso_pu_bacteria 2935810662 2935819773 104
206 iso_pu_bacteria 2935827899 2935836582 104
207 iso_pu_bacteria 2935837841 2935844696 104
208 iso_pu_bacteria 2935855204 2935863175 104
209 iso_pu_bacteria 2935864058 2935868644 104
210 iso_pu_bacteria 2935873716 2935879418 104
211 iso_pu_bacteria 2935992306 2936000212 104
212 iso_pu_bacteria 2936002035 2936010254 104
213 iso_pu_bacteria 2936037263 2936046483 104
214 iso_pu_bacteria 2941538514 2941547534 104
215 iso_pu_bacteria 3005483717 3005485996 104
216 iso_pu_bacteria 3005506211 3005506662 104
217 iso_pu_bacteria 3005710791 3005717434 104
218 iso_pu_bacteria 8016511872 8016519208 104
219 iso_pu_bacteria 8017057580 8017066298 104
220 iso_pu_bacteria 8019576017 8019578320 104
221 iso_pu_bacteria 8019586578 8019596360 104
222 iso_pu_bacteria 8019597564 8019605341 104
223 iso_pu_bacteria 8019608314 8019613200 104
224 3300005336 Ga0070680_100048802 Ga0070680_1000488023 105
225 3300005340 Ga0070689_101173391 Ga0070689_1011733912 105
226 3300005458 Ga0070681_10575932 Ga0070681_105759322 105
227 3300005530 Ga0070679_100011213 Ga0070679_1000112135 105
228 3300005530 Ga0070679_100028212 Ga0070679_1000282122 105
229 3300005618 Ga0068864_100643461 Ga0068864_1006434612 105
230 3300005718 Ga0068866_10381933 Ga0068866_103819332 105
231 3300005841 Ga0068863_100182097 Ga0068863_1001820972 105
232 3300005841 Ga0068863_100598853 Ga0068863_1005988532 105
233 3300025912 Ga0207707_10249254 Ga0207707_102492542 105
234 3300025912 Ga0207707_10679020 Ga0207707_106790201 105
235 3300025917 Ga0207660_10017344 Ga0207660_100173443 105
236 3300025917 Ga0207660_10134958 Ga0207660_101349582 105
237 3300025921 Ga0207652_10049994 Ga0207652_100499943 105
238 3300025921 Ga0207652_10101478 Ga0207652_101014782 105
239 3300026095 Ga0207676_11601381 Ga0207676_116013811 105
240 3300028381 Ga0268264_10181165 Ga0268264_101811652 105
241 3300028573 Ga0265334_10000205 Ga0265334_100002054 105
242 3300028573 Ga0265334_10029025 Ga0265334_100290252 105
243 3300031239 Ga0265328_10311026 Ga0265328_103110261 105
244 3300031250 Ga0265331_10097325 Ga0265331_100973252 105
245 3300031507 Ga0307509_10498154 Ga0307509_104981542 105
246 3300031712 Ga0265342_10093995 Ga0265342_100939951 105
247 3300046663 Ga0495635_0400549 Ga0495635_0400549_499_837 105
248 3300049669 Ga0501235_188837 Ga0501235_188837_41_382 105
249 3300005366 Ga0070659_100654137 Ga0070659_1006541371 106
250 3300005458 Ga0070681_10325818 Ga0070681_103258183 106
251 3300005547 Ga0070693_100307986 Ga0070693_1003079863 106
252 3300005614 Ga0068856_100083848 Ga0068856_1000838483 106
253 3300025912 Ga0207707_10450243 Ga0207707_104502433 106
254 3300025924 Ga0207694_11355786 Ga0207694_113557862 106
255 3300025932 Ga0207690_10838561 Ga0207690_108385612 106
256 3300025942 Ga0207689_11556656 Ga0207689_115566562 106
257 3300026078 Ga0207702_10097706 Ga0207702_100977065 106
258 3300028381 Ga0268264_11655039 Ga0268264_116550392 106
259 3300032005 Ga0307411_11062251 Ga0307411_110622512 106
260 3300048905 Ga0496102_0687740 Ga0496102_0687740_531_860 106
261 3300053093 Ga0500651_0040927 Ga0500651_0040927_220_540 106
262 3300053122 Ga0500608_331117 Ga0500608_331117_196_516 106
263 3300053136 Ga0500559_0302836 Ga0500559_0302836_62_382 106
264 3300053145 Ga0500586_004396 Ga0500586_004396_1769_2098 106
265 3300053148 Ga0500590_153334 Ga0500590_153334_112_432 106
266 iso_pu_bacteria 2517093001 2517104596 106
267 iso_pu_bacteria 2824679649 2824686277 106
268 iso_pu_bacteria 2879083081 2879085742 106
269 iso_pu_bacteria 2906643746 2906647275 106
270 iso_pu_bacteria 2922393267 2922398576 106
271 iso_pu_bacteria 8056967851 8056971841 106
272 3300003659 JGI25404J52841_10018969 JGI25404J52841_100189693 107
273 3300003659 JGI25404J52841_10021526 JGI25404J52841_100215262 107
274 3300003659 JGI25404J52841_10087605 JGI25404J52841_100876051 107
275 3300005548 Ga0070665_100748838 Ga0070665_1007488382 107
276 3300005937 Ga0081455_10176688 Ga0081455_101766882 107
277 3300005983 Ga0081540_1049888 Ga0081540_10498882 107
278 3300005983 Ga0081540_1100218 Ga0081540_11002181 107
279 3300006178 Ga0075367_10540681 Ga0075367_105406811 107
280 3300028379 Ga0268266_12022772 Ga0268266_120227721 107
281 3300050494 nmdc:mga06z11_427832_c1 nmdc:mga06z11_427832_c1_86_409 107
282 iso_pu_bacteria 2791355199 2793078559 107
283 iso_pu_bacteria 2879110137 2879113543 107
284 iso_pu_bacteria 2889033259 2889034144 107
285 iso_pu_bacteria 2922386360 2922391517 107
286 iso_pu_bacteria 8006984368 8006986194 107
287 iso_pu_bacteria 8056673599 8056678872 107
288 3300005355 Ga0070671_101989826 Ga0070671_1019898261 108
289 3300005564 Ga0070664_100125780 Ga0070664_1001257803 108
290 3300005577 Ga0068857_101781706 Ga0068857_1017817062 108
291 3300006177 Ga0075362_10089972 Ga0075362_100899722 108
292 3300006186 Ga0075369_10019469 Ga0075369_100194691 108
293 3300006186 Ga0075369_10026495 Ga0075369_100264953 108
294 3300006195 Ga0075366_10024339 Ga0075366_100243393 108
295 3300006353 Ga0075370_10028156 Ga0075370_100281562 108
296 3300006871 Ga0075434_100011477 Ga0075434_1000114776 108
297 3300007076 Ga0075435_100091989 Ga0075435_1000919892 108
298 3300013297 Ga0157378_10018404 Ga0157378_100184045 108
299 3300013308 Ga0157375_11081242 Ga0157375_110812422 108
300 3300021441 Ga0213871_10014349 Ga0213871_100143493 108
301 3300026067 Ga0207678_10420561 Ga0207678_104205612 108
302 3300044765 Ga0466970_0075288 Ga0466970_0075288_998_1324 108
303 3300046660 Ga0495625_0262166 Ga0495625_0262166_652_978 108
304 3300046692 Ga0495671_0622873 Ga0495671_0622873_123_449 108
305 3300046694 Ga0495649_0234754 Ga0495649_0234754_576_902 108
306 3300048908 Ga0496105_0136808 Ga0496105_0136808_1376_1702 108
307 3300048909 Ga0496106_1127001 Ga0496106_1127001_21_347 108
308 3300048915 Ga0496112_1731025 Ga0496112_1731025_75_401 108
309 3300048921 Ga0496118_0236045 Ga0496118_0236045_257_583 108
310 3300048929 Ga0496126_0318743 Ga0496126_0318743_915_1241 108
311 3300049590 Ga0501074_0787649 Ga0501074_0787649_16_354 108
312 3300050489 nmdc:mga03683_138655_c1 nmdc:mga03683_138655_c1_684_1010 108
313 3300050491 nmdc:mga00v17_367578_c1 nmdc:mga00v17_367578_c1_111_437 108
314 3300050493 nmdc:mga0k408_145062_c1 nmdc:mga0k408_145062_c1_1055_1381 108
315 3300050496 nmdc:mga07m45_412518_c1 nmdc:mga07m45_412518_c1_36_362 108
316 3300050512 nmdc:mga0n895_10129_c1 nmdc:mga0n895_10129_c1_1035_1370 108
317 3300050513 nmdc:mga0rr50_78609_c1 nmdc:mga0rr50_78609_c1_2006_2341 108
318 3300050516 nmdc:mga0sz30_59309_c1 nmdc:mga0sz30_59309_c1_676_1002 108
319 3300025254 Ga0209148_1015258 Ga0209148_10152582 109
320 3300025924 Ga0207694_10339564 Ga0207694_103395642 109
321 3300026023 Ga0207677_10443411 Ga0207677_104434113 109
322 3300005337 Ga0070682_100448157 Ga0070682_1004481572 110
323 3300005344 Ga0070661_100796474 Ga0070661_1007964742 110
324 3300005347 Ga0070668_100725306 Ga0070668_1007253062 110
325 3300005455 Ga0070663_100422844 Ga0070663_1004228441 110
326 3300005530 Ga0070679_100855266 Ga0070679_1008552662 110
327 3300005539 Ga0068853_100033499 Ga0068853_1000334996 110
328 3300005539 Ga0068853_101055623 Ga0068853_1010556232 110
329 3300005843 Ga0068860_100506624 Ga0068860_1005066242 110
330 3300006038 Ga0075365_10116517 Ga0075365_101165172 110
331 3300006042 Ga0075368_10071172 Ga0075368_100711722 110
332 3300006048 Ga0075363_100069487 Ga0075363_1000694873 110
333 3300006048 Ga0075363_100221741 Ga0075363_1002217411 110
334 3300006177 Ga0075362_10175521 Ga0075362_101755212 110
335 3300006178 Ga0075367_10045872 Ga0075367_100458723 110
336 3300006178 Ga0075367_10066484 Ga0075367_100664841 110
337 3300006195 Ga0075366_10387093 Ga0075366_103870932 110
338 3300006353 Ga0075370_10337092 Ga0075370_103370922 110
339 3300006944 Ga0099823_1010603 Ga0099823_10106039 110
340 3300025972 Ga0207668_10648666 Ga0207668_106486662 110
341 3300026067 Ga0207678_10807307 Ga0207678_108073071 110
342 3300027296 Ga0209389_1000016 Ga0209389_100001667 110
343 3300027361 Ga0209489_100063 Ga0209489_10006325 110
344 3300027363 Ga0209700_100012 Ga0209700_10001268 110
345 3300027866 Ga0209813_10015793 Ga0209813_100157932 110
346 3300027866 Ga0209813_10074050 Ga0209813_100740502 110
347 3300028379 Ga0268266_11533360 Ga0268266_115333602 110
348 3300031344 Ga0265316_10102766 Ga0265316_101027661 110
349 3300031824 Ga0307413_10527820 Ga0307413_105278202 110
350 3300031901 Ga0307406_10432905 Ga0307406_104329052 110
351 3300031901 Ga0307406_10684557 Ga0307406_106845572 110
352 3300031995 Ga0307409_101467526 Ga0307409_1014675261 110
353 3300032002 Ga0307416_100713180 Ga0307416_1007131802 110
354 3300032005 Ga0307411_11109766 Ga0307411_111097661 110
355 3300032126 Ga0307415_100839027 Ga0307415_1008390272 110
356 3300041458 Ga0451798_0676178 Ga0451798_0676178_28_360 110
357 3300046474 Ga0495605_0024252 Ga0495605_0024252_1370_1708 110
358 3300046501 Ga0495607_0361142 Ga0495607_0361142_57_395 110
359 3300046507 Ga0495606_0012396 Ga0495606_0012396_2599_2937 110
360 3300046515 Ga0495620_0055003 Ga0495620_0055003_1263_1601 110
361 3300046522 Ga0495643_0028158 Ga0495643_0028158_365_703 110
362 3300046524 Ga0495648_0017419 Ga0495648_0017419_463_801 110
363 3300046538 Ga0495609_0124057 Ga0495609_0124057_682_1020 110
364 3300046557 Ga0495622_0123645 Ga0495622_0123645_647_985 110
365 3300046616 Ga0495668_0215498 Ga0495668_0215498_609_947 110
366 3300046648 Ga0495611_0198249 Ga0495611_0198249_427_765 110
367 3300046660 Ga0495625_0025297 Ga0495625_0025297_3577_3915 110
368 3300046679 Ga0495623_0563545 Ga0495623_0563545_50_394 110
369 3300046692 Ga0495671_0164094 Ga0495671_0164094_122_460 110
370 3300046694 Ga0495649_0012812 Ga0495649_0012812_2930_3268 110
371 3300047323 Ga0495683_0073082 Ga0495683_0073082_754_1092 110
372 3300047472 Ga0495686_0083225 Ga0495686_0083225_1283_1621 110
373 3300049460 Ga0495682_0005291 Ga0495682_0005291_4436_4774 110
374 3300050492 nmdc:mga0yw44_183758_c1 nmdc:mga0yw44_183758_c1_624_980 110
375 3300050495 nmdc:mga04h51_87977_c1 nmdc:mga04h51_87977_c1_89_445 110
376 3300053083 Ga0495655_0046779 Ga0495655_0046779_446_784 110
377 3300053086 Ga0500578_0190582 Ga0500578_0190582_336_674 110
378 3300003215 JGI25153J46596_10009457 JGI25153J46596_100094572 111
379 3300003322 rootL2_10122270 rootL2_101222702 111
380 3300003659 JGI25404J52841_10146277 JGI25404J52841_101462771 111
381 3300005327 Ga0070658_10301967 Ga0070658_103019672 111
382 3300005327 Ga0070658_10454369 Ga0070658_104543692 111
383 3300005328 Ga0070676_11624409 Ga0070676_116244091 111
384 3300005333 Ga0070677_10482048 Ga0070677_104820481 111
385 3300005334 Ga0068869_100121598 Ga0068869_1001215982 111
386 3300005334 Ga0068869_100267954 Ga0068869_1002679541 111
387 3300005334 Ga0068869_101279367 Ga0068869_1012793672 111
388 3300005335 Ga0070666_10215010 Ga0070666_102150102 111
389 3300005335 Ga0070666_10369250 Ga0070666_103692502 111
390 3300005335 Ga0070666_10696793 Ga0070666_106967932 111
391 3300005336 Ga0070680_100017554 Ga0070680_1000175544 111
392 3300005337 Ga0070682_100072743 Ga0070682_1000727433 111
393 3300005338 Ga0068868_100014062 Ga0068868_1000140623 111
394 3300005338 Ga0068868_100114030 Ga0068868_1001140303 111
395 3300005343 Ga0070687_100261716 Ga0070687_1002617163 111
396 3300005344 Ga0070661_100175704 Ga0070661_1001757042 111
397 3300005347 Ga0070668_100607299 Ga0070668_1006072992 111
398 3300005347 Ga0070668_101161077 Ga0070668_1011610772 111
399 3300005347 Ga0070668_101189032 Ga0070668_1011890322 111
400 3300005347 Ga0070668_101947008 Ga0070668_1019470081 111
401 3300005354 Ga0070675_101073300 Ga0070675_1010733001 111
402 3300005355 Ga0070671_100080455 Ga0070671_1000804553 111
403 3300005355 Ga0070671_101560312 Ga0070671_1015603121 111
404 3300005364 Ga0070673_100333248 Ga0070673_1003332482 111
405 3300005365 Ga0070688_100125494 Ga0070688_1001254942 111
406 3300005435 Ga0070714_100311829 Ga0070714_1003118292 111
407 3300005436 Ga0070713_100019375 Ga0070713_1000193756 111
408 3300005438 Ga0070701_10363293 Ga0070701_103632932 111
409 3300005441 Ga0070700_100211194 Ga0070700_1002111943 111
410 3300005445 Ga0070708_100090073 Ga0070708_1000900732 111
411 3300005455 Ga0070663_100156007 Ga0070663_1001560073 111
412 3300005455 Ga0070663_100244642 Ga0070663_1002446423 111
413 3300005456 Ga0070678_100032876 Ga0070678_1000328764 111
414 3300005456 Ga0070678_100040360 Ga0070678_1000403604 111
415 3300005456 Ga0070678_100136230 Ga0070678_1001362303 111
416 3300005457 Ga0070662_100258360 Ga0070662_1002583602 111
417 3300005457 Ga0070662_100860001 Ga0070662_1008600012 111
418 3300005458 Ga0070681_10786286 Ga0070681_107862862 111
419 3300005459 Ga0068867_100205532 Ga0068867_1002055322 111
420 3300005466 Ga0070685_10813513 Ga0070685_108135131 111
421 3300005467 Ga0070706_100578698 Ga0070706_1005786982 111
422 3300005467 Ga0070706_101514664 Ga0070706_1015146641 111
423 3300005471 Ga0070698_102135573 Ga0070698_1021355731 111
424 3300005518 Ga0070699_100943203 Ga0070699_1009432031 111
425 3300005530 Ga0070679_100020644 Ga0070679_1000206444 111
426 3300005536 Ga0070697_100851089 Ga0070697_1008510892 111
427 3300005539 Ga0068853_100097575 Ga0068853_1000975753 111
428 3300005543 Ga0070672_100721325 Ga0070672_1007213252 111
429 3300005547 Ga0070693_100228880 Ga0070693_1002288802 111
430 3300005548 Ga0070665_100038149 Ga0070665_1000381493 111
431 3300005548 Ga0070665_100105625 Ga0070665_1001056252 111
432 3300005548 Ga0070665_100241629 Ga0070665_1002416292 111
433 3300005548 Ga0070665_100280074 Ga0070665_1002800742 111
434 3300005563 Ga0068855_100023888 Ga0068855_1000238886 111
435 3300005563 Ga0068855_101051673 Ga0068855_1010516731 111
436 3300005578 Ga0068854_100640089 Ga0068854_1006400892 111
437 3300005614 Ga0068856_100000522 Ga0068856_10000052240 111
438 3300005614 Ga0068856_100298653 Ga0068856_1002986533 111
439 3300005614 Ga0068856_100519715 Ga0068856_1005197152 111
440 3300005614 Ga0068856_100578821 Ga0068856_1005788212 111
441 3300005616 Ga0068852_100105731 Ga0068852_1001057313 111
442 3300005616 Ga0068852_101031227 Ga0068852_1010312272 111
443 3300005617 Ga0068859_100196295 Ga0068859_1001962953 111
444 3300005617 Ga0068859_100381704 Ga0068859_1003817043 111
445 3300005719 Ga0068861_100135065 Ga0068861_1001350652 111
446 3300005719 Ga0068861_100796606 Ga0068861_1007966062 111
447 3300005719 Ga0068861_102443843 Ga0068861_1024438431 111
448 3300005834 Ga0068851_10244487 Ga0068851_102444872 111
449 3300005840 Ga0068870_10076743 Ga0068870_100767433 111
450 3300005840 Ga0068870_10177545 Ga0068870_101775452 111
451 3300005841 Ga0068863_101458158 Ga0068863_1014581582 111
452 3300005841 Ga0068863_102593529 Ga0068863_1025935292 111
453 3300005842 Ga0068858_100341288 Ga0068858_1003412882 111
454 3300005843 Ga0068860_101047176 Ga0068860_1010471762 111
455 3300005843 Ga0068860_101656962 Ga0068860_1016569622 111
456 3300005844 Ga0068862_100107769 Ga0068862_1001077694 111
457 3300005844 Ga0068862_100216805 Ga0068862_1002168052 111
458 3300005844 Ga0068862_100805409 Ga0068862_1008054091 111
459 3300005844 Ga0068862_102096388 Ga0068862_1020963882 111
460 3300005937 Ga0081455_10026185 Ga0081455_100261855 111
461 3300005981 Ga0081538_10099656 Ga0081538_100996562 111
462 3300005983 Ga0081540_1011981 Ga0081540_10119815 111
463 3300005983 Ga0081540_1031373 Ga0081540_10313733 111
464 3300005985 Ga0081539_10017936 Ga0081539_100179366 111
465 3300006028 Ga0070717_10000325 Ga0070717_1000032522 111
466 3300006038 Ga0075365_10129506 Ga0075365_101295061 111
467 3300006038 Ga0075365_10424752 Ga0075365_104247522 111
468 3300006038 Ga0075365_10595468 Ga0075365_105954682 111
469 3300006038 Ga0075365_10711359 Ga0075365_107113592 111
470 3300006038 Ga0075365_11325633 Ga0075365_113256331 111
471 3300006042 Ga0075368_10153966 Ga0075368_101539662 111
472 3300006048 Ga0075363_100030546 Ga0075363_1000305463 111
473 3300006048 Ga0075363_100643338 Ga0075363_1006433382 111
474 3300006051 Ga0075364_10974869 Ga0075364_109748692 111
475 3300006173 Ga0070716_100053569 Ga0070716_1000535692 111
476 3300006173 Ga0070716_100084265 Ga0070716_1000842652 111
477 3300006175 Ga0070712_100797821 Ga0070712_1007978212 111
478 3300006175 Ga0070712_100902539 Ga0070712_1009025392 111
479 3300006177 Ga0075362_10068209 Ga0075362_100682093 111
480 3300006177 Ga0075362_10144625 Ga0075362_101446252 111
481 3300006177 Ga0075362_10436629 Ga0075362_104366291 111
482 3300006178 Ga0075367_10409112 Ga0075367_104091121 111
483 3300006178 Ga0075367_10410528 Ga0075367_104105281 111
484 3300006195 Ga0075366_10157117 Ga0075366_101571171 111
485 3300006195 Ga0075366_10292653 Ga0075366_102926531 111
486 3300006195 Ga0075366_10786564 Ga0075366_107865642 111
487 3300006353 Ga0075370_10041996 Ga0075370_100419964 111
488 3300006353 Ga0075370_10077103 Ga0075370_100771033 111
489 3300006358 Ga0068871_100481216 Ga0068871_1004812162 111
490 3300006844 Ga0075428_102209334 Ga0075428_1022093342 111
491 3300006881 Ga0068865_100529464 Ga0068865_1005294642 111
492 3300006881 Ga0068865_102037398 Ga0068865_1020373981 111
493 3300006931 Ga0097620_100196308 Ga0097620_1001963083 111
494 3300006931 Ga0097620_100381686 Ga0097620_1003816862 111
495 3300009093 Ga0105240_10272940 Ga0105240_102729402 111
496 3300009094 Ga0111539_10285806 Ga0111539_102858062 111
497 3300009101 Ga0105247_10123534 Ga0105247_101235343 111
498 3300009147 Ga0114129_10177369 Ga0114129_101773693 111
499 3300009147 Ga0114129_11137135 Ga0114129_111371352 111
500 3300009148 Ga0105243_11613235 Ga0105243_116132351 111
501 3300009174 Ga0105241_10716595 Ga0105241_107165952 111
502 3300009176 Ga0105242_10988231 Ga0105242_109882311 111
503 3300009177 Ga0105248_10461429 Ga0105248_104614292 111
504 3300009177 Ga0105248_11821254 Ga0105248_118212541 111
505 3300009545 Ga0105237_10586768 Ga0105237_105867682 111
506 3300009545 Ga0105237_10660884 Ga0105237_106608842 111
507 3300009553 Ga0105249_10203428 Ga0105249_102034282 111
508 3300009553 Ga0105249_10443668 Ga0105249_104436683 111
509 3300010375 Ga0105239_10353779 Ga0105239_103537792 111
510 3300010375 Ga0105239_10592947 Ga0105239_105929472 111
511 3300010375 Ga0105239_13406843 Ga0105239_134068431 111
512 3300011119 Ga0105246_10983585 Ga0105246_109835852 111
513 3300011119 Ga0105246_11039479 Ga0105246_110394792 111
514 3300011119 Ga0105246_12501470 Ga0105246_125014701 111
515 3300013104 Ga0157370_10655413 Ga0157370_106554132 111
516 3300013105 Ga0157369_10307718 Ga0157369_103077182 111
517 3300013297 Ga0157378_10548988 Ga0157378_105489882 111
518 3300013306 Ga0163162_10463964 Ga0163162_104639641 111
519 3300013306 Ga0163162_10778708 Ga0163162_107787082 111
520 3300013306 Ga0163162_11398842 Ga0163162_113988421 111
521 3300013306 Ga0163162_12444255 Ga0163162_124442551 111
522 3300013308 Ga0157375_10214579 Ga0157375_102145792 111
523 3300013308 Ga0157375_10393869 Ga0157375_103938692 111
524 3300013308 Ga0157375_10409346 Ga0157375_104093462 111
525 3300013308 Ga0157375_10429877 Ga0157375_104298773 111
526 3300014325 Ga0163163_10130037 Ga0163163_101300373 111
527 3300014325 Ga0163163_11890179 Ga0163163_118901792 111
528 3300014326 Ga0157380_10201667 Ga0157380_102016673 111
529 3300014745 Ga0157377_11629435 Ga0157377_116294351 111
530 3300014968 Ga0157379_10245391 Ga0157379_102453913 111
531 3300017792 Ga0163161_10303652 Ga0163161_103036522 111
532 3300017792 Ga0163161_10442413 Ga0163161_104424132 111
533 3300017792 Ga0163161_11700544 Ga0163161_117005442 111
534 3300017792 Ga0163161_12089195 Ga0163161_120891951 111
535 3300025297 Ga0209758_1005984 Ga0209758_10059846 111
536 3300025893 Ga0207682_10372930 Ga0207682_103729302 111
537 3300025900 Ga0207710_10112002 Ga0207710_101120021 111
538 3300025900 Ga0207710_10179041 Ga0207710_101790411 111
539 3300025901 Ga0207688_10136258 Ga0207688_101362582 111
540 3300025901 Ga0207688_10220147 Ga0207688_102201472 111
541 3300025903 Ga0207680_10160679 Ga0207680_101606792 111
542 3300025903 Ga0207680_10566378 Ga0207680_105663782 111
543 3300025907 Ga0207645_10100720 Ga0207645_101007203 111
544 3300025908 Ga0207643_10504244 Ga0207643_105042441 111
545 3300025912 Ga0207707_10053447 Ga0207707_100534472 111
546 3300025915 Ga0207693_10526066 Ga0207693_105260662 111
547 3300025915 Ga0207693_10679009 Ga0207693_106790091 111
548 3300025916 Ga0207663_10531104 Ga0207663_105311042 111
549 3300025917 Ga0207660_10029807 Ga0207660_100298074 111
550 3300025918 Ga0207662_10225699 Ga0207662_102256992 111
551 3300025920 Ga0207649_10136724 Ga0207649_101367243 111
552 3300025921 Ga0207652_10439951 Ga0207652_104399512 111
553 3300025925 Ga0207650_10286400 Ga0207650_102864003 111
554 3300025925 Ga0207650_11006663 Ga0207650_110066632 111
555 3300025926 Ga0207659_10901429 Ga0207659_109014292 111
556 3300025926 Ga0207659_11699709 Ga0207659_116997092 111
557 3300025927 Ga0207687_10073554 Ga0207687_100735542 111
558 3300025928 Ga0207700_10018587 Ga0207700_100185873 111
559 3300025929 Ga0207664_10423502 Ga0207664_104235022 111
560 3300025931 Ga0207644_10113061 Ga0207644_101130612 111
561 3300025931 Ga0207644_10840177 Ga0207644_108401772 111
562 3300025933 Ga0207706_10889590 Ga0207706_108895902 111
563 3300025935 Ga0207709_10184326 Ga0207709_101843263 111
564 3300025935 Ga0207709_10263760 Ga0207709_102637602 111
565 3300025938 Ga0207704_10175686 Ga0207704_101756863 111
566 3300025938 Ga0207704_10862334 Ga0207704_108623342 111
567 3300025939 Ga0207665_10097547 Ga0207665_100975472 111
568 3300025939 Ga0207665_10176706 Ga0207665_101767062 111
569 3300025940 Ga0207691_10473402 Ga0207691_104734022 111
570 3300025940 Ga0207691_10962012 Ga0207691_109620121 111
571 3300025941 Ga0207711_10443845 Ga0207711_104438452 111
572 3300025942 Ga0207689_10037068 Ga0207689_100370684 111
573 3300025942 Ga0207689_10062358 Ga0207689_100623583 111
574 3300025945 Ga0207679_10063126 Ga0207679_100631263 111
575 3300025960 Ga0207651_10416540 Ga0207651_104165402 111
576 3300025960 Ga0207651_11108187 Ga0207651_111081871 111
577 3300025972 Ga0207668_10035874 Ga0207668_100358744 111
578 3300025972 Ga0207668_10039748 Ga0207668_100397483 111
579 3300025972 Ga0207668_10461337 Ga0207668_104613372 111
580 3300025972 Ga0207668_10543037 Ga0207668_105430372 111
581 3300025972 Ga0207668_11353917 Ga0207668_113539172 111
582 3300025981 Ga0207640_10456117 Ga0207640_104561172 111
583 3300026023 Ga0207677_10007318 Ga0207677_100073186 111
584 3300026023 Ga0207677_10496358 Ga0207677_104963582 111
585 3300026023 Ga0207677_11369830 Ga0207677_113698302 111
586 3300026035 Ga0207703_12109895 Ga0207703_121098952 111
587 3300026041 Ga0207639_10095084 Ga0207639_100950843 111
588 3300026041 Ga0207639_10164148 Ga0207639_101641483 111
589 3300026067 Ga0207678_10036446 Ga0207678_100364464 111
590 3300026067 Ga0207678_10266009 Ga0207678_102660092 111
591 3300026067 Ga0207678_10306141 Ga0207678_103061411 111
592 3300026067 Ga0207678_10320693 Ga0207678_103206932 111
593 3300026067 Ga0207678_10358339 Ga0207678_103583392 111
594 3300026075 Ga0207708_10221292 Ga0207708_102212923 111
595 3300026075 Ga0207708_10639062 Ga0207708_106390622 111
596 3300026078 Ga0207702_10000014 Ga0207702_10000014238 111
597 3300026078 Ga0207702_10752686 Ga0207702_107526862 111
598 3300026088 Ga0207641_11169825 Ga0207641_111698252 111
599 3300026088 Ga0207641_12123235 Ga0207641_121232351 111
600 3300026095 Ga0207676_10742510 Ga0207676_107425102 111
601 3300026095 Ga0207676_10785932 Ga0207676_107859323 111
602 3300026116 Ga0207674_11263584 Ga0207674_112635842 111
603 3300026118 Ga0207675_100051489 Ga0207675_1000514894 111
604 3300026118 Ga0207675_100574536 Ga0207675_1005745361 111
605 3300026118 Ga0207675_101537961 Ga0207675_1015379612 111
606 3300026118 Ga0207675_102235302 Ga0207675_1022353022 111
607 3300026121 Ga0207683_10010329 Ga0207683_100103295 111
608 3300026121 Ga0207683_10059461 Ga0207683_100594612 111
609 3300026121 Ga0207683_10181418 Ga0207683_101814183 111
610 3300026142 Ga0207698_10063522 Ga0207698_100635223 111
611 3300026142 Ga0207698_10231745 Ga0207698_102317453 111
612 3300027866 Ga0209813_10096138 Ga0209813_100961382 111
613 3300027907 Ga0207428_10517963 Ga0207428_105179632 111
614 3300028379 Ga0268266_10004186 Ga0268266_100041866 111
615 3300028379 Ga0268266_10035828 Ga0268266_100358284 111
616 3300028379 Ga0268266_10297237 Ga0268266_102972373 111
617 3300028379 Ga0268266_10587538 Ga0268266_105875382 111
618 3300028379 Ga0268266_11408435 Ga0268266_114084351 111
619 3300028380 Ga0268265_10120393 Ga0268265_101203933 111
620 3300028380 Ga0268265_10179152 Ga0268265_101791522 111
621 3300028380 Ga0268265_10419214 Ga0268265_104192142 111
622 3300028786 Ga0307517_10476983 Ga0307517_104769831 111
623 3300028786 Ga0307517_10649604 Ga0307517_106496042 111
624 3300028794 Ga0307515_10394839 Ga0307515_103948392 111
625 3300028794 Ga0307515_10414896 Ga0307515_104148962 111
626 3300028794 Ga0307515_10462906 Ga0307515_104629062 111
627 3300031250 Ga0265331_10099252 Ga0265331_100992523 111
628 3300031456 Ga0307513_10378818 Ga0307513_103788182 111
629 3300031456 Ga0307513_10454173 Ga0307513_104541732 111
630 3300031507 Ga0307509_10712027 Ga0307509_107120271 111
631 3300031548 Ga0307408_100373302 Ga0307408_1003733022 111
632 3300031548 Ga0307408_100441588 Ga0307408_1004415882 111
633 3300031548 Ga0307408_100660612 Ga0307408_1006606122 111
634 3300031548 Ga0307408_101287966 Ga0307408_1012879662 111
635 3300031730 Ga0307516_10169761 Ga0307516_101697612 111
636 3300031731 Ga0307405_11322647 Ga0307405_113226472 111
637 3300031824 Ga0307413_10801422 Ga0307413_108014222 111
638 3300031824 Ga0307413_12189339 Ga0307413_121893391 111
639 3300031852 Ga0307410_10197273 Ga0307410_101972733 111
640 3300031901 Ga0307406_10319565 Ga0307406_103195652 111
641 3300031901 Ga0307406_12109741 Ga0307406_121097412 111
642 3300031911 Ga0307412_10384165 Ga0307412_103841652 111
643 3300031911 Ga0307412_10447650 Ga0307412_104476502 111
644 3300031911 Ga0307412_11152607 Ga0307412_111526072 111
645 3300031995 Ga0307409_100785057 Ga0307409_1007850572 111
646 3300031995 Ga0307409_101248187 Ga0307409_1012481872 111
647 3300031995 Ga0307409_102051144 Ga0307409_1020511442 111
648 3300032002 Ga0307416_100166359 Ga0307416_1001663593 111
649 3300032002 Ga0307416_101108066 Ga0307416_1011080662 111
650 3300032002 Ga0307416_101785369 Ga0307416_1017853692 111
651 3300032002 Ga0307416_102154646 Ga0307416_1021546462 111
652 3300032005 Ga0307411_11086952 Ga0307411_110869522 111
653 3300033179 Ga0307507_10639363 Ga0307507_106393631 111
654 3300033180 Ga0307510_10019452 Ga0307510_100194528 111
655 3300033180 Ga0307510_10283845 Ga0307510_102838452 111
656 3300035113 Ga0373936_0292374 Ga0373936_0292374_139_474 111
657 3300035172 Ga0373955_0302418 Ga0373955_0302418_611_952 111
658 3300035691 Ga0373931_0702153 Ga0373931_0702153_139_483 111
659 3300035695 Ga0373927_0079443 Ga0373927_0079443_237_581 111
660 3300035724 Ga0373933_0002307 Ga0373933_0002307_969_1310 111
661 3300035725 Ga0373947_0241823 Ga0373947_0241823_763_1107 111
662 3300035725 Ga0373947_0486484 Ga0373947_0486484_213_554 111
663 3300037068 Ga0373925_0469041 Ga0373925_0469041_14_358 111
664 3300041413 Ga0439465_0236626 Ga0439465_0236626_109_450 111
665 3300041451 Ga0451791_0739765 Ga0451791_0739765_18_353 111
666 3300041460 Ga0451802_1420511 Ga0451802_1420511_15_356 111
667 3300041460 Ga0451802_2110330 Ga0451802_2110330_118_459 111
668 3300041486 Ga0451807_1607596 Ga0451807_1607596_550_885 111
669 3300041494 Ga0451837_0166180 Ga0451837_0166180_27_362 111
670 3300042157 Ga0439458_0017499 Ga0439458_0017499_860_1195 111
671 3300046452 Ga0495617_012261 Ga0495617_012261_2126_2467 111
672 3300046455 Ga0495603_0019146 Ga0495603_0019146_3635_3976 111
673 3300046455 Ga0495603_0023274 Ga0495603_0023274_2733_3068 111
674 3300046460 Ga0495638_0104161 Ga0495638_0104161_871_1212 111
675 3300046461 Ga0495641_0041267 Ga0495641_0041267_1218_1553 111
676 3300046461 Ga0495641_0216531 Ga0495641_0216531_387_728 111
677 3300046462 Ga0495651_0515749 Ga0495651_0515749_294_635 111
678 3300046472 Ga0495580_0406108 Ga0495580_0406108_98_442 111
679 3300046473 Ga0495582_0564199 Ga0495582_0564199_225_566 111
680 3300046474 Ga0495605_0157201 Ga0495605_0157201_49_390 111
681 3300046474 Ga0495605_0209218 Ga0495605_0209218_48_389 111
682 3300046474 Ga0495605_0386999 Ga0495605_0386999_143_484 111
683 3300046475 Ga0495639_0149486 Ga0495639_0149486_48_389 111
684 3300046475 Ga0495639_0203272 Ga0495639_0203272_501_836 111
685 3300046491 Ga0495584_0095443 Ga0495584_0095443_550_885 111
686 3300046492 Ga0495585_0110640 Ga0495585_0110640_465_806 111
687 3300046492 Ga0495585_0169275 Ga0495585_0169275_106_447 111
688 3300046492 Ga0495585_0310967 Ga0495585_0310967_32_373 111
689 3300046499 Ga0495594_0452954 Ga0495594_0452954_200_535 111
690 3300046500 Ga0495596_0037063 Ga0495596_0037063_58_393 111
691 3300046500 Ga0495596_0151077 Ga0495596_0151077_514_855 111
692 3300046500 Ga0495596_0161249 Ga0495596_0161249_134_475 111
693 3300046500 Ga0495596_0201027 Ga0495596_0201027_60_395 111
694 3300046501 Ga0495607_0217623 Ga0495607_0217623_499_840 111
695 3300046501 Ga0495607_0434386 Ga0495607_0434386_229_564 111
696 3300046512 Ga0495610_0123246 Ga0495610_0123246_402_737 111
697 3300046513 Ga0495616_0146426 Ga0495616_0146426_426_767 111
698 3300046513 Ga0495616_0180963 Ga0495616_0180963_71_406 111
699 3300046513 Ga0495616_0242355 Ga0495616_0242355_229_570 111
700 3300046515 Ga0495620_0074829 Ga0495620_0074829_991_1326 111
701 3300046515 Ga0495620_0080394 Ga0495620_0080394_121_462 111
702 3300046518 Ga0495631_0033505 Ga0495631_0033505_48_389 111
703 3300046519 Ga0495632_0147623 Ga0495632_0147623_616_957 111
704 3300046519 Ga0495632_0203522 Ga0495632_0203522_245_580 111
705 3300046519 Ga0495632_0330836 Ga0495632_0330836_56_397 111
706 3300046522 Ga0495643_0244119 Ga0495643_0244119_188_523 111
707 3300046523 Ga0495644_0322078 Ga0495644_0322078_31_372 111
708 3300046525 Ga0495663_0100245 Ga0495663_0100245_582_923 111
709 3300046526 Ga0495666_0392120 Ga0495666_0392120_83_424 111
710 3300046528 Ga0495642_0114043 Ga0495642_0114043_708_1049 111
711 3300046528 Ga0495642_0245848 Ga0495642_0245848_419_754 111
712 3300046530 Ga0495654_0096274 Ga0495654_0096274_52_393 111
713 3300046531 Ga0495665_0232244 Ga0495665_0232244_481_816 111
714 3300046536 Ga0495587_0512512 Ga0495587_0512512_163_504 111
715 3300046538 Ga0495609_0067233 Ga0495609_0067233_401_736 111
716 3300046542 Ga0495597_0171117 Ga0495597_0171117_299_640 111
717 3300046557 Ga0495622_0029989 Ga0495622_0029989_882_1217 111
718 3300046558 Ga0495633_0229205 Ga0495633_0229205_235_576 111
719 3300046558 Ga0495633_0281271 Ga0495633_0281271_95_430 111
720 3300046615 Ga0495656_0004583 Ga0495656_0004583_862_1203 111
721 3300046615 Ga0495656_0156674 Ga0495656_0156674_211_552 111
722 3300046615 Ga0495656_0357593 Ga0495656_0357593_184_525 111
723 3300046616 Ga0495668_0088884 Ga0495668_0088884_750_1091 111
724 3300046616 Ga0495668_0145069 Ga0495668_0145069_677_1012 111
725 3300046616 Ga0495668_0263938 Ga0495668_0263938_526_867 111
726 3300046616 Ga0495668_0311914 Ga0495668_0311914_243_584 111
727 3300046616 Ga0495668_0653876 Ga0495668_0653876_19_354 111
728 3300046642 Ga0495634_0775245 Ga0495634_0775245_187_528 111
729 3300046648 Ga0495611_0204938 Ga0495611_0204938_313_654 111
730 3300046660 Ga0495625_0725939 Ga0495625_0725939_21_362 111
731 3300046664 Ga0495659_0019280 Ga0495659_0019280_1522_1863 111
732 3300046674 Ga0495588_0106822 Ga0495588_0106822_516_857 111
733 3300046674 Ga0495588_0212477 Ga0495588_0212477_144_479 111
734 3300046683 Ga0495658_0250475 Ga0495658_0250475_617_952 111
735 3300046684 Ga0495669_0045936 Ga0495669_0045936_799_1140 111
736 3300046684 Ga0495669_0056763 Ga0495669_0056763_47_388 111
737 3300046690 Ga0495624_0883485 Ga0495624_0883485_128_463 111
738 3300046691 Ga0495670_0434409 Ga0495670_0434409_262_597 111
739 3300046691 Ga0495670_0771924 Ga0495670_0771924_54_395 111
740 3300046692 Ga0495671_0226763 Ga0495671_0226763_130_471 111
741 3300046692 Ga0495671_0613348 Ga0495671_0613348_96_437 111
742 3300046694 Ga0495649_0565932 Ga0495649_0565932_30_371 111
743 3300046794 Ga0495589_0264624 Ga0495589_0264624_205_546 111
744 3300046809 Ga0495600_0064005 Ga0495600_0064005_1438_1779 111
745 3300047315 Ga0495581_0810433 Ga0495581_0810433_66_401 111
746 3300047317 Ga0495604_0664575 Ga0495604_0664575_185_526 111
747 3300047318 Ga0495636_0057273 Ga0495636_0057273_897_1238 111
748 3300047320 Ga0495672_0361314 Ga0495672_0361314_262_597 111
749 3300047321 Ga0495676_0080205 Ga0495676_0080205_393_734 111
750 3300047322 Ga0495680_0462734 Ga0495680_0462734_104_445 111
751 3300047469 Ga0495673_0114584 Ga0495673_0114584_17_352 111
752 3300047470 Ga0495681_0398881 Ga0495681_0398881_75_416 111
753 3300047472 Ga0495686_0190739 Ga0495686_0190739_524_859 111
754 3300047673 Ga0495593_0352235 Ga0495593_0352235_318_662 111
755 3300048089 Ga0495614_0217491 Ga0495614_0217491_20_361 111
756 3300048091 Ga0495626_0090888 Ga0495626_0090888_683_1024 111
757 3300048904 Ga0496101_1573828 Ga0496101_1573828_18_353 111
758 3300048911 Ga0496108_0573947 Ga0496108_0573947_93_428 111
759 3300048912 Ga0496109_0570835 Ga0496109_0570835_497_856 111
760 3300048916 Ga0496113_1425773 Ga0496113_1425773_103_462 111
761 3300048918 Ga0496115_0046849 Ga0496115_0046849_1899_2252 111
762 3300048924 Ga0496121_0044798 Ga0496121_0044798_988_1329 111
763 3300048924 Ga0496121_0082049 Ga0496121_0082049_940_1281 111
764 3300048924 Ga0496121_0119094 Ga0496121_0119094_705_1040 111
765 3300048924 Ga0496121_0158250 Ga0496121_0158250_1291_1632 111
766 3300048924 Ga0496121_0507192 Ga0496121_0507192_316_657 111
767 3300048927 Ga0496124_0124232 Ga0496124_0124232_1310_1651 111
768 3300048927 Ga0496124_0990925 Ga0496124_0990925_77_412 111
769 3300048928 Ga0496125_0173573 Ga0496125_0173573_653_994 111
770 3300048928 Ga0496125_0312501 Ga0496125_0312501_380_721 111
771 3300048928 Ga0496125_0533178 Ga0496125_0533178_236_577 111
772 3300048929 Ga0496126_0048723 Ga0496126_0048723_2227_2568 111
773 3300048929 Ga0496126_0175444 Ga0496126_0175444_490_831 111
774 3300048929 Ga0496126_0275698 Ga0496126_0275698_489_830 111
775 3300049459 Ga0495678_184566 Ga0495678_184566_101_436 111
776 3300049578 Ga0501042_0158314 Ga0501042_0158314_70_411 111
777 3300049583 Ga0501067_0219605 Ga0501067_0219605_63_398 111
778 3300049584 Ga0501068_0838553 Ga0501068_0838553_230_568 111
779 3300049586 Ga0501070_1295502 Ga0501070_1295502_87_428 111
780 3300049587 Ga0501071_0171754 Ga0501071_0171754_88_429 111
781 3300050489 nmdc:mga03683_619723_c1 nmdc:mga03683_619723_c1_157_492 111
782 3300050490 nmdc:mga03n38_1510_c1 nmdc:mga03n38_1510_c1_859_1200 111
783 3300050491 nmdc:mga00v17_202351_c1 nmdc:mga00v17_202351_c1_15_356 111
784 3300050491 nmdc:mga00v17_693401_c1 nmdc:mga00v17_693401_c1_60_401 111
785 3300050492 nmdc:mga0yw44_1027711_c1 nmdc:mga0yw44_1027711_c1_191_532 111
786 3300050493 nmdc:mga0k408_210367_c1 nmdc:mga0k408_210367_c1_558_899 111
787 3300050493 nmdc:mga0k408_477043_c1 nmdc:mga0k408_477043_c1_136_477 111
788 3300050493 nmdc:mga0k408_668833_c1 nmdc:mga0k408_668833_c1_65_406 111
789 3300050493 nmdc:mga0k408_839441_c1 nmdc:mga0k408_839441_c1_93_434 111
790 3300050494 nmdc:mga06z11_180854_c1 nmdc:mga06z11_180854_c1_670_1011 111
791 3300050494 nmdc:mga06z11_283960_c1 nmdc:mga06z11_283960_c1_237_572 111
792 3300050494 nmdc:mga06z11_9242_c1 nmdc:mga06z11_9242_c1_2626_2967 111
793 3300050495 nmdc:mga04h51_114061_c1 nmdc:mga04h51_114061_c1_190_531 111
794 3300050496 nmdc:mga07m45_1327_c4 nmdc:mga07m45_1327_c4_859_1200 111
795 3300050496 nmdc:mga07m45_597371_c1 nmdc:mga07m45_597371_c1_147_482 111
796 3300050507 nmdc:mga05p37_239403_c1 nmdc:mga05p37_239403_c1_1510_1851 111
797 3300050511 nmdc:mga08y16_382743_c1 nmdc:mga08y16_382743_c1_894_1235 111
798 3300050516 nmdc:mga0sz30_219186_c1 nmdc:mga0sz30_219186_c1_31_372 111
799 3300053092 Ga0500583_0388232 Ga0500583_0388232_99_440 111
800 3300053093 Ga0500651_0116823 Ga0500651_0116823_421_756 111
801 3300053096 Ga0500641_0231654 Ga0500641_0231654_185_526 111
802 3300053103 Ga0500555_059939 Ga0500555_059939_357_698 111
803 3300053106 Ga0500558_281906 Ga0500558_281906_132_467 111
804 3300053109 Ga0500569_027872 Ga0500569_027872_1074_1409 111
805 3300053119 Ga0500595_004847 Ga0500595_004847_672_1007 111
806 3300053130 Ga0500642_0068424 Ga0500642_0068424_338_679 111
807 3300053134 Ga0500658_0056611 Ga0500658_0056611_345_680 111
808 3300053134 Ga0500658_0230499 Ga0500658_0230499_234_575 111
809 3300053142 Ga0500577_0133880 Ga0500577_0133880_371_706 111
810 3300053151 Ga0500604_0130673 Ga0500604_0130673_166_507 111
811 3300053151 Ga0500604_0143688 Ga0500604_0143688_167_502 111
812 3300053156 Ga0500622_0315320 Ga0500622_0315320_254_595 111
813 3300053158 Ga0500627_0411914 Ga0500627_0411914_107_442 111
814 3300053160 Ga0500633_0379459 Ga0500633_0379459_129_470 111
815 3300053162 Ga0500638_311554 Ga0500638_311554_126_461 111
816 3300053177 Ga0500636_0526123 Ga0500636_0526123_63_398 111
817 3300053178 Ga0500637_0501835 Ga0500637_0501835_169_504 111
818 3300053730 Ga0500645_205433 Ga0500645_205433_168_503 111
819 3300053731 Ga0500609_021098 Ga0500609_021098_145_480 111
820 3300061734 Ga0530510_0992105 Ga0530510_0992105_196_537 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

44

126

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8r57-assembly1.cif.gz_T cryoem structure of wheat 40s ribosomal subunit, head domain 0.9345 59 92
4jba-assembly1.cif.gz_B crystal structure of the oxidized form of marr from e.coli 0.9337 34 96
6tmf-assembly1.cif.gz_V structure of an archaeal abce1-bound ribosomal post-splitting complex 0.9326 58 92
4v7e-assembly1.cif.gz_BT model of the small subunit rna based on a 5.5 a cryo-em map of triticum aestivum translating 80s ribosome 0.9239 58 92
6zj3-assembly1.cif.gz_SX cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.9198 59 92
ID Description Score Start End Superfamily
af_I1LWR7_1_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9274 59 96 1.10.10.10
af_Q59048_168_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9253 34 87 1.10.10.10
af_Q9H171_1_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9243 34 86 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9139 22 106 1.10.10.10
af_A4I1H2_999_1066_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9095 34 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S6AIF2-F1-model_v4 Transcriptional regulator 0.9757 27 104 GO:0003677
AF-A0A1H4SED5-F1-model_v4 DNA-binding transcriptional regulator, HxlR family 0.9708 23 110 GO:0003677
AF-A0A5C5RFR2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9667 27 105 GO:0003677
AF-A0A4U8VYG9-F1-model_v4 HxlR-like helix-turn-helix 0.966 27 106 GO:0003677
AF-A0A1A2KYN1-F1-model_v4 Transcriptional regulator 0.9611 23 107 GO:0003677

Feature Viewer

pLDDT pTM Quality
85.93 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map