F482201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 820 | 446 | 744 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100422844|Ga0070663_1004228441 |
| Length | 126 |
| Sequence | MTKATRRTIATPPAQGHKRDARPAKRPSVRGSRTGRPIMALLDLLGRRWTLRIAWELREGSLTSRALRTACDDASPTVVQARLSELREAGLVELLPGDGYRLTALGQELNETFLPLYRFAERWSKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 6 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 7 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 8 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 9 | 2791355199 | |||
| 10 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 11 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 12 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 13 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 14 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 15 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 16 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 17 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 18 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 19 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 20 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 21 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 22 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 23 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 24 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 25 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 26 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 27 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 28 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 29 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 30 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 31 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 32 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 33 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 34 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 35 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 36 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 37 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 38 | 2922368715 | |||
| 39 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 40 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 41 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 42 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 43 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 44 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 45 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 46 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 47 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 48 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 49 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 50 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 51 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 52 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 53 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 54 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 55 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 56 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 57 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 58 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 59 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 60 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 61 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 62 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 63 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 64 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 65 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 66 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 67 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 68 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 69 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 70 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 131 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 132 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 139 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 143 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 144 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 145 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 146 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 149 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 150 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 164 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 278 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 395 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 400 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 412 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 413 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 417 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 418 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 425 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 427 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 428 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 433 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 436 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 438 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 439 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 440 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 441 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 442 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 443 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 444 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 445 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 446 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.95 |
| Metatranscriptomes | 0 |
| Isolates | 9.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.59 |
| Nodule | 6.83 |
| Rhizoplane | 4.27 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10009457 | 3300003215 | Bacteria | 4528 |
| 2 | rootL2_10122270 | 3300003322 | Bacteria | 1560 |
| 3 | JGI25404J52841_10018969 | 3300003659 | Bacteria | 1490 |
| 4 | JGI25404J52841_10021526 | 3300003659 | Bacteria | 1396 |
| 5 | JGI25404J52841_10087605 | 3300003659 | Bacteria | 651 |
| 6 | JGI25404J52841_10146277 | 3300003659 | Bacteria | 502 |
| 7 | Ga0070658_10301967 | 3300005327 | Bacteria | 1365 |
| 8 | Ga0070658_10454369 | 3300005327 | Bacteria | 1104 |
| 9 | Ga0070658_10630521 | 3300005327 | Bacteria | 930 |
| 10 | Ga0070676_11624409 | 3300005328 | Bacteria | 500 |
| 11 | Ga0070683_100325152 | 3300005329 | Bacteria | 1464 |
| 12 | Ga0070677_10482048 | 3300005333 | Bacteria | 669 |
| 13 | Ga0068869_100121598 | 3300005334 | Bacteria | 1997 |
| 14 | Ga0068869_100267954 | 3300005334 | Bacteria | 1369 |
| 15 | Ga0068869_101279367 | 3300005334 | Bacteria | 646 |
| 16 | Ga0070666_10215010 | 3300005335 | Bacteria | 1355 |
| 17 | Ga0070666_10369250 | 3300005335 | Bacteria | 1029 |
| 18 | Ga0070666_10696793 | 3300005335 | Bacteria | 745 |
| 19 | Ga0070680_100017554 | 3300005336 | Bacteria | 5644 |
| 20 | Ga0070680_100048802 | 3300005336 | Bacteria | 3450 |
| 21 | Ga0070682_100072743 | 3300005337 | Bacteria | 2204 |
| 22 | Ga0070682_100448157 | 3300005337 | Bacteria | 988 |
| 23 | Ga0068868_100014062 | 3300005338 | Bacteria | 5891 |
| 24 | Ga0068868_100114030 | 3300005338 | Bacteria | 2198 |
| 25 | Ga0070689_101173391 | 3300005340 | Bacteria | 688 |
| 26 | Ga0070687_100261716 | 3300005343 | Bacteria | 1080 |
| 27 | Ga0070661_100175704 | 3300005344 | Bacteria | 1628 |
| 28 | Ga0070661_100796474 | 3300005344 | Bacteria | 775 |
| 29 | Ga0070668_100607299 | 3300005347 | Bacteria | 958 |
| 30 | Ga0070668_100725306 | 3300005347 | Bacteria | 878 |
| 31 | Ga0070668_101161077 | 3300005347 | Bacteria | 699 |
| 32 | Ga0070668_101189032 | 3300005347 | Bacteria | 690 |
| 33 | Ga0070668_101947008 | 3300005347 | Bacteria | 542 |
| 34 | Ga0070675_101073300 | 3300005354 | Bacteria | 740 |
| 35 | Ga0070671_100080455 | 3300005355 | Bacteria | 2724 |
| 36 | Ga0070671_101560312 | 3300005355 | Bacteria | 585 |
| 37 | Ga0070671_101989826 | 3300005355 | Bacteria | 517 |
| 38 | Ga0070673_100333248 | 3300005364 | Bacteria | 1343 |
| 39 | Ga0070688_100125494 | 3300005365 | Bacteria | 1724 |
| 40 | Ga0070659_100654137 | 3300005366 | Bacteria | 906 |
| 41 | Ga0070714_100311829 | 3300005435 | Bacteria | 1469 |
| 42 | Ga0070714_102389867 | 3300005435 | Bacteria | 514 |
| 43 | Ga0070713_100019375 | 3300005436 | Bacteria | 5193 |
| 44 | Ga0070701_10363293 | 3300005438 | Bacteria | 908 |
| 45 | Ga0070700_100211194 | 3300005441 | Bacteria | 1369 |
| 46 | Ga0070708_100090073 | 3300005445 | Bacteria | 2792 |
| 47 | Ga0070663_100029162 | 3300005455 | Bacteria | 3767 |
| 48 | Ga0070663_100156007 | 3300005455 | Bacteria | 1754 |
| 49 | Ga0070663_100244642 | 3300005455 | Bacteria | 1417 |
| 50 | Ga0070663_100422844 | 3300005455 | Bacteria | 1093 |
| 51 | Ga0070678_100032876 | 3300005456 | Bacteria | 3595 |
| 52 | Ga0070678_100040360 | 3300005456 | Bacteria | 3302 |
| 53 | Ga0070678_100136230 | 3300005456 | Bacteria | 1958 |
| 54 | Ga0070662_100258360 | 3300005457 | Bacteria | 1403 |
| 55 | Ga0070662_100860001 | 3300005457 | Bacteria | 773 |
| 56 | Ga0070681_10075720 | 3300005458 | Bacteria | 3325 |
| 57 | Ga0070681_10325818 | 3300005458 | Bacteria | 1446 |
| 58 | Ga0070681_10575932 | 3300005458 | Bacteria | 1039 |
| 59 | Ga0070681_10786286 | 3300005458 | Bacteria | 869 |
| 60 | Ga0068867_100205532 | 3300005459 | Bacteria | 1578 |
| 61 | Ga0070685_10813513 | 3300005466 | Bacteria | 690 |
| 62 | Ga0070706_100578698 | 3300005467 | Bacteria | 1044 |
| 63 | Ga0070706_101514664 | 3300005467 | Bacteria | 613 |
| 64 | Ga0070698_102135573 | 3300005471 | Bacteria | 514 |
| 65 | Ga0070699_100943203 | 3300005518 | Bacteria | 791 |
| 66 | Ga0070679_100011213 | 3300005530 | Bacteria | 8545 |
| 67 | Ga0070679_100020644 | 3300005530 | Bacteria | 6424 |
| 68 | Ga0070679_100028212 | 3300005530 | Bacteria | 5533 |
| 69 | Ga0070679_100855266 | 3300005530 | Bacteria | 853 |
| 70 | Ga0070679_101345524 | 3300005530 | Unclassified | 660 |
| 71 | Ga0070697_100851089 | 3300005536 | Bacteria | 808 |
| 72 | Ga0068853_100033499 | 3300005539 | Bacteria | 4359 |
| 73 | Ga0068853_100097575 | 3300005539 | Bacteria | 2594 |
| 74 | Ga0068853_100681028 | 3300005539 | Bacteria | 980 |
| 75 | Ga0068853_101055623 | 3300005539 | Bacteria | 783 |
| 76 | Ga0068853_102186166 | 3300005539 | Bacteria | 536 |
| 77 | Ga0070672_100721325 | 3300005543 | Bacteria | 874 |
| 78 | Ga0070693_100228880 | 3300005547 | Bacteria | 1222 |
| 79 | Ga0070693_100307986 | 3300005547 | Bacteria | 1070 |
| 80 | Ga0070665_100038149 | 3300005548 | Bacteria | 4829 |
| 81 | Ga0070665_100105625 | 3300005548 | Bacteria | 2818 |
| 82 | Ga0070665_100241629 | 3300005548 | Bacteria | 1806 |
| 83 | Ga0070665_100280074 | 3300005548 | Bacteria | 1669 |
| 84 | Ga0070665_100748838 | 3300005548 | Bacteria | 990 |
| 85 | Ga0068855_100023888 | 3300005563 | Bacteria | 7321 |
| 86 | Ga0068855_101051673 | 3300005563 | Bacteria | 853 |
| 87 | Ga0070664_100125780 | 3300005564 | Bacteria | 2249 |
| 88 | Ga0068857_101781706 | 3300005577 | Unclassified | 602 |
| 89 | Ga0068854_100640089 | 3300005578 | Bacteria | 912 |
| 90 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 91 | Ga0068856_100083848 | 3300005614 | Bacteria | 3166 |
| 92 | Ga0068856_100298653 | 3300005614 | Bacteria | 1628 |
| 93 | Ga0068856_100519715 | 3300005614 | Bacteria | 1212 |
| 94 | Ga0068856_100578821 | 3300005614 | Bacteria | 1144 |
| 95 | Ga0068852_100105731 | 3300005616 | Bacteria | 2550 |
| 96 | Ga0068852_101031227 | 3300005616 | Bacteria | 842 |
| 97 | Ga0068859_100196295 | 3300005617 | Bacteria | 2103 |
| 98 | Ga0068859_100381704 | 3300005617 | Bacteria | 1504 |
| 99 | Ga0068864_100643461 | 3300005618 | Bacteria | 1032 |
| 100 | Ga0068866_10381933 | 3300005718 | Bacteria | 903 |
| 101 | Ga0068861_100135065 | 3300005719 | Bacteria | 2006 |
| 102 | Ga0068861_100796606 | 3300005719 | Bacteria | 886 |
| 103 | Ga0068861_102443843 | 3300005719 | Bacteria | 525 |
| 104 | Ga0068851_10244487 | 3300005834 | Bacteria | 1016 |
| 105 | Ga0068870_10076743 | 3300005840 | Bacteria | 1836 |
| 106 | Ga0068870_10177545 | 3300005840 | Bacteria | 1276 |
| 107 | Ga0068863_100182097 | 3300005841 | Bacteria | 2017 |
| 108 | Ga0068863_100598853 | 3300005841 | Bacteria | 1091 |
| 109 | Ga0068863_101458158 | 3300005841 | Bacteria | 692 |
| 110 | Ga0068863_102593529 | 3300005841 | Bacteria | 516 |
| 111 | Ga0068858_100124003 | 3300005842 | Bacteria | 2418 |
| 112 | Ga0068858_100341288 | 3300005842 | Bacteria | 1434 |
| 113 | Ga0068858_101250578 | 3300005842 | Bacteria | 730 |
| 114 | Ga0068860_100506624 | 3300005843 | Bacteria | 1206 |
| 115 | Ga0068860_100900227 | 3300005843 | Bacteria | 901 |
| 116 | Ga0068860_101047176 | 3300005843 | Bacteria | 834 |
| 117 | Ga0068860_101656962 | 3300005843 | Bacteria | 662 |
| 118 | Ga0068862_100107769 | 3300005844 | Bacteria | 2442 |
| 119 | Ga0068862_100216805 | 3300005844 | Bacteria | 1731 |
| 120 | Ga0068862_100805409 | 3300005844 | Bacteria | 917 |
| 121 | Ga0068862_102096388 | 3300005844 | Bacteria | 577 |
| 122 | Ga0081455_10026185 | 3300005937 | Bacteria | 5372 |
| 123 | Ga0081455_10176688 | 3300005937 | Bacteria | 1621 |
| 124 | Ga0081538_10099656 | 3300005981 | Bacteria | 1467 |
| 125 | Ga0081540_1011981 | 3300005983 | Bacteria | 5748 |
| 126 | Ga0081540_1031373 | 3300005983 | Bacteria | 2922 |
| 127 | Ga0081540_1049888 | 3300005983 | Bacteria | 2084 |
| 128 | Ga0081540_1100218 | 3300005983 | Bacteria | 1250 |
| 129 | Ga0081539_10017936 | 3300005985 | Bacteria | 4939 |
| 130 | Ga0070717_10000325 | 3300006028 | Bacteria | 31034 |
| 131 | Ga0075365_10116517 | 3300006038 | Bacteria | 1840 |
| 132 | Ga0075365_10129506 | 3300006038 | Bacteria | 1746 |
| 133 | Ga0075365_10424752 | 3300006038 | Bacteria | 938 |
| 134 | Ga0075365_10595468 | 3300006038 | Bacteria | 782 |
| 135 | Ga0075365_10711359 | 3300006038 | Bacteria | 709 |
| 136 | Ga0075365_11325633 | 3300006038 | Bacteria | 506 |
| 137 | Ga0075368_10071172 | 3300006042 | Bacteria | 1405 |
| 138 | Ga0075368_10153966 | 3300006042 | Bacteria | 961 |
| 139 | Ga0075363_100030546 | 3300006048 | Bacteria | 2790 |
| 140 | Ga0075363_100069487 | 3300006048 | Bacteria | 1911 |
| 141 | Ga0075363_100221741 | 3300006048 | Bacteria | 1084 |
| 142 | Ga0075363_100643338 | 3300006048 | Bacteria | 638 |
| 143 | Ga0075364_10974869 | 3300006051 | Bacteria | 577 |
| 144 | Ga0070716_100053569 | 3300006173 | Bacteria | 2301 |
| 145 | Ga0070716_100084265 | 3300006173 | Bacteria | 1906 |
| 146 | Ga0070712_100797821 | 3300006175 | Bacteria | 810 |
| 147 | Ga0070712_100902539 | 3300006175 | Bacteria | 762 |
| 148 | Ga0070712_101856912 | 3300006175 | Bacteria | 528 |
| 149 | Ga0075362_10068209 | 3300006177 | Bacteria | 1619 |
| 150 | Ga0075362_10089972 | 3300006177 | Bacteria | 1424 |
| 151 | Ga0075362_10144625 | 3300006177 | Bacteria | 1138 |
| 152 | Ga0075362_10175521 | 3300006177 | Bacteria | 1037 |
| 153 | Ga0075362_10243844 | 3300006177 | Bacteria | 883 |
| 154 | Ga0075362_10436629 | 3300006177 | Bacteria | 664 |
| 155 | Ga0075367_10045872 | 3300006178 | Bacteria | 2566 |
| 156 | Ga0075367_10066484 | 3300006178 | Bacteria | 2160 |
| 157 | Ga0075367_10409112 | 3300006178 | Bacteria | 858 |
| 158 | Ga0075367_10410528 | 3300006178 | Bacteria | 857 |
| 159 | Ga0075367_10540681 | 3300006178 | Bacteria | 740 |
| 160 | Ga0075369_10019469 | 3300006186 | Bacteria | 2771 |
| 161 | Ga0075369_10026495 | 3300006186 | Bacteria | 2416 |
| 162 | Ga0075366_10024339 | 3300006195 | Bacteria | 3531 |
| 163 | Ga0075366_10157117 | 3300006195 | Bacteria | 1377 |
| 164 | Ga0075366_10292653 | 3300006195 | Bacteria | 996 |
| 165 | Ga0075366_10387093 | 3300006195 | Unclassified | 860 |
| 166 | Ga0075366_10786564 | 3300006195 | Bacteria | 592 |
| 167 | Ga0075370_10028156 | 3300006353 | Bacteria | 3122 |
| 168 | Ga0075370_10041996 | 3300006353 | Bacteria | 2582 |
| 169 | Ga0075370_10077103 | 3300006353 | Bacteria | 1912 |
| 170 | Ga0075370_10337092 | 3300006353 | Unclassified | 900 |
| 171 | Ga0068871_100481216 | 3300006358 | Bacteria | 1117 |
| 172 | Ga0075428_101806788 | 3300006844 | Bacteria | 636 |
| 173 | Ga0075428_102209334 | 3300006844 | Bacteria | 568 |
| 174 | Ga0075430_100178283 | 3300006846 | Bacteria | 1768 |
| 175 | Ga0075434_100011477 | 3300006871 | Bacteria | 8362 |
| 176 | Ga0068865_100529464 | 3300006881 | Bacteria | 987 |
| 177 | Ga0068865_102037398 | 3300006881 | Bacteria | 521 |
| 178 | Ga0075436_100265403 | 3300006914 | Bacteria | 1225 |
| 179 | Ga0097620_100196308 | 3300006931 | Bacteria | 2103 |
| 180 | Ga0097620_100381686 | 3300006931 | Bacteria | 1504 |
| 181 | Ga0099823_1010603 | 3300006944 | Bacteria | 9345 |
| 182 | Ga0075435_100091989 | 3300007076 | Bacteria | 2504 |
| 183 | Ga0099794_10035033 | 3300007265 | Bacteria | 2367 |
| 184 | Ga0105240_10272940 | 3300009093 | Bacteria | 1946 |
| 185 | Ga0105240_10368125 | 3300009093 | Bacteria | 1626 |
| 186 | Ga0111539_10285806 | 3300009094 | Bacteria | 1919 |
| 187 | Ga0105245_10012692 | 3300009098 | Bacteria | 7335 |
| 188 | Ga0105247_10123534 | 3300009101 | Bacteria | 1680 |
| 189 | Ga0114129_10177369 | 3300009147 | Bacteria | 2902 |
| 190 | Ga0114129_11137135 | 3300009147 | Bacteria | 976 |
| 191 | Ga0105243_11613235 | 3300009148 | Bacteria | 676 |
| 192 | Ga0105241_10716595 | 3300009174 | Bacteria | 915 |
| 193 | Ga0105242_10988231 | 3300009176 | Bacteria | 848 |
| 194 | Ga0105248_10046694 | 3300009177 | Bacteria | 4855 |
| 195 | Ga0105248_10461340 | 3300009177 | Bacteria | 1432 |
| 196 | Ga0105248_10461429 | 3300009177 | Bacteria | 1432 |
| 197 | Ga0105248_11066290 | 3300009177 | Bacteria | 913 |
| 198 | Ga0105248_11821254 | 3300009177 | Bacteria | 690 |
| 199 | Ga0105237_10303264 | 3300009545 | Bacteria | 1600 |
| 200 | Ga0105237_10586768 | 3300009545 | Bacteria | 1121 |
| 201 | Ga0105237_10660884 | 3300009545 | Bacteria | 1052 |
| 202 | Ga0105237_12787494 | 3300009545 | Bacteria | 500 |
| 203 | Ga0105238_10078299 | 3300009551 | Bacteria | 3296 |
| 204 | Ga0105249_10203428 | 3300009553 | Bacteria | 1939 |
| 205 | Ga0105249_10443668 | 3300009553 | Bacteria | 1335 |
| 206 | Ga0099796_10062676 | 3300010159 | Bacteria | 1322 |
| 207 | Ga0105239_10097211 | 3300010375 | Bacteria | 3254 |
| 208 | Ga0105239_10353779 | 3300010375 | Bacteria | 1658 |
| 209 | Ga0105239_10592947 | 3300010375 | Bacteria | 1264 |
| 210 | Ga0105239_12035665 | 3300010375 | Bacteria | 667 |
| 211 | Ga0105239_13406843 | 3300010375 | Bacteria | 517 |
| 212 | Ga0105246_10983585 | 3300011119 | Bacteria | 763 |
| 213 | Ga0105246_11039479 | 3300011119 | Bacteria | 744 |
| 214 | Ga0105246_12501470 | 3300011119 | Bacteria | 508 |
| 215 | Ga0157370_10655413 | 3300013104 | Bacteria | 959 |
| 216 | Ga0157370_11874399 | 3300013104 | Bacteria | 538 |
| 217 | Ga0157369_10307718 | 3300013105 | Bacteria | 1648 |
| 218 | Ga0157369_10389029 | 3300013105 | Bacteria | 1447 |
| 219 | Ga0157369_10705902 | 3300013105 | Bacteria | 1038 |
| 220 | Ga0157374_10113473 | 3300013296 | Bacteria | 2608 |
| 221 | Ga0157374_11728134 | 3300013296 | Bacteria | 650 |
| 222 | Ga0157378_10018404 | 3300013297 | Bacteria | 6135 |
| 223 | Ga0157378_10255636 | 3300013297 | Bacteria | 1679 |
| 224 | Ga0157378_10548988 | 3300013297 | Bacteria | 1160 |
| 225 | Ga0163162_10047620 | 3300013306 | Bacteria | 4296 |
| 226 | Ga0163162_10463964 | 3300013306 | Bacteria | 1398 |
| 227 | Ga0163162_10778708 | 3300013306 | Bacteria | 1075 |
| 228 | Ga0163162_11038665 | 3300013306 | Bacteria | 927 |
| 229 | Ga0163162_11398842 | 3300013306 | Bacteria | 796 |
| 230 | Ga0163162_12444255 | 3300013306 | Bacteria | 601 |
| 231 | Ga0163162_12915089 | 3300013306 | Bacteria | 550 |
| 232 | Ga0163162_13005952 | 3300013306 | Bacteria | 542 |
| 233 | Ga0157375_10013598 | 3300013308 | Bacteria | 7251 |
| 234 | Ga0157375_10214579 | 3300013308 | Bacteria | 2082 |
| 235 | Ga0157375_10393869 | 3300013308 | Bacteria | 1552 |
| 236 | Ga0157375_10409346 | 3300013308 | Bacteria | 1522 |
| 237 | Ga0157375_10429877 | 3300013308 | Bacteria | 1486 |
| 238 | Ga0157375_11081242 | 3300013308 | Bacteria | 938 |
| 239 | Ga0157375_11374626 | 3300013308 | Bacteria | 831 |
| 240 | Ga0163163_10017597 | 3300014325 | Bacteria | 6669 |
| 241 | Ga0163163_10130037 | 3300014325 | Bacteria | 2558 |
| 242 | Ga0163163_11110114 | 3300014325 | Bacteria | 854 |
| 243 | Ga0163163_11822697 | 3300014325 | Bacteria | 669 |
| 244 | Ga0163163_11890179 | 3300014325 | Bacteria | 657 |
| 245 | Ga0157380_10201667 | 3300014326 | Bacteria | 1765 |
| 246 | Ga0182008_10153885 | 3300014497 | Bacteria | 1154 |
| 247 | Ga0157377_10050988 | 3300014745 | Bacteria | 2333 |
| 248 | Ga0157377_11629435 | 3300014745 | Bacteria | 518 |
| 249 | Ga0157379_10041641 | 3300014968 | Bacteria | 4100 |
| 250 | Ga0157379_10245391 | 3300014968 | Bacteria | 1625 |
| 251 | Ga0157376_10215020 | 3300014969 | Bacteria | 1777 |
| 252 | Ga0163161_10303652 | 3300017792 | Bacteria | 1258 |
| 253 | Ga0163161_10442413 | 3300017792 | Bacteria | 1049 |
| 254 | Ga0163161_11700544 | 3300017792 | Bacteria | 559 |
| 255 | Ga0163161_12089195 | 3300017792 | Bacteria | 504 |
| 256 | Ga0213871_10014349 | 3300021441 | Bacteria | 1877 |
| 257 | Ga0209148_1015258 | 3300025254 | Bacteria | 1344 |
| 258 | Ga0209758_1005984 | 3300025297 | Bacteria | 9007 |
| 259 | Ga0207682_10372930 | 3300025893 | Bacteria | 673 |
| 260 | Ga0207710_10112002 | 3300025900 | Bacteria | 1297 |
| 261 | Ga0207710_10179041 | 3300025900 | Bacteria | 1039 |
| 262 | Ga0207688_10136258 | 3300025901 | Bacteria | 1442 |
| 263 | Ga0207688_10220147 | 3300025901 | Bacteria | 1143 |
| 264 | Ga0207680_10160679 | 3300025903 | Bacteria | 1506 |
| 265 | Ga0207680_10566378 | 3300025903 | Bacteria | 811 |
| 266 | Ga0207645_10100720 | 3300025907 | Bacteria | 1863 |
| 267 | Ga0207643_10504244 | 3300025908 | Bacteria | 774 |
| 268 | Ga0207707_10053447 | 3300025912 | Bacteria | 3516 |
| 269 | Ga0207707_10249254 | 3300025912 | Bacteria | 1543 |
| 270 | Ga0207707_10450243 | 3300025912 | Bacteria | 1102 |
| 271 | Ga0207707_10679020 | 3300025912 | Bacteria | 866 |
| 272 | Ga0207671_11418492 | 3300025914 | Bacteria | 538 |
| 273 | Ga0207693_10526066 | 3300025915 | Bacteria | 923 |
| 274 | Ga0207693_10679009 | 3300025915 | Bacteria | 799 |
| 275 | Ga0207663_10531104 | 3300025916 | Bacteria | 917 |
| 276 | Ga0207660_10017344 | 3300025917 | Bacteria | 4783 |
| 277 | Ga0207660_10029807 | 3300025917 | Bacteria | 3747 |
| 278 | Ga0207660_10134958 | 3300025917 | Bacteria | 1882 |
| 279 | Ga0207662_10225699 | 3300025918 | Bacteria | 1221 |
| 280 | Ga0207649_10136724 | 3300025920 | Bacteria | 1672 |
| 281 | Ga0207649_10360425 | 3300025920 | Bacteria | 1079 |
| 282 | Ga0207652_10049994 | 3300025921 | Bacteria | 3581 |
| 283 | Ga0207652_10101478 | 3300025921 | Bacteria | 2542 |
| 284 | Ga0207652_10439951 | 3300025921 | Bacteria | 1175 |
| 285 | Ga0207652_11201518 | 3300025921 | Unclassified | 660 |
| 286 | Ga0207694_10252792 | 3300025924 | Bacteria | 1442 |
| 287 | Ga0207694_10339564 | 3300025924 | Bacteria | 1242 |
| 288 | Ga0207694_11355786 | 3300025924 | Bacteria | 601 |
| 289 | Ga0207650_10286400 | 3300025925 | Bacteria | 1343 |
| 290 | Ga0207650_11006663 | 3300025925 | Bacteria | 709 |
| 291 | Ga0207659_10901429 | 3300025926 | Bacteria | 760 |
| 292 | Ga0207659_11699709 | 3300025926 | Bacteria | 537 |
| 293 | Ga0207659_11762149 | 3300025926 | Bacteria | 527 |
| 294 | Ga0207687_10073554 | 3300025927 | Bacteria | 2447 |
| 295 | Ga0207700_10018587 | 3300025928 | Bacteria | 4676 |
| 296 | Ga0207664_10423502 | 3300025929 | Bacteria | 1186 |
| 297 | Ga0207664_10500595 | 3300025929 | Bacteria | 1088 |
| 298 | Ga0207644_10113061 | 3300025931 | Bacteria | 2056 |
| 299 | Ga0207644_10840177 | 3300025931 | Bacteria | 769 |
| 300 | Ga0207690_10838561 | 3300025932 | Bacteria | 761 |
| 301 | Ga0207706_10889590 | 3300025933 | Bacteria | 753 |
| 302 | Ga0207709_10184326 | 3300025935 | Bacteria | 1477 |
| 303 | Ga0207709_10263760 | 3300025935 | Bacteria | 1264 |
| 304 | Ga0207704_10175686 | 3300025938 | Bacteria | 1542 |
| 305 | Ga0207704_10862334 | 3300025938 | Bacteria | 760 |
| 306 | Ga0207665_10097547 | 3300025939 | Bacteria | 2046 |
| 307 | Ga0207665_10176706 | 3300025939 | Bacteria | 1544 |
| 308 | Ga0207691_10473402 | 3300025940 | Bacteria | 1065 |
| 309 | Ga0207691_10962012 | 3300025940 | Bacteria | 713 |
| 310 | Ga0207711_10047611 | 3300025941 | Bacteria | 3667 |
| 311 | Ga0207711_10443845 | 3300025941 | Bacteria | 1208 |
| 312 | Ga0207711_10835466 | 3300025941 | Bacteria | 857 |
| 313 | Ga0207689_10037068 | 3300025942 | Bacteria | 4046 |
| 314 | Ga0207689_10062358 | 3300025942 | Bacteria | 3066 |
| 315 | Ga0207689_11556656 | 3300025942 | Bacteria | 551 |
| 316 | Ga0207661_10512137 | 3300025944 | Bacteria | 1097 |
| 317 | Ga0207679_10063126 | 3300025945 | Bacteria | 2764 |
| 318 | Ga0207651_10416540 | 3300025960 | Bacteria | 1146 |
| 319 | Ga0207651_11108187 | 3300025960 | Bacteria | 710 |
| 320 | Ga0207668_10035874 | 3300025972 | Bacteria | 3306 |
| 321 | Ga0207668_10039748 | 3300025972 | Bacteria | 3169 |
| 322 | Ga0207668_10461337 | 3300025972 | Bacteria | 1086 |
| 323 | Ga0207668_10543037 | 3300025972 | Bacteria | 1006 |
| 324 | Ga0207668_10648666 | 3300025972 | Bacteria | 924 |
| 325 | Ga0207668_11353917 | 3300025972 | Bacteria | 641 |
| 326 | Ga0207640_10456117 | 3300025981 | Bacteria | 1055 |
| 327 | Ga0207677_10007318 | 3300026023 | Bacteria | 6096 |
| 328 | Ga0207677_10443411 | 3300026023 | Bacteria | 1111 |
| 329 | Ga0207677_10496358 | 3300026023 | Bacteria | 1054 |
| 330 | Ga0207677_11369830 | 3300026023 | Bacteria | 651 |
| 331 | Ga0207703_10190261 | 3300026035 | Bacteria | 1817 |
| 332 | Ga0207703_12109895 | 3300026035 | Bacteria | 540 |
| 333 | Ga0207639_10095084 | 3300026041 | Bacteria | 2394 |
| 334 | Ga0207639_10164148 | 3300026041 | Bacteria | 1875 |
| 335 | Ga0207678_10018506 | 3300026067 | Bacteria | 6118 |
| 336 | Ga0207678_10036446 | 3300026067 | Bacteria | 4281 |
| 337 | Ga0207678_10266009 | 3300026067 | Bacteria | 1470 |
| 338 | Ga0207678_10306141 | 3300026067 | Bacteria | 1366 |
| 339 | Ga0207678_10320693 | 3300026067 | Bacteria | 1333 |
| 340 | Ga0207678_10358339 | 3300026067 | Bacteria | 1258 |
| 341 | Ga0207678_10420561 | 3300026067 | Bacteria | 1159 |
| 342 | Ga0207678_10807307 | 3300026067 | Bacteria | 828 |
| 343 | Ga0207708_10221292 | 3300026075 | Bacteria | 1517 |
| 344 | Ga0207708_10639062 | 3300026075 | Bacteria | 905 |
| 345 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 346 | Ga0207702_10097706 | 3300026078 | Bacteria | 2585 |
| 347 | Ga0207702_10752686 | 3300026078 | Bacteria | 962 |
| 348 | Ga0207641_11169825 | 3300026088 | Bacteria | 768 |
| 349 | Ga0207641_12123235 | 3300026088 | Bacteria | 562 |
| 350 | Ga0207676_10742510 | 3300026095 | Bacteria | 954 |
| 351 | Ga0207676_10785932 | 3300026095 | Bacteria | 928 |
| 352 | Ga0207676_11601381 | 3300026095 | Bacteria | 649 |
| 353 | Ga0207674_11112171 | 3300026116 | Bacteria | 759 |
| 354 | Ga0207674_11263584 | 3300026116 | Bacteria | 708 |
| 355 | Ga0207675_100051489 | 3300026118 | Bacteria | 3842 |
| 356 | Ga0207675_100574536 | 3300026118 | Bacteria | 1128 |
| 357 | Ga0207675_101537961 | 3300026118 | Bacteria | 686 |
| 358 | Ga0207675_102235302 | 3300026118 | Bacteria | 562 |
| 359 | Ga0207683_10010329 | 3300026121 | Bacteria | 7963 |
| 360 | Ga0207683_10059461 | 3300026121 | Bacteria | 3357 |
| 361 | Ga0207683_10181418 | 3300026121 | Bacteria | 1909 |
| 362 | Ga0207698_10063522 | 3300026142 | Bacteria | 2890 |
| 363 | Ga0207698_10231745 | 3300026142 | Bacteria | 1677 |
| 364 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 365 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 366 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 367 | Ga0209813_10015793 | 3300027866 | Bacteria | 2052 |
| 368 | Ga0209813_10074050 | 3300027866 | Bacteria | 1113 |
| 369 | Ga0209813_10096138 | 3300027866 | Bacteria | 1001 |
| 370 | Ga0207428_10517963 | 3300027907 | Bacteria | 865 |
| 371 | Ga0268266_10004186 | 3300028379 | Bacteria | 13903 |
| 372 | Ga0268266_10035828 | 3300028379 | Bacteria | 4220 |
| 373 | Ga0268266_10297237 | 3300028379 | Bacteria | 1505 |
| 374 | Ga0268266_10587538 | 3300028379 | Bacteria | 1069 |
| 375 | Ga0268266_11408435 | 3300028379 | Bacteria | 673 |
| 376 | Ga0268266_11533360 | 3300028379 | Bacteria | 642 |
| 377 | Ga0268266_12022772 | 3300028379 | Bacteria | 549 |
| 378 | Ga0268265_10120393 | 3300028380 | Bacteria | 2161 |
| 379 | Ga0268265_10179152 | 3300028380 | Bacteria | 1819 |
| 380 | Ga0268265_10419214 | 3300028380 | Bacteria | 1242 |
| 381 | Ga0268264_10181165 | 3300028381 | Bacteria | 1913 |
| 382 | Ga0268264_11655039 | 3300028381 | Bacteria | 651 |
| 383 | Ga0268264_11661847 | 3300028381 | Bacteria | 649 |
| 384 | Ga0265334_10000205 | 3300028573 | Bacteria | 34229 |
| 385 | Ga0265334_10029025 | 3300028573 | Bacteria | 2218 |
| 386 | Ga0307517_10476983 | 3300028786 | Bacteria | 640 |
| 387 | Ga0307517_10649604 | 3300028786 | Bacteria | 513 |
| 388 | Ga0307515_10394839 | 3300028794 | Bacteria | 1011 |
| 389 | Ga0307515_10414896 | 3300028794 | Bacteria | 968 |
| 390 | Ga0307515_10462906 | 3300028794 | Bacteria | 882 |
| 391 | Ga0265328_10311026 | 3300031239 | Bacteria | 609 |
| 392 | Ga0265339_10101052 | 3300031249 | Bacteria | 1501 |
| 393 | Ga0265331_10097325 | 3300031250 | Bacteria | 1357 |
| 394 | Ga0265331_10099252 | 3300031250 | Bacteria | 1341 |
| 395 | Ga0265331_10156540 | 3300031250 | Bacteria | 1034 |
| 396 | Ga0265316_10102766 | 3300031344 | Bacteria | 2171 |
| 397 | Ga0307513_10378818 | 3300031456 | Bacteria | 1155 |
| 398 | Ga0307513_10454173 | 3300031456 | Bacteria | 1005 |
| 399 | Ga0307509_10267924 | 3300031507 | Bacteria | 1478 |
| 400 | Ga0307509_10498154 | 3300031507 | Unclassified | 903 |
| 401 | Ga0307509_10712027 | 3300031507 | Bacteria | 670 |
| 402 | Ga0307408_100373302 | 3300031548 | Bacteria | 1217 |
| 403 | Ga0307408_100441588 | 3300031548 | Bacteria | 1127 |
| 404 | Ga0307408_100660612 | 3300031548 | Bacteria | 936 |
| 405 | Ga0307408_101287966 | 3300031548 | Bacteria | 685 |
| 406 | Ga0265342_10093995 | 3300031712 | Bacteria | 1716 |
| 407 | Ga0307516_10169761 | 3300031730 | Bacteria | 1923 |
| 408 | Ga0307405_11322647 | 3300031731 | Bacteria | 628 |
| 409 | Ga0307413_10527820 | 3300031824 | Bacteria | 953 |
| 410 | Ga0307413_10801422 | 3300031824 | Bacteria | 792 |
| 411 | Ga0307413_12189339 | 3300031824 | Bacteria | 501 |
| 412 | Ga0307410_10197273 | 3300031852 | Bacteria | 1535 |
| 413 | Ga0307406_10319565 | 3300031901 | Bacteria | 1200 |
| 414 | Ga0307406_10432905 | 3300031901 | Bacteria | 1051 |
| 415 | Ga0307406_10684557 | 3300031901 | Bacteria | 855 |
| 416 | Ga0307406_12109741 | 3300031901 | Bacteria | 505 |
| 417 | Ga0307412_10384165 | 3300031911 | Bacteria | 1138 |
| 418 | Ga0307412_10447650 | 3300031911 | Bacteria | 1063 |
| 419 | Ga0307412_11152607 | 3300031911 | Bacteria | 692 |
| 420 | Ga0307409_100785057 | 3300031995 | Bacteria | 959 |
| 421 | Ga0307409_101248187 | 3300031995 | Bacteria | 767 |
| 422 | Ga0307409_101467526 | 3300031995 | Bacteria | 709 |
| 423 | Ga0307409_102051144 | 3300031995 | Bacteria | 602 |
| 424 | Ga0307416_100166359 | 3300032002 | Bacteria | 2046 |
| 425 | Ga0307416_100713180 | 3300032002 | Bacteria | 1093 |
| 426 | Ga0307416_101108066 | 3300032002 | Bacteria | 896 |
| 427 | Ga0307416_101785369 | 3300032002 | Bacteria | 719 |
| 428 | Ga0307416_102154646 | 3300032002 | Bacteria | 659 |
| 429 | Ga0307411_10614805 | 3300032005 | Bacteria | 936 |
| 430 | Ga0307411_11062251 | 3300032005 | Unclassified | 728 |
| 431 | Ga0307411_11086952 | 3300032005 | Bacteria | 720 |
| 432 | Ga0307411_11109766 | 3300032005 | Bacteria | 713 |
| 433 | Ga0307415_100839027 | 3300032126 | Bacteria | 842 |
| 434 | Ga0307507_10639363 | 3300033179 | Bacteria | 542 |
| 435 | Ga0307510_10019452 | 3300033180 | Bacteria | 7967 |
| 436 | Ga0307510_10283845 | 3300033180 | Bacteria | 1125 |
| 437 | Ga0373934_0194745 | 3300035086 | Bacteria | 834 |
| 438 | Ga0373936_0292374 | 3300035113 | Bacteria | 734 |
| 439 | Ga0373953_0173447 | 3300035117 | Bacteria | 929 |
| 440 | Ga0373953_0305569 | 3300035117 | Bacteria | 694 |
| 441 | Ga0373943_0019829 | 3300035170 | Bacteria | 3096 |
| 442 | Ga0373955_0302418 | 3300035172 | Bacteria | 965 |
| 443 | Ga0373955_0808675 | 3300035172 | Bacteria | 576 |
| 444 | Ga0373931_0702153 | 3300035691 | Bacteria | 668 |
| 445 | Ga0373927_0079443 | 3300035695 | Bacteria | 2125 |
| 446 | Ga0373927_0337047 | 3300035695 | Bacteria | 993 |
| 447 | Ga0373933_0002307 | 3300035724 | Bacteria | 10837 |
| 448 | Ga0373933_0305874 | 3300035724 | Bacteria | 1030 |
| 449 | Ga0373933_0510864 | 3300035724 | Bacteria | 787 |
| 450 | Ga0373947_0015251 | 3300035725 | Bacteria | 4412 |
| 451 | Ga0373947_0241823 | 3300035725 | Bacteria | 1191 |
| 452 | Ga0373947_0486484 | 3300035725 | Bacteria | 838 |
| 453 | Ga0373947_0976646 | 3300035725 | Bacteria | 578 |
| 454 | Ga0373925_0032743 | 3300037068 | Bacteria | 3827 |
| 455 | Ga0373925_0043457 | 3300037068 | Bacteria | 3335 |
| 456 | Ga0373925_0046639 | 3300037068 | Bacteria | 3223 |
| 457 | Ga0373925_0469041 | 3300037068 | Bacteria | 1032 |
| 458 | Ga0439465_0236626 | 3300041413 | Bacteria | 673 |
| 459 | Ga0451791_0739765 | 3300041451 | Bacteria | 745 |
| 460 | Ga0451795_1327697 | 3300041456 | Bacteria | 520 |
| 461 | Ga0451798_0676178 | 3300041458 | Bacteria | 833 |
| 462 | Ga0451802_1420511 | 3300041460 | Bacteria | 678 |
| 463 | Ga0451802_2110330 | 3300041460 | Bacteria | 710 |
| 464 | Ga0451807_1607596 | 3300041486 | Bacteria | 944 |
| 465 | Ga0451837_0166180 | 3300041494 | Bacteria | 943 |
| 466 | Ga0451853_2647951 | 3300041512 | Bacteria | 1802 |
| 467 | Ga0451853_2941052 | 3300041512 | Bacteria | 565 |
| 468 | Ga0439458_0017499 | 3300042157 | Bacteria | 1638 |
| 469 | Ga0466969_0451963 | 3300044656 | Bacteria | 585 |
| 470 | Ga0466972_0000177 | 3300044658 | Bacteria | 49318 |
| 471 | Ga0466965_0085702 | 3300044683 | Bacteria | 1597 |
| 472 | Ga0466971_0094190 | 3300044719 | Bacteria | 1373 |
| 473 | Ga0466970_0075288 | 3300044765 | Bacteria | 1818 |
| 474 | Ga0466958_0756378 | 3300045836 | Bacteria | 633 |
| 475 | Ga0495617_012261 | 3300046452 | Bacteria | 2920 |
| 476 | Ga0495603_0011257 | 3300046455 | Bacteria | 5419 |
| 477 | Ga0495603_0019146 | 3300046455 | Bacteria | 4144 |
| 478 | Ga0495603_0023274 | 3300046455 | Bacteria | 3751 |
| 479 | Ga0495603_0240898 | 3300046455 | Bacteria | 1042 |
| 480 | Ga0495629_0233421 | 3300046459 | Bacteria | 1268 |
| 481 | Ga0495638_0104161 | 3300046460 | Bacteria | 1692 |
| 482 | Ga0495641_0041267 | 3300046461 | Bacteria | 2144 |
| 483 | Ga0495641_0216531 | 3300046461 | Bacteria | 859 |
| 484 | Ga0495651_0087411 | 3300046462 | Bacteria | 2344 |
| 485 | Ga0495651_0515749 | 3300046462 | Bacteria | 763 |
| 486 | Ga0495653_0377238 | 3300046463 | Bacteria | 906 |
| 487 | Ga0495580_0406108 | 3300046472 | Bacteria | 918 |
| 488 | Ga0495582_0042207 | 3300046473 | Bacteria | 2513 |
| 489 | Ga0495582_0564199 | 3300046473 | Bacteria | 659 |
| 490 | Ga0495605_0024252 | 3300046474 | Bacteria | 3177 |
| 491 | Ga0495605_0143211 | 3300046474 | Bacteria | 1071 |
| 492 | Ga0495605_0157201 | 3300046474 | Bacteria | 1011 |
| 493 | Ga0495605_0209218 | 3300046474 | Bacteria | 847 |
| 494 | Ga0495605_0386999 | 3300046474 | Bacteria | 583 |
| 495 | Ga0495639_0149486 | 3300046475 | Bacteria | 1126 |
| 496 | Ga0495639_0203272 | 3300046475 | Bacteria | 970 |
| 497 | Ga0495639_0402648 | 3300046475 | Bacteria | 691 |
| 498 | Ga0495639_0657239 | 3300046475 | Bacteria | 540 |
| 499 | Ga0495664_0030300 | 3300046477 | Bacteria | 3168 |
| 500 | Ga0495664_0047566 | 3300046477 | Bacteria | 2546 |
| 501 | Ga0495664_0276709 | 3300046477 | Bacteria | 1014 |
| 502 | Ga0495664_0504460 | 3300046477 | Bacteria | 722 |
| 503 | Ga0495584_0095443 | 3300046491 | Bacteria | 1501 |
| 504 | Ga0495585_0110640 | 3300046492 | Bacteria | 1461 |
| 505 | Ga0495585_0169275 | 3300046492 | Bacteria | 1129 |
| 506 | Ga0495585_0310967 | 3300046492 | Bacteria | 772 |
| 507 | Ga0495594_0452954 | 3300046499 | Bacteria | 729 |
| 508 | Ga0495596_0037063 | 3300046500 | Bacteria | 1930 |
| 509 | Ga0495596_0151077 | 3300046500 | Bacteria | 902 |
| 510 | Ga0495596_0161249 | 3300046500 | Bacteria | 871 |
| 511 | Ga0495596_0201027 | 3300046500 | Bacteria | 774 |
| 512 | Ga0495607_0217623 | 3300046501 | Bacteria | 936 |
| 513 | Ga0495607_0361142 | 3300046501 | Bacteria | 668 |
| 514 | Ga0495607_0434386 | 3300046501 | Bacteria | 592 |
| 515 | Ga0495606_0001686 | 3300046507 | Bacteria | 28531 |
| 516 | Ga0495606_0012396 | 3300046507 | Bacteria | 6839 |
| 517 | Ga0495608_0279694 | 3300046511 | Bacteria | 1036 |
| 518 | Ga0495608_0631357 | 3300046511 | Bacteria | 641 |
| 519 | Ga0495610_0123246 | 3300046512 | Bacteria | 1133 |
| 520 | Ga0495616_0146426 | 3300046513 | Bacteria | 1071 |
| 521 | Ga0495616_0180963 | 3300046513 | Bacteria | 937 |
| 522 | Ga0495616_0242355 | 3300046513 | Bacteria | 777 |
| 523 | Ga0495620_0055003 | 3300046515 | Bacteria | 1679 |
| 524 | Ga0495620_0074829 | 3300046515 | Bacteria | 1379 |
| 525 | Ga0495620_0080394 | 3300046515 | Bacteria | 1319 |
| 526 | Ga0495628_0442221 | 3300046516 | Bacteria | 945 |
| 527 | Ga0495630_0059712 | 3300046517 | Bacteria | 2861 |
| 528 | Ga0495631_0033505 | 3300046518 | Bacteria | 2307 |
| 529 | Ga0495632_0147623 | 3300046519 | Bacteria | 1088 |
| 530 | Ga0495632_0203522 | 3300046519 | Bacteria | 900 |
| 531 | Ga0495632_0330836 | 3300046519 | Bacteria | 672 |
| 532 | Ga0495643_0028158 | 3300046522 | Bacteria | 3153 |
| 533 | Ga0495643_0244119 | 3300046522 | Bacteria | 841 |
| 534 | Ga0495644_0322078 | 3300046523 | Bacteria | 606 |
| 535 | Ga0495648_0017419 | 3300046524 | Bacteria | 5134 |
| 536 | Ga0495663_0100245 | 3300046525 | Bacteria | 953 |
| 537 | Ga0495666_0173837 | 3300046526 | Bacteria | 996 |
| 538 | Ga0495666_0392120 | 3300046526 | Bacteria | 624 |
| 539 | Ga0495642_0114043 | 3300046528 | Bacteria | 1157 |
| 540 | Ga0495642_0245848 | 3300046528 | Bacteria | 782 |
| 541 | Ga0495652_0130491 | 3300046529 | Bacteria | 1990 |
| 542 | Ga0495654_0096274 | 3300046530 | Bacteria | 1368 |
| 543 | Ga0495665_0232244 | 3300046531 | Bacteria | 952 |
| 544 | Ga0495586_0365121 | 3300046535 | Bacteria | 830 |
| 545 | Ga0495587_0262029 | 3300046536 | Bacteria | 971 |
| 546 | Ga0495587_0512512 | 3300046536 | Bacteria | 663 |
| 547 | Ga0495587_0513338 | 3300046536 | Bacteria | 662 |
| 548 | Ga0495609_0067233 | 3300046538 | Bacteria | 1578 |
| 549 | Ga0495609_0124057 | 3300046538 | Bacteria | 1109 |
| 550 | Ga0495609_0159166 | 3300046538 | Bacteria | 958 |
| 551 | Ga0495597_0171117 | 3300046542 | Bacteria | 882 |
| 552 | Ga0495645_0123813 | 3300046543 | Bacteria | 1818 |
| 553 | Ga0495622_0029989 | 3300046557 | Bacteria | 2541 |
| 554 | Ga0495622_0123645 | 3300046557 | Bacteria | 1181 |
| 555 | Ga0495633_0229205 | 3300046558 | Bacteria | 849 |
| 556 | Ga0495633_0281271 | 3300046558 | Bacteria | 757 |
| 557 | Ga0495656_0004583 | 3300046615 | Bacteria | 4743 |
| 558 | Ga0495656_0156674 | 3300046615 | Bacteria | 1104 |
| 559 | Ga0495656_0357593 | 3300046615 | Bacteria | 758 |
| 560 | Ga0495668_0088884 | 3300046616 | Bacteria | 1693 |
| 561 | Ga0495668_0145069 | 3300046616 | Bacteria | 1299 |
| 562 | Ga0495668_0215498 | 3300046616 | Bacteria | 1051 |
| 563 | Ga0495668_0263938 | 3300046616 | Bacteria | 943 |
| 564 | Ga0495668_0311914 | 3300046616 | Bacteria | 862 |
| 565 | Ga0495668_0653876 | 3300046616 | Bacteria | 581 |
| 566 | Ga0495634_0775245 | 3300046642 | Bacteria | 548 |
| 567 | Ga0495611_0198249 | 3300046648 | Bacteria | 937 |
| 568 | Ga0495611_0204938 | 3300046648 | Bacteria | 919 |
| 569 | Ga0495625_0025297 | 3300046660 | Bacteria | 4503 |
| 570 | Ga0495625_0262166 | 3300046660 | Bacteria | 1118 |
| 571 | Ga0495625_0725939 | 3300046660 | Bacteria | 584 |
| 572 | Ga0495635_0400549 | 3300046663 | Bacteria | 912 |
| 573 | Ga0495659_0019280 | 3300046664 | Bacteria | 2282 |
| 574 | Ga0495588_0106822 | 3300046674 | Bacteria | 1473 |
| 575 | Ga0495588_0212477 | 3300046674 | Bacteria | 1021 |
| 576 | Ga0495588_0751840 | 3300046674 | Bacteria | 510 |
| 577 | Ga0495657_0166924 | 3300046675 | Bacteria | 1358 |
| 578 | Ga0495623_0253437 | 3300046679 | Unclassified | 989 |
| 579 | Ga0495623_0563545 | 3300046679 | Bacteria | 595 |
| 580 | Ga0495646_0056633 | 3300046680 | Bacteria | 2350 |
| 581 | Ga0495646_0216003 | 3300046680 | Unclassified | 1039 |
| 582 | Ga0495647_0064510 | 3300046681 | Bacteria | 1452 |
| 583 | Ga0495647_0149228 | 3300046681 | Bacteria | 1001 |
| 584 | Ga0495658_0250475 | 3300046683 | Bacteria | 1114 |
| 585 | Ga0495669_0045936 | 3300046684 | Bacteria | 1948 |
| 586 | Ga0495669_0056763 | 3300046684 | Bacteria | 1765 |
| 587 | Ga0495613_0095338 | 3300046689 | Bacteria | 2152 |
| 588 | Ga0495613_0613575 | 3300046689 | Bacteria | 723 |
| 589 | Ga0495624_0883485 | 3300046690 | Bacteria | 526 |
| 590 | Ga0495670_0434409 | 3300046691 | Bacteria | 711 |
| 591 | Ga0495670_0771924 | 3300046691 | Bacteria | 524 |
| 592 | Ga0495671_0164094 | 3300046692 | Bacteria | 1080 |
| 593 | Ga0495671_0226763 | 3300046692 | Bacteria | 904 |
| 594 | Ga0495671_0613348 | 3300046692 | Bacteria | 517 |
| 595 | Ga0495671_0622873 | 3300046692 | Bacteria | 513 |
| 596 | Ga0495649_0012812 | 3300046694 | Bacteria | 4862 |
| 597 | Ga0495649_0234754 | 3300046694 | Bacteria | 946 |
| 598 | Ga0495649_0565932 | 3300046694 | Bacteria | 562 |
| 599 | Ga0495589_0264624 | 3300046794 | Bacteria | 801 |
| 600 | Ga0495600_0064005 | 3300046809 | Bacteria | 2404 |
| 601 | Ga0495581_0253907 | 3300047315 | Bacteria | 1028 |
| 602 | Ga0495581_0810433 | 3300047315 | Bacteria | 537 |
| 603 | Ga0495604_0098924 | 3300047317 | Bacteria | 2148 |
| 604 | Ga0495604_0664575 | 3300047317 | Bacteria | 664 |
| 605 | Ga0495636_0057273 | 3300047318 | Bacteria | 1641 |
| 606 | Ga0495674_0201039 | 3300047319 | Unclassified | 1653 |
| 607 | Ga0495674_0969987 | 3300047319 | Bacteria | 653 |
| 608 | Ga0495672_0361314 | 3300047320 | Bacteria | 672 |
| 609 | Ga0495676_0057771 | 3300047321 | Bacteria | 3057 |
| 610 | Ga0495676_0080205 | 3300047321 | Bacteria | 2479 |
| 611 | Ga0495680_0305732 | 3300047322 | Unclassified | 1115 |
| 612 | Ga0495680_0352494 | 3300047322 | Bacteria | 1024 |
| 613 | Ga0495680_0462734 | 3300047322 | Bacteria | 866 |
| 614 | Ga0495683_0073082 | 3300047323 | Bacteria | 1682 |
| 615 | Ga0495673_0114584 | 3300047469 | Bacteria | 1074 |
| 616 | Ga0495681_0398881 | 3300047470 | Bacteria | 514 |
| 617 | Ga0495686_0083225 | 3300047472 | Bacteria | 1952 |
| 618 | Ga0495686_0190739 | 3300047472 | Bacteria | 1182 |
| 619 | Ga0495593_0352235 | 3300047673 | Bacteria | 736 |
| 620 | Ga0495602_0412852 | 3300048088 | Bacteria | 960 |
| 621 | Ga0495602_0528650 | 3300048088 | Bacteria | 820 |
| 622 | Ga0495614_0217491 | 3300048089 | Bacteria | 868 |
| 623 | Ga0495626_0090888 | 3300048091 | Bacteria | 1342 |
| 624 | Ga0496100_0003516 | 3300048903 | Bacteria | 8181 |
| 625 | Ga0496101_0395874 | 3300048904 | Bacteria | 1087 |
| 626 | Ga0496101_1573828 | 3300048904 | Bacteria | 511 |
| 627 | Ga0496102_0034702 | 3300048905 | Bacteria | 4538 |
| 628 | Ga0496102_0687740 | 3300048905 | Bacteria | 946 |
| 629 | Ga0496103_0270108 | 3300048906 | Bacteria | 1094 |
| 630 | Ga0496104_0110050 | 3300048907 | Bacteria | 2640 |
| 631 | Ga0496105_0026046 | 3300048908 | Bacteria | 4766 |
| 632 | Ga0496105_0136808 | 3300048908 | Bacteria | 2018 |
| 633 | Ga0496106_0242054 | 3300048909 | Bacteria | 1441 |
| 634 | Ga0496106_0726011 | 3300048909 | Bacteria | 791 |
| 635 | Ga0496106_1127001 | 3300048909 | Bacteria | 614 |
| 636 | Ga0496107_0002052 | 3300048910 | Bacteria | 12878 |
| 637 | Ga0496108_0385077 | 3300048911 | Bacteria | 1224 |
| 638 | Ga0496108_0573947 | 3300048911 | Bacteria | 983 |
| 639 | Ga0496109_0081672 | 3300048912 | Bacteria | 2978 |
| 640 | Ga0496109_0570835 | 3300048912 | Bacteria | 1066 |
| 641 | Ga0496110_1307425 | 3300048913 | Bacteria | 634 |
| 642 | Ga0496111_0021303 | 3300048914 | Bacteria | 4524 |
| 643 | Ga0496111_1201082 | 3300048914 | Bacteria | 537 |
| 644 | Ga0496112_0118824 | 3300048915 | Bacteria | 2613 |
| 645 | Ga0496112_0655210 | 3300048915 | Bacteria | 979 |
| 646 | Ga0496112_1153082 | 3300048915 | Bacteria | 692 |
| 647 | Ga0496112_1731025 | 3300048915 | Bacteria | 537 |
| 648 | Ga0496113_0042472 | 3300048916 | Bacteria | 3360 |
| 649 | Ga0496113_1425773 | 3300048916 | Bacteria | 536 |
| 650 | Ga0496114_0040999 | 3300048917 | Bacteria | 3836 |
| 651 | Ga0496115_0010980 | 3300048918 | Bacteria | 6781 |
| 652 | Ga0496115_0046849 | 3300048918 | Bacteria | 3457 |
| 653 | Ga0496118_0236045 | 3300048921 | Bacteria | 1051 |
| 654 | Ga0496121_0044798 | 3300048924 | Bacteria | 3810 |
| 655 | Ga0496121_0082049 | 3300048924 | Bacteria | 2550 |
| 656 | Ga0496121_0119094 | 3300048924 | Bacteria | 1997 |
| 657 | Ga0496121_0158250 | 3300048924 | Bacteria | 1659 |
| 658 | Ga0496121_0507192 | 3300048924 | Bacteria | 764 |
| 659 | Ga0496124_0124232 | 3300048927 | Bacteria | 2058 |
| 660 | Ga0496124_0334023 | 3300048927 | Bacteria | 1079 |
| 661 | Ga0496124_0990925 | 3300048927 | Bacteria | 502 |
| 662 | Ga0496125_0173573 | 3300048928 | Bacteria | 1446 |
| 663 | Ga0496125_0176361 | 3300048928 | Bacteria | 1429 |
| 664 | Ga0496125_0312501 | 3300048928 | Bacteria | 957 |
| 665 | Ga0496125_0533178 | 3300048928 | Bacteria | 654 |
| 666 | Ga0496126_0048723 | 3300048929 | Bacteria | 3870 |
| 667 | Ga0496126_0175444 | 3300048929 | Bacteria | 1823 |
| 668 | Ga0496126_0197410 | 3300048929 | Bacteria | 1701 |
| 669 | Ga0496126_0275698 | 3300048929 | Bacteria | 1394 |
| 670 | Ga0496126_0318743 | 3300048929 | Bacteria | 1278 |
| 671 | Ga0495678_184566 | 3300049459 | Bacteria | 652 |
| 672 | Ga0495682_0005291 | 3300049460 | Bacteria | 5384 |
| 673 | Ga0501036_0602749 | 3300049572 | Bacteria | 911 |
| 674 | Ga0501039_0158956 | 3300049575 | Bacteria | 1776 |
| 675 | Ga0501040_1141820 | 3300049576 | Unclassified | 565 |
| 676 | Ga0501042_0158314 | 3300049578 | Bacteria | 1634 |
| 677 | Ga0501067_0219605 | 3300049583 | Bacteria | 1058 |
| 678 | Ga0501068_0838553 | 3300049584 | Bacteria | 604 |
| 679 | Ga0501070_1295502 | 3300049586 | Bacteria | 556 |
| 680 | Ga0501071_0171754 | 3300049587 | Bacteria | 1623 |
| 681 | Ga0501074_0787649 | 3300049590 | Bacteria | 670 |
| 682 | Ga0501235_188837 | 3300049669 | Bacteria | 553 |
| 683 | nmdc:mga03683_138655_c1 | 3300050489 | Bacteria | 1092 |
| 684 | nmdc:mga03683_619723_c1 | 3300050489 | Bacteria | 531 |
| 685 | nmdc:mga03n38_1510_c1 | 3300050490 | Bacteria | 6717 |
| 686 | nmdc:mga00v17_202351_c1 | 3300050491 | Bacteria | 1284 |
| 687 | nmdc:mga00v17_367578_c1 | 3300050491 | Bacteria | 935 |
| 688 | nmdc:mga00v17_693401_c1 | 3300050491 | Bacteria | 653 |
| 689 | nmdc:mga0yw44_1027711_c1 | 3300050492 | Bacteria | 558 |
| 690 | nmdc:mga0yw44_183758_c1 | 3300050492 | Bacteria | 1377 |
| 691 | nmdc:mga0k408_145062_c1 | 3300050493 | Bacteria | 1413 |
| 692 | nmdc:mga0k408_210367_c1 | 3300050493 | Bacteria | 1161 |
| 693 | nmdc:mga0k408_477043_c1 | 3300050493 | Bacteria | 740 |
| 694 | nmdc:mga0k408_668833_c1 | 3300050493 | Bacteria | 610 |
| 695 | nmdc:mga0k408_839441_c1 | 3300050493 | Bacteria | 534 |
| 696 | nmdc:mga06z11_180854_c1 | 3300050494 | Bacteria | 1216 |
| 697 | nmdc:mga06z11_283960_c1 | 3300050494 | Bacteria | 981 |
| 698 | nmdc:mga06z11_427832_c1 | 3300050494 | Bacteria | 798 |
| 699 | nmdc:mga06z11_9242_c1 | 3300050494 | Bacteria | 4146 |
| 700 | nmdc:mga04h51_114061_c1 | 3300050495 | Bacteria | 1000 |
| 701 | nmdc:mga04h51_87977_c1 | 3300050495 | Bacteria | 1113 |
| 702 | nmdc:mga07m45_1327_c4 | 3300050496 | Bacteria | 2702 |
| 703 | nmdc:mga07m45_412518_c1 | 3300050496 | Bacteria | 784 |
| 704 | nmdc:mga07m45_597371_c1 | 3300050496 | Bacteria | 637 |
| 705 | nmdc:mga05p37_239403_c1 | 3300050507 | Bacteria | 2183 |
| 706 | nmdc:mga0qj67_338939_c1 | 3300050509 | Bacteria | 1216 |
| 707 | nmdc:mga08y16_382743_c1 | 3300050511 | Bacteria | 1442 |
| 708 | nmdc:mga0n895_10129_c1 | 3300050512 | Bacteria | 8297 |
| 709 | nmdc:mga0rr50_78609_c1 | 3300050513 | Bacteria | 2539 |
| 710 | nmdc:mga0sz30_219186_c1 | 3300050516 | Bacteria | 846 |
| 711 | nmdc:mga0sz30_59309_c1 | 3300050516 | Bacteria | 1633 |
| 712 | Ga0495655_0046779 | 3300053083 | Bacteria | 1129 |
| 713 | Ga0500578_0190582 | 3300053086 | Bacteria | 1259 |
| 714 | Ga0500647_0136259 | 3300053091 | Bacteria | 1155 |
| 715 | Ga0500583_0388232 | 3300053092 | Bacteria | 671 |
| 716 | Ga0500651_0040927 | 3300053093 | Bacteria | 2920 |
| 717 | Ga0500651_0116823 | 3300053093 | Bacteria | 1623 |
| 718 | Ga0500641_0231654 | 3300053096 | Bacteria | 780 |
| 719 | Ga0500555_059939 | 3300053103 | Bacteria | 1026 |
| 720 | Ga0500558_281906 | 3300053106 | Bacteria | 528 |
| 721 | Ga0500569_027872 | 3300053109 | Bacteria | 1561 |
| 722 | Ga0500595_004847 | 3300053119 | Bacteria | 5952 |
| 723 | Ga0500608_331117 | 3300053122 | Bacteria | 549 |
| 724 | Ga0500642_0068424 | 3300053130 | Bacteria | 1611 |
| 725 | Ga0500658_0056611 | 3300053134 | Bacteria | 1618 |
| 726 | Ga0500658_0230499 | 3300053134 | Bacteria | 850 |
| 727 | Ga0500658_0498743 | 3300053134 | Bacteria | 551 |
| 728 | Ga0500559_0302836 | 3300053136 | Bacteria | 750 |
| 729 | Ga0500577_0133880 | 3300053142 | Bacteria | 1041 |
| 730 | Ga0500586_004396 | 3300053145 | Bacteria | 3443 |
| 731 | Ga0500590_153334 | 3300053148 | Bacteria | 1036 |
| 732 | Ga0500604_0130673 | 3300053151 | Bacteria | 844 |
| 733 | Ga0500604_0143688 | 3300053151 | Bacteria | 808 |
| 734 | Ga0500622_0315320 | 3300053156 | Bacteria | 661 |
| 735 | Ga0500627_0411914 | 3300053158 | Bacteria | 574 |
| 736 | Ga0500633_0379459 | 3300053160 | Bacteria | 512 |
| 737 | Ga0500638_311554 | 3300053162 | Bacteria | 602 |
| 738 | Ga0500636_0526123 | 3300053177 | Bacteria | 517 |
| 739 | Ga0500637_0501835 | 3300053178 | Bacteria | 601 |
| 740 | Ga0500645_205433 | 3300053730 | Bacteria | 530 |
| 741 | Ga0500609_021098 | 3300053731 | Bacteria | 889 |
| 742 | Ga0500656_062964 | 3300053732 | Bacteria | 559 |
| 743 | Ga0466962_0284218 | 3300061719 | Bacteria | 817 |
| 744 | Ga0530510_0992105 | 3300061734 | Bacteria | 643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10046694 | Ga0105248_100466944 | 85 |
| 2 | 3300009545 | Ga0105237_12787494 | Ga0105237_127874942 | 85 |
| 3 | 3300013296 | Ga0157374_11728134 | Ga0157374_117281342 | 85 |
| 4 | 3300013306 | Ga0163162_13005952 | Ga0163162_130059522 | 85 |
| 5 | 3300013308 | Ga0157375_11374626 | Ga0157375_113746262 | 85 |
| 6 | 3300014325 | Ga0163163_10017597 | Ga0163163_100175978 | 85 |
| 7 | 3300014968 | Ga0157379_10041641 | Ga0157379_100416414 | 85 |
| 8 | 3300044656 | Ga0466969_0451963 | Ga0466969_0451963_199_462 | 86 |
| 9 | 3300044719 | Ga0466971_0094190 | Ga0466971_0094190_885_1148 | 86 |
| 10 | 3300045836 | Ga0466958_0756378 | Ga0466958_0756378_191_454 | 86 |
| 11 | 3300061719 | Ga0466962_0284218 | Ga0466962_0284218_283_546 | 86 |
| 12 | 3300005458 | Ga0070681_10075720 | Ga0070681_100757201 | 88 |
| 13 | 3300009545 | Ga0105237_10303264 | Ga0105237_103032642 | 88 |
| 14 | 3300031507 | Ga0307509_10267924 | Ga0307509_102679242 | 88 |
| 15 | 3300035172 | Ga0373955_0808675 | Ga0373955_0808675_93_362 | 88 |
| 16 | 3300035724 | Ga0373933_0510864 | Ga0373933_0510864_454_723 | 88 |
| 17 | 3300035725 | Ga0373947_0976646 | Ga0373947_0976646_87_356 | 88 |
| 18 | 3300046462 | Ga0495651_0087411 | Ga0495651_0087411_1213_1482 | 88 |
| 19 | 3300046463 | Ga0495653_0377238 | Ga0495653_0377238_475_744 | 88 |
| 20 | 3300046477 | Ga0495664_0047566 | Ga0495664_0047566_14_283 | 88 |
| 21 | 3300046477 | Ga0495664_0276709 | Ga0495664_0276709_710_979 | 88 |
| 22 | 3300046477 | Ga0495664_0504460 | Ga0495664_0504460_165_434 | 88 |
| 23 | 3300046511 | Ga0495608_0631357 | Ga0495608_0631357_70_339 | 88 |
| 24 | 3300046516 | Ga0495628_0442221 | Ga0495628_0442221_108_377 | 88 |
| 25 | 3300046526 | Ga0495666_0173837 | Ga0495666_0173837_625_900 | 88 |
| 26 | 3300046529 | Ga0495652_0130491 | Ga0495652_0130491_1289_1558 | 88 |
| 27 | 3300046535 | Ga0495586_0365121 | Ga0495586_0365121_291_560 | 88 |
| 28 | 3300046536 | Ga0495587_0262029 | Ga0495587_0262029_343_612 | 88 |
| 29 | 3300046536 | Ga0495587_0513338 | Ga0495587_0513338_78_347 | 88 |
| 30 | 3300046675 | Ga0495657_0166924 | Ga0495657_0166924_935_1204 | 88 |
| 31 | 3300046679 | Ga0495623_0253437 | Ga0495623_0253437_580_849 | 88 |
| 32 | 3300046680 | Ga0495646_0056633 | Ga0495646_0056633_1763_2032 | 88 |
| 33 | 3300046680 | Ga0495646_0216003 | Ga0495646_0216003_184_453 | 88 |
| 34 | 3300046689 | Ga0495613_0613575 | Ga0495613_0613575_179_460 | 88 |
| 35 | 3300047317 | Ga0495604_0098924 | Ga0495604_0098924_53_334 | 88 |
| 36 | 3300047319 | Ga0495674_0201039 | Ga0495674_0201039_569_838 | 88 |
| 37 | 3300047322 | Ga0495680_0305732 | Ga0495680_0305732_266_535 | 88 |
| 38 | 3300047322 | Ga0495680_0352494 | Ga0495680_0352494_520_789 | 88 |
| 39 | 3300048088 | Ga0495602_0412852 | Ga0495602_0412852_193_462 | 88 |
| 40 | 3300048088 | Ga0495602_0528650 | Ga0495602_0528650_500_769 | 88 |
| 41 | 3300049576 | Ga0501040_1141820 | Ga0501040_1141820_13_294 | 88 |
| 42 | 3300053134 | Ga0500658_0498743 | Ga0500658_0498743_133_408 | 88 |
| 43 | 3300053732 | Ga0500656_062964 | Ga0500656_062964_73_348 | 88 |
| 44 | 3300013104 | Ga0157370_11874399 | Ga0157370_118743992 | 91 |
| 45 | 3300049572 | Ga0501036_0602749 | Ga0501036_0602749_457_777 | 98 |
| 46 | 3300049575 | Ga0501039_0158956 | Ga0501039_0158956_661_981 | 98 |
| 47 | 3300044658 | Ga0466972_0000177 | Ga0466972_0000177_8152_8514 | 101 |
| 48 | 3300044683 | Ga0466965_0085702 | Ga0466965_0085702_550_912 | 101 |
| 49 | 3300005530 | Ga0070679_101345524 | Ga0070679_1013455241 | 102 |
| 50 | 3300014325 | Ga0163163_11110114 | Ga0163163_111101142 | 102 |
| 51 | 3300025921 | Ga0207652_11201518 | Ga0207652_112015181 | 102 |
| 52 | iso_pu_bacteria | 2513237104 | 2513716809 | 102 |
| 53 | iso_pu_bacteria | 2513237161 | 2514009976 | 102 |
| 54 | iso_pu_bacteria | 2617270735 | 2617354163 | 102 |
| 55 | iso_pu_bacteria | 2824671348 | 2824679441 | 102 |
| 56 | iso_pu_bacteria | 2824687955 | 2824696050 | 102 |
| 57 | iso_pu_bacteria | 2841966195 | 2841970814 | 102 |
| 58 | iso_pu_bacteria | 2841974524 | 2841977927 | 102 |
| 59 | iso_pu_bacteria | 2935675223 | 2935684084 | 102 |
| 60 | iso_pu_bacteria | 3005594810 | 3005601697 | 102 |
| 61 | iso_pu_bacteria | 3005718088 | 3005724378 | 102 |
| 62 | 3300005327 | Ga0070658_10630521 | Ga0070658_106305212 | 103 |
| 63 | 3300005329 | Ga0070683_100325152 | Ga0070683_1003251522 | 103 |
| 64 | 3300005435 | Ga0070714_102389867 | Ga0070714_1023898671 | 103 |
| 65 | 3300005455 | Ga0070663_100029162 | Ga0070663_1000291624 | 103 |
| 66 | 3300005539 | Ga0068853_102186166 | Ga0068853_1021861662 | 103 |
| 67 | 3300005842 | Ga0068858_100124003 | Ga0068858_1001240032 | 103 |
| 68 | 3300005843 | Ga0068860_100900227 | Ga0068860_1009002272 | 103 |
| 69 | 3300006175 | Ga0070712_101856912 | Ga0070712_1018569121 | 103 |
| 70 | 3300006914 | Ga0075436_100265403 | Ga0075436_1002654031 | 103 |
| 71 | 3300013105 | Ga0157369_10705902 | Ga0157369_107059022 | 103 |
| 72 | 3300025914 | Ga0207671_11418492 | Ga0207671_114184921 | 103 |
| 73 | 3300025920 | Ga0207649_10360425 | Ga0207649_103604251 | 103 |
| 74 | 3300025926 | Ga0207659_11762149 | Ga0207659_117621491 | 103 |
| 75 | 3300025929 | Ga0207664_10500595 | Ga0207664_105005952 | 103 |
| 76 | 3300025941 | Ga0207711_10047611 | Ga0207711_100476115 | 103 |
| 77 | 3300025944 | Ga0207661_10512137 | Ga0207661_105121372 | 103 |
| 78 | 3300026035 | Ga0207703_10190261 | Ga0207703_101902613 | 103 |
| 79 | 3300026067 | Ga0207678_10018506 | Ga0207678_100185064 | 103 |
| 80 | 3300026116 | Ga0207674_11112171 | Ga0207674_111121712 | 103 |
| 81 | 3300028381 | Ga0268264_11661847 | Ga0268264_116618471 | 103 |
| 82 | 3300031250 | Ga0265331_10156540 | Ga0265331_101565403 | 103 |
| 83 | 3300035117 | Ga0373953_0305569 | Ga0373953_0305569_366_677 | 103 |
| 84 | 3300037068 | Ga0373925_0043457 | Ga0373925_0043457_784_1095 | 103 |
| 85 | 3300046473 | Ga0495582_0042207 | Ga0495582_0042207_772_1083 | 103 |
| 86 | 3300046477 | Ga0495664_0030300 | Ga0495664_0030300_14_325 | 103 |
| 87 | 3300046511 | Ga0495608_0279694 | Ga0495608_0279694_641_952 | 103 |
| 88 | 3300046517 | Ga0495630_0059712 | Ga0495630_0059712_2526_2837 | 103 |
| 89 | 3300046543 | Ga0495645_0123813 | Ga0495645_0123813_861_1172 | 103 |
| 90 | 3300046681 | Ga0495647_0064510 | Ga0495647_0064510_692_1003 | 103 |
| 91 | 3300046689 | Ga0495613_0095338 | Ga0495613_0095338_26_337 | 103 |
| 92 | 3300005539 | Ga0068853_100681028 | Ga0068853_1006810282 | 104 |
| 93 | 3300005842 | Ga0068858_101250578 | Ga0068858_1012505782 | 104 |
| 94 | 3300006177 | Ga0075362_10243844 | Ga0075362_102438441 | 104 |
| 95 | 3300006844 | Ga0075428_101806788 | Ga0075428_1018067881 | 104 |
| 96 | 3300006846 | Ga0075430_100178283 | Ga0075430_1001782832 | 104 |
| 97 | 3300007265 | Ga0099794_10035033 | Ga0099794_100350332 | 104 |
| 98 | 3300009093 | Ga0105240_10368125 | Ga0105240_103681253 | 104 |
| 99 | 3300009098 | Ga0105245_10012692 | Ga0105245_100126927 | 104 |
| 100 | 3300009177 | Ga0105248_10461340 | Ga0105248_104613403 | 104 |
| 101 | 3300009177 | Ga0105248_11066290 | Ga0105248_110662902 | 104 |
| 102 | 3300009551 | Ga0105238_10078299 | Ga0105238_100782993 | 104 |
| 103 | 3300010159 | Ga0099796_10062676 | Ga0099796_100626761 | 104 |
| 104 | 3300010375 | Ga0105239_10097211 | Ga0105239_100972113 | 104 |
| 105 | 3300010375 | Ga0105239_12035665 | Ga0105239_120356652 | 104 |
| 106 | 3300013105 | Ga0157369_10389029 | Ga0157369_103890293 | 104 |
| 107 | 3300013296 | Ga0157374_10113473 | Ga0157374_101134732 | 104 |
| 108 | 3300013297 | Ga0157378_10255636 | Ga0157378_102556361 | 104 |
| 109 | 3300013306 | Ga0163162_10047620 | Ga0163162_100476204 | 104 |
| 110 | 3300013306 | Ga0163162_11038665 | Ga0163162_110386652 | 104 |
| 111 | 3300013306 | Ga0163162_12915089 | Ga0163162_129150892 | 104 |
| 112 | 3300013308 | Ga0157375_10013598 | Ga0157375_100135988 | 104 |
| 113 | 3300014325 | Ga0163163_11822697 | Ga0163163_118226972 | 104 |
| 114 | 3300014497 | Ga0182008_10153885 | Ga0182008_101538852 | 104 |
| 115 | 3300014745 | Ga0157377_10050988 | Ga0157377_100509882 | 104 |
| 116 | 3300014969 | Ga0157376_10215020 | Ga0157376_102150203 | 104 |
| 117 | 3300025924 | Ga0207694_10252792 | Ga0207694_102527923 | 104 |
| 118 | 3300025941 | Ga0207711_10835466 | Ga0207711_108354661 | 104 |
| 119 | 3300031249 | Ga0265339_10101052 | Ga0265339_101010522 | 104 |
| 120 | 3300032005 | Ga0307411_10614805 | Ga0307411_106148052 | 104 |
| 121 | 3300035086 | Ga0373934_0194745 | Ga0373934_0194745_119_457 | 104 |
| 122 | 3300035117 | Ga0373953_0173447 | Ga0373953_0173447_325_663 | 104 |
| 123 | 3300035170 | Ga0373943_0019829 | Ga0373943_0019829_1140_1463 | 104 |
| 124 | 3300035695 | Ga0373927_0337047 | Ga0373927_0337047_316_639 | 104 |
| 125 | 3300035724 | Ga0373933_0305874 | Ga0373933_0305874_181_519 | 104 |
| 126 | 3300035725 | Ga0373947_0015251 | Ga0373947_0015251_3809_4132 | 104 |
| 127 | 3300037068 | Ga0373925_0032743 | Ga0373925_0032743_1056_1376 | 104 |
| 128 | 3300037068 | Ga0373925_0046639 | Ga0373925_0046639_2602_2925 | 104 |
| 129 | 3300041456 | Ga0451795_1327697 | Ga0451795_1327697_62_382 | 104 |
| 130 | 3300041512 | Ga0451853_2647951 | Ga0451853_2647951_500_820 | 104 |
| 131 | 3300041512 | Ga0451853_2941052 | Ga0451853_2941052_11_331 | 104 |
| 132 | 3300046455 | Ga0495603_0011257 | Ga0495603_0011257_4528_4851 | 104 |
| 133 | 3300046455 | Ga0495603_0240898 | Ga0495603_0240898_300_620 | 104 |
| 134 | 3300046459 | Ga0495629_0233421 | Ga0495629_0233421_654_974 | 104 |
| 135 | 3300046474 | Ga0495605_0143211 | Ga0495605_0143211_86_406 | 104 |
| 136 | 3300046475 | Ga0495639_0402648 | Ga0495639_0402648_174_497 | 104 |
| 137 | 3300046475 | Ga0495639_0657239 | Ga0495639_0657239_19_342 | 104 |
| 138 | 3300046507 | Ga0495606_0001686 | Ga0495606_0001686_24305_24631 | 104 |
| 139 | 3300046538 | Ga0495609_0159166 | Ga0495609_0159166_452_772 | 104 |
| 140 | 3300046674 | Ga0495588_0751840 | Ga0495588_0751840_69_389 | 104 |
| 141 | 3300046681 | Ga0495647_0149228 | Ga0495647_0149228_367_690 | 104 |
| 142 | 3300047315 | Ga0495581_0253907 | Ga0495581_0253907_351_671 | 104 |
| 143 | 3300047319 | Ga0495674_0969987 | Ga0495674_0969987_252_569 | 104 |
| 144 | 3300047321 | Ga0495676_0057771 | Ga0495676_0057771_765_1088 | 104 |
| 145 | 3300048903 | Ga0496100_0003516 | Ga0496100_0003516_922_1242 | 104 |
| 146 | 3300048904 | Ga0496101_0395874 | Ga0496101_0395874_333_653 | 104 |
| 147 | 3300048905 | Ga0496102_0034702 | Ga0496102_0034702_759_1079 | 104 |
| 148 | 3300048906 | Ga0496103_0270108 | Ga0496103_0270108_284_604 | 104 |
| 149 | 3300048907 | Ga0496104_0110050 | Ga0496104_0110050_594_914 | 104 |
| 150 | 3300048908 | Ga0496105_0026046 | Ga0496105_0026046_3524_3844 | 104 |
| 151 | 3300048909 | Ga0496106_0242054 | Ga0496106_0242054_1082_1402 | 104 |
| 152 | 3300048909 | Ga0496106_0726011 | Ga0496106_0726011_308_625 | 104 |
| 153 | 3300048910 | Ga0496107_0002052 | Ga0496107_0002052_5571_5891 | 104 |
| 154 | 3300048911 | Ga0496108_0385077 | Ga0496108_0385077_78_398 | 104 |
| 155 | 3300048912 | Ga0496109_0081672 | Ga0496109_0081672_1956_2276 | 104 |
| 156 | 3300048913 | Ga0496110_1307425 | Ga0496110_1307425_221_538 | 104 |
| 157 | 3300048914 | Ga0496111_0021303 | Ga0496111_0021303_3027_3347 | 104 |
| 158 | 3300048914 | Ga0496111_1201082 | Ga0496111_1201082_90_416 | 104 |
| 159 | 3300048915 | Ga0496112_0118824 | Ga0496112_0118824_1948_2268 | 104 |
| 160 | 3300048915 | Ga0496112_0655210 | Ga0496112_0655210_67_393 | 104 |
| 161 | 3300048915 | Ga0496112_1153082 | Ga0496112_1153082_70_390 | 104 |
| 162 | 3300048916 | Ga0496113_0042472 | Ga0496113_0042472_2906_3226 | 104 |
| 163 | 3300048917 | Ga0496114_0040999 | Ga0496114_0040999_1747_2067 | 104 |
| 164 | 3300048918 | Ga0496115_0010980 | Ga0496115_0010980_285_605 | 104 |
| 165 | 3300048927 | Ga0496124_0334023 | Ga0496124_0334023_654_980 | 104 |
| 166 | 3300048928 | Ga0496125_0176361 | Ga0496125_0176361_53_379 | 104 |
| 167 | 3300048929 | Ga0496126_0197410 | Ga0496126_0197410_1311_1628 | 104 |
| 168 | 3300050509 | nmdc:mga0qj67_338939_c1 | nmdc:mga0qj67_338939_c1_489_842 | 104 |
| 169 | 3300053091 | Ga0500647_0136259 | Ga0500647_0136259_678_992 | 104 |
| 170 | iso_pu_bacteria | 2513237094 | 2513638646 | 104 |
| 171 | iso_pu_bacteria | 2513237102 | 2513702492 | 104 |
| 172 | iso_pu_bacteria | 2513237139 | 2513874258 | 104 |
| 173 | iso_pu_bacteria | 2617270741 | 2617374661 | 104 |
| 174 | iso_pu_bacteria | 2802429603 | 2805916024 | 104 |
| 175 | iso_pu_bacteria | 2824617872 | 2824626020 | 104 |
| 176 | iso_pu_bacteria | 2824626560 | 2824634321 | 104 |
| 177 | iso_pu_bacteria | 2824635225 | 2824642682 | 104 |
| 178 | iso_pu_bacteria | 2824644064 | 2824650609 | 104 |
| 179 | iso_pu_bacteria | 2824696289 | 2824699012 | 104 |
| 180 | iso_pu_bacteria | 2824714736 | 2824722250 | 104 |
| 181 | iso_pu_bacteria | 2824723954 | 2824730698 | 104 |
| 182 | iso_pu_bacteria | 2824732956 | 2824738951 | 104 |
| 183 | iso_pu_bacteria | 2824746037 | 2824753286 | 104 |
| 184 | iso_pu_bacteria | 2842038055 | 2842041772 | 104 |
| 185 | iso_pu_bacteria | 2842045827 | 2842049814 | 104 |
| 186 | iso_pu_bacteria | 2847939898 | 2847943303 | 104 |
| 187 | iso_pu_bacteria | 2874612657 | 2874620294 | 104 |
| 188 | iso_pu_bacteria | 2879099564 | 2879100004 | 104 |
| 189 | iso_pu_bacteria | 2881665667 | 2881669325 | 104 |
| 190 | iso_pu_bacteria | 2904690495 | 2904692671 | 104 |
| 191 | iso_pu_bacteria | 2908756301 | 2908757690 | 104 |
| 192 | iso_pu_bacteria | 2908775508 | 2908777142 | 104 |
| 193 | iso_pu_bacteria | 2922368715 | 2922376626 | 104 |
| 194 | iso_pu_bacteria | 2932784394 | 2932789686 | 104 |
| 195 | iso_pu_bacteria | 2932809354 | 2932818195 | 104 |
| 196 | iso_pu_bacteria | 2932818245 | 2932828033 | 104 |
| 197 | iso_pu_bacteria | 2932828146 | 2932835611 | 104 |
| 198 | iso_pu_bacteria | 2935616580 | 2935624615 | 104 |
| 199 | iso_pu_bacteria | 2935638405 | 2935647158 | 104 |
| 200 | iso_pu_bacteria | 2935665750 | 2935674379 | 104 |
| 201 | iso_pu_bacteria | 2935694250 | 2935697607 | 104 |
| 202 | iso_pu_bacteria | 2935703347 | 2935711368 | 104 |
| 203 | iso_pu_bacteria | 2935760218 | 2935764187 | 104 |
| 204 | iso_pu_bacteria | 2935801545 | 2935809846 | 104 |
| 205 | iso_pu_bacteria | 2935810662 | 2935819773 | 104 |
| 206 | iso_pu_bacteria | 2935827899 | 2935836582 | 104 |
| 207 | iso_pu_bacteria | 2935837841 | 2935844696 | 104 |
| 208 | iso_pu_bacteria | 2935855204 | 2935863175 | 104 |
| 209 | iso_pu_bacteria | 2935864058 | 2935868644 | 104 |
| 210 | iso_pu_bacteria | 2935873716 | 2935879418 | 104 |
| 211 | iso_pu_bacteria | 2935992306 | 2936000212 | 104 |
| 212 | iso_pu_bacteria | 2936002035 | 2936010254 | 104 |
| 213 | iso_pu_bacteria | 2936037263 | 2936046483 | 104 |
| 214 | iso_pu_bacteria | 2941538514 | 2941547534 | 104 |
| 215 | iso_pu_bacteria | 3005483717 | 3005485996 | 104 |
| 216 | iso_pu_bacteria | 3005506211 | 3005506662 | 104 |
| 217 | iso_pu_bacteria | 3005710791 | 3005717434 | 104 |
| 218 | iso_pu_bacteria | 8016511872 | 8016519208 | 104 |
| 219 | iso_pu_bacteria | 8017057580 | 8017066298 | 104 |
| 220 | iso_pu_bacteria | 8019576017 | 8019578320 | 104 |
| 221 | iso_pu_bacteria | 8019586578 | 8019596360 | 104 |
| 222 | iso_pu_bacteria | 8019597564 | 8019605341 | 104 |
| 223 | iso_pu_bacteria | 8019608314 | 8019613200 | 104 |
| 224 | 3300005336 | Ga0070680_100048802 | Ga0070680_1000488023 | 105 |
| 225 | 3300005340 | Ga0070689_101173391 | Ga0070689_1011733912 | 105 |
| 226 | 3300005458 | Ga0070681_10575932 | Ga0070681_105759322 | 105 |
| 227 | 3300005530 | Ga0070679_100011213 | Ga0070679_1000112135 | 105 |
| 228 | 3300005530 | Ga0070679_100028212 | Ga0070679_1000282122 | 105 |
| 229 | 3300005618 | Ga0068864_100643461 | Ga0068864_1006434612 | 105 |
| 230 | 3300005718 | Ga0068866_10381933 | Ga0068866_103819332 | 105 |
| 231 | 3300005841 | Ga0068863_100182097 | Ga0068863_1001820972 | 105 |
| 232 | 3300005841 | Ga0068863_100598853 | Ga0068863_1005988532 | 105 |
| 233 | 3300025912 | Ga0207707_10249254 | Ga0207707_102492542 | 105 |
| 234 | 3300025912 | Ga0207707_10679020 | Ga0207707_106790201 | 105 |
| 235 | 3300025917 | Ga0207660_10017344 | Ga0207660_100173443 | 105 |
| 236 | 3300025917 | Ga0207660_10134958 | Ga0207660_101349582 | 105 |
| 237 | 3300025921 | Ga0207652_10049994 | Ga0207652_100499943 | 105 |
| 238 | 3300025921 | Ga0207652_10101478 | Ga0207652_101014782 | 105 |
| 239 | 3300026095 | Ga0207676_11601381 | Ga0207676_116013811 | 105 |
| 240 | 3300028381 | Ga0268264_10181165 | Ga0268264_101811652 | 105 |
| 241 | 3300028573 | Ga0265334_10000205 | Ga0265334_100002054 | 105 |
| 242 | 3300028573 | Ga0265334_10029025 | Ga0265334_100290252 | 105 |
| 243 | 3300031239 | Ga0265328_10311026 | Ga0265328_103110261 | 105 |
| 244 | 3300031250 | Ga0265331_10097325 | Ga0265331_100973252 | 105 |
| 245 | 3300031507 | Ga0307509_10498154 | Ga0307509_104981542 | 105 |
| 246 | 3300031712 | Ga0265342_10093995 | Ga0265342_100939951 | 105 |
| 247 | 3300046663 | Ga0495635_0400549 | Ga0495635_0400549_499_837 | 105 |
| 248 | 3300049669 | Ga0501235_188837 | Ga0501235_188837_41_382 | 105 |
| 249 | 3300005366 | Ga0070659_100654137 | Ga0070659_1006541371 | 106 |
| 250 | 3300005458 | Ga0070681_10325818 | Ga0070681_103258183 | 106 |
| 251 | 3300005547 | Ga0070693_100307986 | Ga0070693_1003079863 | 106 |
| 252 | 3300005614 | Ga0068856_100083848 | Ga0068856_1000838483 | 106 |
| 253 | 3300025912 | Ga0207707_10450243 | Ga0207707_104502433 | 106 |
| 254 | 3300025924 | Ga0207694_11355786 | Ga0207694_113557862 | 106 |
| 255 | 3300025932 | Ga0207690_10838561 | Ga0207690_108385612 | 106 |
| 256 | 3300025942 | Ga0207689_11556656 | Ga0207689_115566562 | 106 |
| 257 | 3300026078 | Ga0207702_10097706 | Ga0207702_100977065 | 106 |
| 258 | 3300028381 | Ga0268264_11655039 | Ga0268264_116550392 | 106 |
| 259 | 3300032005 | Ga0307411_11062251 | Ga0307411_110622512 | 106 |
| 260 | 3300048905 | Ga0496102_0687740 | Ga0496102_0687740_531_860 | 106 |
| 261 | 3300053093 | Ga0500651_0040927 | Ga0500651_0040927_220_540 | 106 |
| 262 | 3300053122 | Ga0500608_331117 | Ga0500608_331117_196_516 | 106 |
| 263 | 3300053136 | Ga0500559_0302836 | Ga0500559_0302836_62_382 | 106 |
| 264 | 3300053145 | Ga0500586_004396 | Ga0500586_004396_1769_2098 | 106 |
| 265 | 3300053148 | Ga0500590_153334 | Ga0500590_153334_112_432 | 106 |
| 266 | iso_pu_bacteria | 2517093001 | 2517104596 | 106 |
| 267 | iso_pu_bacteria | 2824679649 | 2824686277 | 106 |
| 268 | iso_pu_bacteria | 2879083081 | 2879085742 | 106 |
| 269 | iso_pu_bacteria | 2906643746 | 2906647275 | 106 |
| 270 | iso_pu_bacteria | 2922393267 | 2922398576 | 106 |
| 271 | iso_pu_bacteria | 8056967851 | 8056971841 | 106 |
| 272 | 3300003659 | JGI25404J52841_10018969 | JGI25404J52841_100189693 | 107 |
| 273 | 3300003659 | JGI25404J52841_10021526 | JGI25404J52841_100215262 | 107 |
| 274 | 3300003659 | JGI25404J52841_10087605 | JGI25404J52841_100876051 | 107 |
| 275 | 3300005548 | Ga0070665_100748838 | Ga0070665_1007488382 | 107 |
| 276 | 3300005937 | Ga0081455_10176688 | Ga0081455_101766882 | 107 |
| 277 | 3300005983 | Ga0081540_1049888 | Ga0081540_10498882 | 107 |
| 278 | 3300005983 | Ga0081540_1100218 | Ga0081540_11002181 | 107 |
| 279 | 3300006178 | Ga0075367_10540681 | Ga0075367_105406811 | 107 |
| 280 | 3300028379 | Ga0268266_12022772 | Ga0268266_120227721 | 107 |
| 281 | 3300050494 | nmdc:mga06z11_427832_c1 | nmdc:mga06z11_427832_c1_86_409 | 107 |
| 282 | iso_pu_bacteria | 2791355199 | 2793078559 | 107 |
| 283 | iso_pu_bacteria | 2879110137 | 2879113543 | 107 |
| 284 | iso_pu_bacteria | 2889033259 | 2889034144 | 107 |
| 285 | iso_pu_bacteria | 2922386360 | 2922391517 | 107 |
| 286 | iso_pu_bacteria | 8006984368 | 8006986194 | 107 |
| 287 | iso_pu_bacteria | 8056673599 | 8056678872 | 107 |
| 288 | 3300005355 | Ga0070671_101989826 | Ga0070671_1019898261 | 108 |
| 289 | 3300005564 | Ga0070664_100125780 | Ga0070664_1001257803 | 108 |
| 290 | 3300005577 | Ga0068857_101781706 | Ga0068857_1017817062 | 108 |
| 291 | 3300006177 | Ga0075362_10089972 | Ga0075362_100899722 | 108 |
| 292 | 3300006186 | Ga0075369_10019469 | Ga0075369_100194691 | 108 |
| 293 | 3300006186 | Ga0075369_10026495 | Ga0075369_100264953 | 108 |
| 294 | 3300006195 | Ga0075366_10024339 | Ga0075366_100243393 | 108 |
| 295 | 3300006353 | Ga0075370_10028156 | Ga0075370_100281562 | 108 |
| 296 | 3300006871 | Ga0075434_100011477 | Ga0075434_1000114776 | 108 |
| 297 | 3300007076 | Ga0075435_100091989 | Ga0075435_1000919892 | 108 |
| 298 | 3300013297 | Ga0157378_10018404 | Ga0157378_100184045 | 108 |
| 299 | 3300013308 | Ga0157375_11081242 | Ga0157375_110812422 | 108 |
| 300 | 3300021441 | Ga0213871_10014349 | Ga0213871_100143493 | 108 |
| 301 | 3300026067 | Ga0207678_10420561 | Ga0207678_104205612 | 108 |
| 302 | 3300044765 | Ga0466970_0075288 | Ga0466970_0075288_998_1324 | 108 |
| 303 | 3300046660 | Ga0495625_0262166 | Ga0495625_0262166_652_978 | 108 |
| 304 | 3300046692 | Ga0495671_0622873 | Ga0495671_0622873_123_449 | 108 |
| 305 | 3300046694 | Ga0495649_0234754 | Ga0495649_0234754_576_902 | 108 |
| 306 | 3300048908 | Ga0496105_0136808 | Ga0496105_0136808_1376_1702 | 108 |
| 307 | 3300048909 | Ga0496106_1127001 | Ga0496106_1127001_21_347 | 108 |
| 308 | 3300048915 | Ga0496112_1731025 | Ga0496112_1731025_75_401 | 108 |
| 309 | 3300048921 | Ga0496118_0236045 | Ga0496118_0236045_257_583 | 108 |
| 310 | 3300048929 | Ga0496126_0318743 | Ga0496126_0318743_915_1241 | 108 |
| 311 | 3300049590 | Ga0501074_0787649 | Ga0501074_0787649_16_354 | 108 |
| 312 | 3300050489 | nmdc:mga03683_138655_c1 | nmdc:mga03683_138655_c1_684_1010 | 108 |
| 313 | 3300050491 | nmdc:mga00v17_367578_c1 | nmdc:mga00v17_367578_c1_111_437 | 108 |
| 314 | 3300050493 | nmdc:mga0k408_145062_c1 | nmdc:mga0k408_145062_c1_1055_1381 | 108 |
| 315 | 3300050496 | nmdc:mga07m45_412518_c1 | nmdc:mga07m45_412518_c1_36_362 | 108 |
| 316 | 3300050512 | nmdc:mga0n895_10129_c1 | nmdc:mga0n895_10129_c1_1035_1370 | 108 |
| 317 | 3300050513 | nmdc:mga0rr50_78609_c1 | nmdc:mga0rr50_78609_c1_2006_2341 | 108 |
| 318 | 3300050516 | nmdc:mga0sz30_59309_c1 | nmdc:mga0sz30_59309_c1_676_1002 | 108 |
| 319 | 3300025254 | Ga0209148_1015258 | Ga0209148_10152582 | 109 |
| 320 | 3300025924 | Ga0207694_10339564 | Ga0207694_103395642 | 109 |
| 321 | 3300026023 | Ga0207677_10443411 | Ga0207677_104434113 | 109 |
| 322 | 3300005337 | Ga0070682_100448157 | Ga0070682_1004481572 | 110 |
| 323 | 3300005344 | Ga0070661_100796474 | Ga0070661_1007964742 | 110 |
| 324 | 3300005347 | Ga0070668_100725306 | Ga0070668_1007253062 | 110 |
| 325 | 3300005455 | Ga0070663_100422844 | Ga0070663_1004228441 | 110 |
| 326 | 3300005530 | Ga0070679_100855266 | Ga0070679_1008552662 | 110 |
| 327 | 3300005539 | Ga0068853_100033499 | Ga0068853_1000334996 | 110 |
| 328 | 3300005539 | Ga0068853_101055623 | Ga0068853_1010556232 | 110 |
| 329 | 3300005843 | Ga0068860_100506624 | Ga0068860_1005066242 | 110 |
| 330 | 3300006038 | Ga0075365_10116517 | Ga0075365_101165172 | 110 |
| 331 | 3300006042 | Ga0075368_10071172 | Ga0075368_100711722 | 110 |
| 332 | 3300006048 | Ga0075363_100069487 | Ga0075363_1000694873 | 110 |
| 333 | 3300006048 | Ga0075363_100221741 | Ga0075363_1002217411 | 110 |
| 334 | 3300006177 | Ga0075362_10175521 | Ga0075362_101755212 | 110 |
| 335 | 3300006178 | Ga0075367_10045872 | Ga0075367_100458723 | 110 |
| 336 | 3300006178 | Ga0075367_10066484 | Ga0075367_100664841 | 110 |
| 337 | 3300006195 | Ga0075366_10387093 | Ga0075366_103870932 | 110 |
| 338 | 3300006353 | Ga0075370_10337092 | Ga0075370_103370922 | 110 |
| 339 | 3300006944 | Ga0099823_1010603 | Ga0099823_10106039 | 110 |
| 340 | 3300025972 | Ga0207668_10648666 | Ga0207668_106486662 | 110 |
| 341 | 3300026067 | Ga0207678_10807307 | Ga0207678_108073071 | 110 |
| 342 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001667 | 110 |
| 343 | 3300027361 | Ga0209489_100063 | Ga0209489_10006325 | 110 |
| 344 | 3300027363 | Ga0209700_100012 | Ga0209700_10001268 | 110 |
| 345 | 3300027866 | Ga0209813_10015793 | Ga0209813_100157932 | 110 |
| 346 | 3300027866 | Ga0209813_10074050 | Ga0209813_100740502 | 110 |
| 347 | 3300028379 | Ga0268266_11533360 | Ga0268266_115333602 | 110 |
| 348 | 3300031344 | Ga0265316_10102766 | Ga0265316_101027661 | 110 |
| 349 | 3300031824 | Ga0307413_10527820 | Ga0307413_105278202 | 110 |
| 350 | 3300031901 | Ga0307406_10432905 | Ga0307406_104329052 | 110 |
| 351 | 3300031901 | Ga0307406_10684557 | Ga0307406_106845572 | 110 |
| 352 | 3300031995 | Ga0307409_101467526 | Ga0307409_1014675261 | 110 |
| 353 | 3300032002 | Ga0307416_100713180 | Ga0307416_1007131802 | 110 |
| 354 | 3300032005 | Ga0307411_11109766 | Ga0307411_111097661 | 110 |
| 355 | 3300032126 | Ga0307415_100839027 | Ga0307415_1008390272 | 110 |
| 356 | 3300041458 | Ga0451798_0676178 | Ga0451798_0676178_28_360 | 110 |
| 357 | 3300046474 | Ga0495605_0024252 | Ga0495605_0024252_1370_1708 | 110 |
| 358 | 3300046501 | Ga0495607_0361142 | Ga0495607_0361142_57_395 | 110 |
| 359 | 3300046507 | Ga0495606_0012396 | Ga0495606_0012396_2599_2937 | 110 |
| 360 | 3300046515 | Ga0495620_0055003 | Ga0495620_0055003_1263_1601 | 110 |
| 361 | 3300046522 | Ga0495643_0028158 | Ga0495643_0028158_365_703 | 110 |
| 362 | 3300046524 | Ga0495648_0017419 | Ga0495648_0017419_463_801 | 110 |
| 363 | 3300046538 | Ga0495609_0124057 | Ga0495609_0124057_682_1020 | 110 |
| 364 | 3300046557 | Ga0495622_0123645 | Ga0495622_0123645_647_985 | 110 |
| 365 | 3300046616 | Ga0495668_0215498 | Ga0495668_0215498_609_947 | 110 |
| 366 | 3300046648 | Ga0495611_0198249 | Ga0495611_0198249_427_765 | 110 |
| 367 | 3300046660 | Ga0495625_0025297 | Ga0495625_0025297_3577_3915 | 110 |
| 368 | 3300046679 | Ga0495623_0563545 | Ga0495623_0563545_50_394 | 110 |
| 369 | 3300046692 | Ga0495671_0164094 | Ga0495671_0164094_122_460 | 110 |
| 370 | 3300046694 | Ga0495649_0012812 | Ga0495649_0012812_2930_3268 | 110 |
| 371 | 3300047323 | Ga0495683_0073082 | Ga0495683_0073082_754_1092 | 110 |
| 372 | 3300047472 | Ga0495686_0083225 | Ga0495686_0083225_1283_1621 | 110 |
| 373 | 3300049460 | Ga0495682_0005291 | Ga0495682_0005291_4436_4774 | 110 |
| 374 | 3300050492 | nmdc:mga0yw44_183758_c1 | nmdc:mga0yw44_183758_c1_624_980 | 110 |
| 375 | 3300050495 | nmdc:mga04h51_87977_c1 | nmdc:mga04h51_87977_c1_89_445 | 110 |
| 376 | 3300053083 | Ga0495655_0046779 | Ga0495655_0046779_446_784 | 110 |
| 377 | 3300053086 | Ga0500578_0190582 | Ga0500578_0190582_336_674 | 110 |
| 378 | 3300003215 | JGI25153J46596_10009457 | JGI25153J46596_100094572 | 111 |
| 379 | 3300003322 | rootL2_10122270 | rootL2_101222702 | 111 |
| 380 | 3300003659 | JGI25404J52841_10146277 | JGI25404J52841_101462771 | 111 |
| 381 | 3300005327 | Ga0070658_10301967 | Ga0070658_103019672 | 111 |
| 382 | 3300005327 | Ga0070658_10454369 | Ga0070658_104543692 | 111 |
| 383 | 3300005328 | Ga0070676_11624409 | Ga0070676_116244091 | 111 |
| 384 | 3300005333 | Ga0070677_10482048 | Ga0070677_104820481 | 111 |
| 385 | 3300005334 | Ga0068869_100121598 | Ga0068869_1001215982 | 111 |
| 386 | 3300005334 | Ga0068869_100267954 | Ga0068869_1002679541 | 111 |
| 387 | 3300005334 | Ga0068869_101279367 | Ga0068869_1012793672 | 111 |
| 388 | 3300005335 | Ga0070666_10215010 | Ga0070666_102150102 | 111 |
| 389 | 3300005335 | Ga0070666_10369250 | Ga0070666_103692502 | 111 |
| 390 | 3300005335 | Ga0070666_10696793 | Ga0070666_106967932 | 111 |
| 391 | 3300005336 | Ga0070680_100017554 | Ga0070680_1000175544 | 111 |
| 392 | 3300005337 | Ga0070682_100072743 | Ga0070682_1000727433 | 111 |
| 393 | 3300005338 | Ga0068868_100014062 | Ga0068868_1000140623 | 111 |
| 394 | 3300005338 | Ga0068868_100114030 | Ga0068868_1001140303 | 111 |
| 395 | 3300005343 | Ga0070687_100261716 | Ga0070687_1002617163 | 111 |
| 396 | 3300005344 | Ga0070661_100175704 | Ga0070661_1001757042 | 111 |
| 397 | 3300005347 | Ga0070668_100607299 | Ga0070668_1006072992 | 111 |
| 398 | 3300005347 | Ga0070668_101161077 | Ga0070668_1011610772 | 111 |
| 399 | 3300005347 | Ga0070668_101189032 | Ga0070668_1011890322 | 111 |
| 400 | 3300005347 | Ga0070668_101947008 | Ga0070668_1019470081 | 111 |
| 401 | 3300005354 | Ga0070675_101073300 | Ga0070675_1010733001 | 111 |
| 402 | 3300005355 | Ga0070671_100080455 | Ga0070671_1000804553 | 111 |
| 403 | 3300005355 | Ga0070671_101560312 | Ga0070671_1015603121 | 111 |
| 404 | 3300005364 | Ga0070673_100333248 | Ga0070673_1003332482 | 111 |
| 405 | 3300005365 | Ga0070688_100125494 | Ga0070688_1001254942 | 111 |
| 406 | 3300005435 | Ga0070714_100311829 | Ga0070714_1003118292 | 111 |
| 407 | 3300005436 | Ga0070713_100019375 | Ga0070713_1000193756 | 111 |
| 408 | 3300005438 | Ga0070701_10363293 | Ga0070701_103632932 | 111 |
| 409 | 3300005441 | Ga0070700_100211194 | Ga0070700_1002111943 | 111 |
| 410 | 3300005445 | Ga0070708_100090073 | Ga0070708_1000900732 | 111 |
| 411 | 3300005455 | Ga0070663_100156007 | Ga0070663_1001560073 | 111 |
| 412 | 3300005455 | Ga0070663_100244642 | Ga0070663_1002446423 | 111 |
| 413 | 3300005456 | Ga0070678_100032876 | Ga0070678_1000328764 | 111 |
| 414 | 3300005456 | Ga0070678_100040360 | Ga0070678_1000403604 | 111 |
| 415 | 3300005456 | Ga0070678_100136230 | Ga0070678_1001362303 | 111 |
| 416 | 3300005457 | Ga0070662_100258360 | Ga0070662_1002583602 | 111 |
| 417 | 3300005457 | Ga0070662_100860001 | Ga0070662_1008600012 | 111 |
| 418 | 3300005458 | Ga0070681_10786286 | Ga0070681_107862862 | 111 |
| 419 | 3300005459 | Ga0068867_100205532 | Ga0068867_1002055322 | 111 |
| 420 | 3300005466 | Ga0070685_10813513 | Ga0070685_108135131 | 111 |
| 421 | 3300005467 | Ga0070706_100578698 | Ga0070706_1005786982 | 111 |
| 422 | 3300005467 | Ga0070706_101514664 | Ga0070706_1015146641 | 111 |
| 423 | 3300005471 | Ga0070698_102135573 | Ga0070698_1021355731 | 111 |
| 424 | 3300005518 | Ga0070699_100943203 | Ga0070699_1009432031 | 111 |
| 425 | 3300005530 | Ga0070679_100020644 | Ga0070679_1000206444 | 111 |
| 426 | 3300005536 | Ga0070697_100851089 | Ga0070697_1008510892 | 111 |
| 427 | 3300005539 | Ga0068853_100097575 | Ga0068853_1000975753 | 111 |
| 428 | 3300005543 | Ga0070672_100721325 | Ga0070672_1007213252 | 111 |
| 429 | 3300005547 | Ga0070693_100228880 | Ga0070693_1002288802 | 111 |
| 430 | 3300005548 | Ga0070665_100038149 | Ga0070665_1000381493 | 111 |
| 431 | 3300005548 | Ga0070665_100105625 | Ga0070665_1001056252 | 111 |
| 432 | 3300005548 | Ga0070665_100241629 | Ga0070665_1002416292 | 111 |
| 433 | 3300005548 | Ga0070665_100280074 | Ga0070665_1002800742 | 111 |
| 434 | 3300005563 | Ga0068855_100023888 | Ga0068855_1000238886 | 111 |
| 435 | 3300005563 | Ga0068855_101051673 | Ga0068855_1010516731 | 111 |
| 436 | 3300005578 | Ga0068854_100640089 | Ga0068854_1006400892 | 111 |
| 437 | 3300005614 | Ga0068856_100000522 | Ga0068856_10000052240 | 111 |
| 438 | 3300005614 | Ga0068856_100298653 | Ga0068856_1002986533 | 111 |
| 439 | 3300005614 | Ga0068856_100519715 | Ga0068856_1005197152 | 111 |
| 440 | 3300005614 | Ga0068856_100578821 | Ga0068856_1005788212 | 111 |
| 441 | 3300005616 | Ga0068852_100105731 | Ga0068852_1001057313 | 111 |
| 442 | 3300005616 | Ga0068852_101031227 | Ga0068852_1010312272 | 111 |
| 443 | 3300005617 | Ga0068859_100196295 | Ga0068859_1001962953 | 111 |
| 444 | 3300005617 | Ga0068859_100381704 | Ga0068859_1003817043 | 111 |
| 445 | 3300005719 | Ga0068861_100135065 | Ga0068861_1001350652 | 111 |
| 446 | 3300005719 | Ga0068861_100796606 | Ga0068861_1007966062 | 111 |
| 447 | 3300005719 | Ga0068861_102443843 | Ga0068861_1024438431 | 111 |
| 448 | 3300005834 | Ga0068851_10244487 | Ga0068851_102444872 | 111 |
| 449 | 3300005840 | Ga0068870_10076743 | Ga0068870_100767433 | 111 |
| 450 | 3300005840 | Ga0068870_10177545 | Ga0068870_101775452 | 111 |
| 451 | 3300005841 | Ga0068863_101458158 | Ga0068863_1014581582 | 111 |
| 452 | 3300005841 | Ga0068863_102593529 | Ga0068863_1025935292 | 111 |
| 453 | 3300005842 | Ga0068858_100341288 | Ga0068858_1003412882 | 111 |
| 454 | 3300005843 | Ga0068860_101047176 | Ga0068860_1010471762 | 111 |
| 455 | 3300005843 | Ga0068860_101656962 | Ga0068860_1016569622 | 111 |
| 456 | 3300005844 | Ga0068862_100107769 | Ga0068862_1001077694 | 111 |
| 457 | 3300005844 | Ga0068862_100216805 | Ga0068862_1002168052 | 111 |
| 458 | 3300005844 | Ga0068862_100805409 | Ga0068862_1008054091 | 111 |
| 459 | 3300005844 | Ga0068862_102096388 | Ga0068862_1020963882 | 111 |
| 460 | 3300005937 | Ga0081455_10026185 | Ga0081455_100261855 | 111 |
| 461 | 3300005981 | Ga0081538_10099656 | Ga0081538_100996562 | 111 |
| 462 | 3300005983 | Ga0081540_1011981 | Ga0081540_10119815 | 111 |
| 463 | 3300005983 | Ga0081540_1031373 | Ga0081540_10313733 | 111 |
| 464 | 3300005985 | Ga0081539_10017936 | Ga0081539_100179366 | 111 |
| 465 | 3300006028 | Ga0070717_10000325 | Ga0070717_1000032522 | 111 |
| 466 | 3300006038 | Ga0075365_10129506 | Ga0075365_101295061 | 111 |
| 467 | 3300006038 | Ga0075365_10424752 | Ga0075365_104247522 | 111 |
| 468 | 3300006038 | Ga0075365_10595468 | Ga0075365_105954682 | 111 |
| 469 | 3300006038 | Ga0075365_10711359 | Ga0075365_107113592 | 111 |
| 470 | 3300006038 | Ga0075365_11325633 | Ga0075365_113256331 | 111 |
| 471 | 3300006042 | Ga0075368_10153966 | Ga0075368_101539662 | 111 |
| 472 | 3300006048 | Ga0075363_100030546 | Ga0075363_1000305463 | 111 |
| 473 | 3300006048 | Ga0075363_100643338 | Ga0075363_1006433382 | 111 |
| 474 | 3300006051 | Ga0075364_10974869 | Ga0075364_109748692 | 111 |
| 475 | 3300006173 | Ga0070716_100053569 | Ga0070716_1000535692 | 111 |
| 476 | 3300006173 | Ga0070716_100084265 | Ga0070716_1000842652 | 111 |
| 477 | 3300006175 | Ga0070712_100797821 | Ga0070712_1007978212 | 111 |
| 478 | 3300006175 | Ga0070712_100902539 | Ga0070712_1009025392 | 111 |
| 479 | 3300006177 | Ga0075362_10068209 | Ga0075362_100682093 | 111 |
| 480 | 3300006177 | Ga0075362_10144625 | Ga0075362_101446252 | 111 |
| 481 | 3300006177 | Ga0075362_10436629 | Ga0075362_104366291 | 111 |
| 482 | 3300006178 | Ga0075367_10409112 | Ga0075367_104091121 | 111 |
| 483 | 3300006178 | Ga0075367_10410528 | Ga0075367_104105281 | 111 |
| 484 | 3300006195 | Ga0075366_10157117 | Ga0075366_101571171 | 111 |
| 485 | 3300006195 | Ga0075366_10292653 | Ga0075366_102926531 | 111 |
| 486 | 3300006195 | Ga0075366_10786564 | Ga0075366_107865642 | 111 |
| 487 | 3300006353 | Ga0075370_10041996 | Ga0075370_100419964 | 111 |
| 488 | 3300006353 | Ga0075370_10077103 | Ga0075370_100771033 | 111 |
| 489 | 3300006358 | Ga0068871_100481216 | Ga0068871_1004812162 | 111 |
| 490 | 3300006844 | Ga0075428_102209334 | Ga0075428_1022093342 | 111 |
| 491 | 3300006881 | Ga0068865_100529464 | Ga0068865_1005294642 | 111 |
| 492 | 3300006881 | Ga0068865_102037398 | Ga0068865_1020373981 | 111 |
| 493 | 3300006931 | Ga0097620_100196308 | Ga0097620_1001963083 | 111 |
| 494 | 3300006931 | Ga0097620_100381686 | Ga0097620_1003816862 | 111 |
| 495 | 3300009093 | Ga0105240_10272940 | Ga0105240_102729402 | 111 |
| 496 | 3300009094 | Ga0111539_10285806 | Ga0111539_102858062 | 111 |
| 497 | 3300009101 | Ga0105247_10123534 | Ga0105247_101235343 | 111 |
| 498 | 3300009147 | Ga0114129_10177369 | Ga0114129_101773693 | 111 |
| 499 | 3300009147 | Ga0114129_11137135 | Ga0114129_111371352 | 111 |
| 500 | 3300009148 | Ga0105243_11613235 | Ga0105243_116132351 | 111 |
| 501 | 3300009174 | Ga0105241_10716595 | Ga0105241_107165952 | 111 |
| 502 | 3300009176 | Ga0105242_10988231 | Ga0105242_109882311 | 111 |
| 503 | 3300009177 | Ga0105248_10461429 | Ga0105248_104614292 | 111 |
| 504 | 3300009177 | Ga0105248_11821254 | Ga0105248_118212541 | 111 |
| 505 | 3300009545 | Ga0105237_10586768 | Ga0105237_105867682 | 111 |
| 506 | 3300009545 | Ga0105237_10660884 | Ga0105237_106608842 | 111 |
| 507 | 3300009553 | Ga0105249_10203428 | Ga0105249_102034282 | 111 |
| 508 | 3300009553 | Ga0105249_10443668 | Ga0105249_104436683 | 111 |
| 509 | 3300010375 | Ga0105239_10353779 | Ga0105239_103537792 | 111 |
| 510 | 3300010375 | Ga0105239_10592947 | Ga0105239_105929472 | 111 |
| 511 | 3300010375 | Ga0105239_13406843 | Ga0105239_134068431 | 111 |
| 512 | 3300011119 | Ga0105246_10983585 | Ga0105246_109835852 | 111 |
| 513 | 3300011119 | Ga0105246_11039479 | Ga0105246_110394792 | 111 |
| 514 | 3300011119 | Ga0105246_12501470 | Ga0105246_125014701 | 111 |
| 515 | 3300013104 | Ga0157370_10655413 | Ga0157370_106554132 | 111 |
| 516 | 3300013105 | Ga0157369_10307718 | Ga0157369_103077182 | 111 |
| 517 | 3300013297 | Ga0157378_10548988 | Ga0157378_105489882 | 111 |
| 518 | 3300013306 | Ga0163162_10463964 | Ga0163162_104639641 | 111 |
| 519 | 3300013306 | Ga0163162_10778708 | Ga0163162_107787082 | 111 |
| 520 | 3300013306 | Ga0163162_11398842 | Ga0163162_113988421 | 111 |
| 521 | 3300013306 | Ga0163162_12444255 | Ga0163162_124442551 | 111 |
| 522 | 3300013308 | Ga0157375_10214579 | Ga0157375_102145792 | 111 |
| 523 | 3300013308 | Ga0157375_10393869 | Ga0157375_103938692 | 111 |
| 524 | 3300013308 | Ga0157375_10409346 | Ga0157375_104093462 | 111 |
| 525 | 3300013308 | Ga0157375_10429877 | Ga0157375_104298773 | 111 |
| 526 | 3300014325 | Ga0163163_10130037 | Ga0163163_101300373 | 111 |
| 527 | 3300014325 | Ga0163163_11890179 | Ga0163163_118901792 | 111 |
| 528 | 3300014326 | Ga0157380_10201667 | Ga0157380_102016673 | 111 |
| 529 | 3300014745 | Ga0157377_11629435 | Ga0157377_116294351 | 111 |
| 530 | 3300014968 | Ga0157379_10245391 | Ga0157379_102453913 | 111 |
| 531 | 3300017792 | Ga0163161_10303652 | Ga0163161_103036522 | 111 |
| 532 | 3300017792 | Ga0163161_10442413 | Ga0163161_104424132 | 111 |
| 533 | 3300017792 | Ga0163161_11700544 | Ga0163161_117005442 | 111 |
| 534 | 3300017792 | Ga0163161_12089195 | Ga0163161_120891951 | 111 |
| 535 | 3300025297 | Ga0209758_1005984 | Ga0209758_10059846 | 111 |
| 536 | 3300025893 | Ga0207682_10372930 | Ga0207682_103729302 | 111 |
| 537 | 3300025900 | Ga0207710_10112002 | Ga0207710_101120021 | 111 |
| 538 | 3300025900 | Ga0207710_10179041 | Ga0207710_101790411 | 111 |
| 539 | 3300025901 | Ga0207688_10136258 | Ga0207688_101362582 | 111 |
| 540 | 3300025901 | Ga0207688_10220147 | Ga0207688_102201472 | 111 |
| 541 | 3300025903 | Ga0207680_10160679 | Ga0207680_101606792 | 111 |
| 542 | 3300025903 | Ga0207680_10566378 | Ga0207680_105663782 | 111 |
| 543 | 3300025907 | Ga0207645_10100720 | Ga0207645_101007203 | 111 |
| 544 | 3300025908 | Ga0207643_10504244 | Ga0207643_105042441 | 111 |
| 545 | 3300025912 | Ga0207707_10053447 | Ga0207707_100534472 | 111 |
| 546 | 3300025915 | Ga0207693_10526066 | Ga0207693_105260662 | 111 |
| 547 | 3300025915 | Ga0207693_10679009 | Ga0207693_106790091 | 111 |
| 548 | 3300025916 | Ga0207663_10531104 | Ga0207663_105311042 | 111 |
| 549 | 3300025917 | Ga0207660_10029807 | Ga0207660_100298074 | 111 |
| 550 | 3300025918 | Ga0207662_10225699 | Ga0207662_102256992 | 111 |
| 551 | 3300025920 | Ga0207649_10136724 | Ga0207649_101367243 | 111 |
| 552 | 3300025921 | Ga0207652_10439951 | Ga0207652_104399512 | 111 |
| 553 | 3300025925 | Ga0207650_10286400 | Ga0207650_102864003 | 111 |
| 554 | 3300025925 | Ga0207650_11006663 | Ga0207650_110066632 | 111 |
| 555 | 3300025926 | Ga0207659_10901429 | Ga0207659_109014292 | 111 |
| 556 | 3300025926 | Ga0207659_11699709 | Ga0207659_116997092 | 111 |
| 557 | 3300025927 | Ga0207687_10073554 | Ga0207687_100735542 | 111 |
| 558 | 3300025928 | Ga0207700_10018587 | Ga0207700_100185873 | 111 |
| 559 | 3300025929 | Ga0207664_10423502 | Ga0207664_104235022 | 111 |
| 560 | 3300025931 | Ga0207644_10113061 | Ga0207644_101130612 | 111 |
| 561 | 3300025931 | Ga0207644_10840177 | Ga0207644_108401772 | 111 |
| 562 | 3300025933 | Ga0207706_10889590 | Ga0207706_108895902 | 111 |
| 563 | 3300025935 | Ga0207709_10184326 | Ga0207709_101843263 | 111 |
| 564 | 3300025935 | Ga0207709_10263760 | Ga0207709_102637602 | 111 |
| 565 | 3300025938 | Ga0207704_10175686 | Ga0207704_101756863 | 111 |
| 566 | 3300025938 | Ga0207704_10862334 | Ga0207704_108623342 | 111 |
| 567 | 3300025939 | Ga0207665_10097547 | Ga0207665_100975472 | 111 |
| 568 | 3300025939 | Ga0207665_10176706 | Ga0207665_101767062 | 111 |
| 569 | 3300025940 | Ga0207691_10473402 | Ga0207691_104734022 | 111 |
| 570 | 3300025940 | Ga0207691_10962012 | Ga0207691_109620121 | 111 |
| 571 | 3300025941 | Ga0207711_10443845 | Ga0207711_104438452 | 111 |
| 572 | 3300025942 | Ga0207689_10037068 | Ga0207689_100370684 | 111 |
| 573 | 3300025942 | Ga0207689_10062358 | Ga0207689_100623583 | 111 |
| 574 | 3300025945 | Ga0207679_10063126 | Ga0207679_100631263 | 111 |
| 575 | 3300025960 | Ga0207651_10416540 | Ga0207651_104165402 | 111 |
| 576 | 3300025960 | Ga0207651_11108187 | Ga0207651_111081871 | 111 |
| 577 | 3300025972 | Ga0207668_10035874 | Ga0207668_100358744 | 111 |
| 578 | 3300025972 | Ga0207668_10039748 | Ga0207668_100397483 | 111 |
| 579 | 3300025972 | Ga0207668_10461337 | Ga0207668_104613372 | 111 |
| 580 | 3300025972 | Ga0207668_10543037 | Ga0207668_105430372 | 111 |
| 581 | 3300025972 | Ga0207668_11353917 | Ga0207668_113539172 | 111 |
| 582 | 3300025981 | Ga0207640_10456117 | Ga0207640_104561172 | 111 |
| 583 | 3300026023 | Ga0207677_10007318 | Ga0207677_100073186 | 111 |
| 584 | 3300026023 | Ga0207677_10496358 | Ga0207677_104963582 | 111 |
| 585 | 3300026023 | Ga0207677_11369830 | Ga0207677_113698302 | 111 |
| 586 | 3300026035 | Ga0207703_12109895 | Ga0207703_121098952 | 111 |
| 587 | 3300026041 | Ga0207639_10095084 | Ga0207639_100950843 | 111 |
| 588 | 3300026041 | Ga0207639_10164148 | Ga0207639_101641483 | 111 |
| 589 | 3300026067 | Ga0207678_10036446 | Ga0207678_100364464 | 111 |
| 590 | 3300026067 | Ga0207678_10266009 | Ga0207678_102660092 | 111 |
| 591 | 3300026067 | Ga0207678_10306141 | Ga0207678_103061411 | 111 |
| 592 | 3300026067 | Ga0207678_10320693 | Ga0207678_103206932 | 111 |
| 593 | 3300026067 | Ga0207678_10358339 | Ga0207678_103583392 | 111 |
| 594 | 3300026075 | Ga0207708_10221292 | Ga0207708_102212923 | 111 |
| 595 | 3300026075 | Ga0207708_10639062 | Ga0207708_106390622 | 111 |
| 596 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014238 | 111 |
| 597 | 3300026078 | Ga0207702_10752686 | Ga0207702_107526862 | 111 |
| 598 | 3300026088 | Ga0207641_11169825 | Ga0207641_111698252 | 111 |
| 599 | 3300026088 | Ga0207641_12123235 | Ga0207641_121232351 | 111 |
| 600 | 3300026095 | Ga0207676_10742510 | Ga0207676_107425102 | 111 |
| 601 | 3300026095 | Ga0207676_10785932 | Ga0207676_107859323 | 111 |
| 602 | 3300026116 | Ga0207674_11263584 | Ga0207674_112635842 | 111 |
| 603 | 3300026118 | Ga0207675_100051489 | Ga0207675_1000514894 | 111 |
| 604 | 3300026118 | Ga0207675_100574536 | Ga0207675_1005745361 | 111 |
| 605 | 3300026118 | Ga0207675_101537961 | Ga0207675_1015379612 | 111 |
| 606 | 3300026118 | Ga0207675_102235302 | Ga0207675_1022353022 | 111 |
| 607 | 3300026121 | Ga0207683_10010329 | Ga0207683_100103295 | 111 |
| 608 | 3300026121 | Ga0207683_10059461 | Ga0207683_100594612 | 111 |
| 609 | 3300026121 | Ga0207683_10181418 | Ga0207683_101814183 | 111 |
| 610 | 3300026142 | Ga0207698_10063522 | Ga0207698_100635223 | 111 |
| 611 | 3300026142 | Ga0207698_10231745 | Ga0207698_102317453 | 111 |
| 612 | 3300027866 | Ga0209813_10096138 | Ga0209813_100961382 | 111 |
| 613 | 3300027907 | Ga0207428_10517963 | Ga0207428_105179632 | 111 |
| 614 | 3300028379 | Ga0268266_10004186 | Ga0268266_100041866 | 111 |
| 615 | 3300028379 | Ga0268266_10035828 | Ga0268266_100358284 | 111 |
| 616 | 3300028379 | Ga0268266_10297237 | Ga0268266_102972373 | 111 |
| 617 | 3300028379 | Ga0268266_10587538 | Ga0268266_105875382 | 111 |
| 618 | 3300028379 | Ga0268266_11408435 | Ga0268266_114084351 | 111 |
| 619 | 3300028380 | Ga0268265_10120393 | Ga0268265_101203933 | 111 |
| 620 | 3300028380 | Ga0268265_10179152 | Ga0268265_101791522 | 111 |
| 621 | 3300028380 | Ga0268265_10419214 | Ga0268265_104192142 | 111 |
| 622 | 3300028786 | Ga0307517_10476983 | Ga0307517_104769831 | 111 |
| 623 | 3300028786 | Ga0307517_10649604 | Ga0307517_106496042 | 111 |
| 624 | 3300028794 | Ga0307515_10394839 | Ga0307515_103948392 | 111 |
| 625 | 3300028794 | Ga0307515_10414896 | Ga0307515_104148962 | 111 |
| 626 | 3300028794 | Ga0307515_10462906 | Ga0307515_104629062 | 111 |
| 627 | 3300031250 | Ga0265331_10099252 | Ga0265331_100992523 | 111 |
| 628 | 3300031456 | Ga0307513_10378818 | Ga0307513_103788182 | 111 |
| 629 | 3300031456 | Ga0307513_10454173 | Ga0307513_104541732 | 111 |
| 630 | 3300031507 | Ga0307509_10712027 | Ga0307509_107120271 | 111 |
| 631 | 3300031548 | Ga0307408_100373302 | Ga0307408_1003733022 | 111 |
| 632 | 3300031548 | Ga0307408_100441588 | Ga0307408_1004415882 | 111 |
| 633 | 3300031548 | Ga0307408_100660612 | Ga0307408_1006606122 | 111 |
| 634 | 3300031548 | Ga0307408_101287966 | Ga0307408_1012879662 | 111 |
| 635 | 3300031730 | Ga0307516_10169761 | Ga0307516_101697612 | 111 |
| 636 | 3300031731 | Ga0307405_11322647 | Ga0307405_113226472 | 111 |
| 637 | 3300031824 | Ga0307413_10801422 | Ga0307413_108014222 | 111 |
| 638 | 3300031824 | Ga0307413_12189339 | Ga0307413_121893391 | 111 |
| 639 | 3300031852 | Ga0307410_10197273 | Ga0307410_101972733 | 111 |
| 640 | 3300031901 | Ga0307406_10319565 | Ga0307406_103195652 | 111 |
| 641 | 3300031901 | Ga0307406_12109741 | Ga0307406_121097412 | 111 |
| 642 | 3300031911 | Ga0307412_10384165 | Ga0307412_103841652 | 111 |
| 643 | 3300031911 | Ga0307412_10447650 | Ga0307412_104476502 | 111 |
| 644 | 3300031911 | Ga0307412_11152607 | Ga0307412_111526072 | 111 |
| 645 | 3300031995 | Ga0307409_100785057 | Ga0307409_1007850572 | 111 |
| 646 | 3300031995 | Ga0307409_101248187 | Ga0307409_1012481872 | 111 |
| 647 | 3300031995 | Ga0307409_102051144 | Ga0307409_1020511442 | 111 |
| 648 | 3300032002 | Ga0307416_100166359 | Ga0307416_1001663593 | 111 |
| 649 | 3300032002 | Ga0307416_101108066 | Ga0307416_1011080662 | 111 |
| 650 | 3300032002 | Ga0307416_101785369 | Ga0307416_1017853692 | 111 |
| 651 | 3300032002 | Ga0307416_102154646 | Ga0307416_1021546462 | 111 |
| 652 | 3300032005 | Ga0307411_11086952 | Ga0307411_110869522 | 111 |
| 653 | 3300033179 | Ga0307507_10639363 | Ga0307507_106393631 | 111 |
| 654 | 3300033180 | Ga0307510_10019452 | Ga0307510_100194528 | 111 |
| 655 | 3300033180 | Ga0307510_10283845 | Ga0307510_102838452 | 111 |
| 656 | 3300035113 | Ga0373936_0292374 | Ga0373936_0292374_139_474 | 111 |
| 657 | 3300035172 | Ga0373955_0302418 | Ga0373955_0302418_611_952 | 111 |
| 658 | 3300035691 | Ga0373931_0702153 | Ga0373931_0702153_139_483 | 111 |
| 659 | 3300035695 | Ga0373927_0079443 | Ga0373927_0079443_237_581 | 111 |
| 660 | 3300035724 | Ga0373933_0002307 | Ga0373933_0002307_969_1310 | 111 |
| 661 | 3300035725 | Ga0373947_0241823 | Ga0373947_0241823_763_1107 | 111 |
| 662 | 3300035725 | Ga0373947_0486484 | Ga0373947_0486484_213_554 | 111 |
| 663 | 3300037068 | Ga0373925_0469041 | Ga0373925_0469041_14_358 | 111 |
| 664 | 3300041413 | Ga0439465_0236626 | Ga0439465_0236626_109_450 | 111 |
| 665 | 3300041451 | Ga0451791_0739765 | Ga0451791_0739765_18_353 | 111 |
| 666 | 3300041460 | Ga0451802_1420511 | Ga0451802_1420511_15_356 | 111 |
| 667 | 3300041460 | Ga0451802_2110330 | Ga0451802_2110330_118_459 | 111 |
| 668 | 3300041486 | Ga0451807_1607596 | Ga0451807_1607596_550_885 | 111 |
| 669 | 3300041494 | Ga0451837_0166180 | Ga0451837_0166180_27_362 | 111 |
| 670 | 3300042157 | Ga0439458_0017499 | Ga0439458_0017499_860_1195 | 111 |
| 671 | 3300046452 | Ga0495617_012261 | Ga0495617_012261_2126_2467 | 111 |
| 672 | 3300046455 | Ga0495603_0019146 | Ga0495603_0019146_3635_3976 | 111 |
| 673 | 3300046455 | Ga0495603_0023274 | Ga0495603_0023274_2733_3068 | 111 |
| 674 | 3300046460 | Ga0495638_0104161 | Ga0495638_0104161_871_1212 | 111 |
| 675 | 3300046461 | Ga0495641_0041267 | Ga0495641_0041267_1218_1553 | 111 |
| 676 | 3300046461 | Ga0495641_0216531 | Ga0495641_0216531_387_728 | 111 |
| 677 | 3300046462 | Ga0495651_0515749 | Ga0495651_0515749_294_635 | 111 |
| 678 | 3300046472 | Ga0495580_0406108 | Ga0495580_0406108_98_442 | 111 |
| 679 | 3300046473 | Ga0495582_0564199 | Ga0495582_0564199_225_566 | 111 |
| 680 | 3300046474 | Ga0495605_0157201 | Ga0495605_0157201_49_390 | 111 |
| 681 | 3300046474 | Ga0495605_0209218 | Ga0495605_0209218_48_389 | 111 |
| 682 | 3300046474 | Ga0495605_0386999 | Ga0495605_0386999_143_484 | 111 |
| 683 | 3300046475 | Ga0495639_0149486 | Ga0495639_0149486_48_389 | 111 |
| 684 | 3300046475 | Ga0495639_0203272 | Ga0495639_0203272_501_836 | 111 |
| 685 | 3300046491 | Ga0495584_0095443 | Ga0495584_0095443_550_885 | 111 |
| 686 | 3300046492 | Ga0495585_0110640 | Ga0495585_0110640_465_806 | 111 |
| 687 | 3300046492 | Ga0495585_0169275 | Ga0495585_0169275_106_447 | 111 |
| 688 | 3300046492 | Ga0495585_0310967 | Ga0495585_0310967_32_373 | 111 |
| 689 | 3300046499 | Ga0495594_0452954 | Ga0495594_0452954_200_535 | 111 |
| 690 | 3300046500 | Ga0495596_0037063 | Ga0495596_0037063_58_393 | 111 |
| 691 | 3300046500 | Ga0495596_0151077 | Ga0495596_0151077_514_855 | 111 |
| 692 | 3300046500 | Ga0495596_0161249 | Ga0495596_0161249_134_475 | 111 |
| 693 | 3300046500 | Ga0495596_0201027 | Ga0495596_0201027_60_395 | 111 |
| 694 | 3300046501 | Ga0495607_0217623 | Ga0495607_0217623_499_840 | 111 |
| 695 | 3300046501 | Ga0495607_0434386 | Ga0495607_0434386_229_564 | 111 |
| 696 | 3300046512 | Ga0495610_0123246 | Ga0495610_0123246_402_737 | 111 |
| 697 | 3300046513 | Ga0495616_0146426 | Ga0495616_0146426_426_767 | 111 |
| 698 | 3300046513 | Ga0495616_0180963 | Ga0495616_0180963_71_406 | 111 |
| 699 | 3300046513 | Ga0495616_0242355 | Ga0495616_0242355_229_570 | 111 |
| 700 | 3300046515 | Ga0495620_0074829 | Ga0495620_0074829_991_1326 | 111 |
| 701 | 3300046515 | Ga0495620_0080394 | Ga0495620_0080394_121_462 | 111 |
| 702 | 3300046518 | Ga0495631_0033505 | Ga0495631_0033505_48_389 | 111 |
| 703 | 3300046519 | Ga0495632_0147623 | Ga0495632_0147623_616_957 | 111 |
| 704 | 3300046519 | Ga0495632_0203522 | Ga0495632_0203522_245_580 | 111 |
| 705 | 3300046519 | Ga0495632_0330836 | Ga0495632_0330836_56_397 | 111 |
| 706 | 3300046522 | Ga0495643_0244119 | Ga0495643_0244119_188_523 | 111 |
| 707 | 3300046523 | Ga0495644_0322078 | Ga0495644_0322078_31_372 | 111 |
| 708 | 3300046525 | Ga0495663_0100245 | Ga0495663_0100245_582_923 | 111 |
| 709 | 3300046526 | Ga0495666_0392120 | Ga0495666_0392120_83_424 | 111 |
| 710 | 3300046528 | Ga0495642_0114043 | Ga0495642_0114043_708_1049 | 111 |
| 711 | 3300046528 | Ga0495642_0245848 | Ga0495642_0245848_419_754 | 111 |
| 712 | 3300046530 | Ga0495654_0096274 | Ga0495654_0096274_52_393 | 111 |
| 713 | 3300046531 | Ga0495665_0232244 | Ga0495665_0232244_481_816 | 111 |
| 714 | 3300046536 | Ga0495587_0512512 | Ga0495587_0512512_163_504 | 111 |
| 715 | 3300046538 | Ga0495609_0067233 | Ga0495609_0067233_401_736 | 111 |
| 716 | 3300046542 | Ga0495597_0171117 | Ga0495597_0171117_299_640 | 111 |
| 717 | 3300046557 | Ga0495622_0029989 | Ga0495622_0029989_882_1217 | 111 |
| 718 | 3300046558 | Ga0495633_0229205 | Ga0495633_0229205_235_576 | 111 |
| 719 | 3300046558 | Ga0495633_0281271 | Ga0495633_0281271_95_430 | 111 |
| 720 | 3300046615 | Ga0495656_0004583 | Ga0495656_0004583_862_1203 | 111 |
| 721 | 3300046615 | Ga0495656_0156674 | Ga0495656_0156674_211_552 | 111 |
| 722 | 3300046615 | Ga0495656_0357593 | Ga0495656_0357593_184_525 | 111 |
| 723 | 3300046616 | Ga0495668_0088884 | Ga0495668_0088884_750_1091 | 111 |
| 724 | 3300046616 | Ga0495668_0145069 | Ga0495668_0145069_677_1012 | 111 |
| 725 | 3300046616 | Ga0495668_0263938 | Ga0495668_0263938_526_867 | 111 |
| 726 | 3300046616 | Ga0495668_0311914 | Ga0495668_0311914_243_584 | 111 |
| 727 | 3300046616 | Ga0495668_0653876 | Ga0495668_0653876_19_354 | 111 |
| 728 | 3300046642 | Ga0495634_0775245 | Ga0495634_0775245_187_528 | 111 |
| 729 | 3300046648 | Ga0495611_0204938 | Ga0495611_0204938_313_654 | 111 |
| 730 | 3300046660 | Ga0495625_0725939 | Ga0495625_0725939_21_362 | 111 |
| 731 | 3300046664 | Ga0495659_0019280 | Ga0495659_0019280_1522_1863 | 111 |
| 732 | 3300046674 | Ga0495588_0106822 | Ga0495588_0106822_516_857 | 111 |
| 733 | 3300046674 | Ga0495588_0212477 | Ga0495588_0212477_144_479 | 111 |
| 734 | 3300046683 | Ga0495658_0250475 | Ga0495658_0250475_617_952 | 111 |
| 735 | 3300046684 | Ga0495669_0045936 | Ga0495669_0045936_799_1140 | 111 |
| 736 | 3300046684 | Ga0495669_0056763 | Ga0495669_0056763_47_388 | 111 |
| 737 | 3300046690 | Ga0495624_0883485 | Ga0495624_0883485_128_463 | 111 |
| 738 | 3300046691 | Ga0495670_0434409 | Ga0495670_0434409_262_597 | 111 |
| 739 | 3300046691 | Ga0495670_0771924 | Ga0495670_0771924_54_395 | 111 |
| 740 | 3300046692 | Ga0495671_0226763 | Ga0495671_0226763_130_471 | 111 |
| 741 | 3300046692 | Ga0495671_0613348 | Ga0495671_0613348_96_437 | 111 |
| 742 | 3300046694 | Ga0495649_0565932 | Ga0495649_0565932_30_371 | 111 |
| 743 | 3300046794 | Ga0495589_0264624 | Ga0495589_0264624_205_546 | 111 |
| 744 | 3300046809 | Ga0495600_0064005 | Ga0495600_0064005_1438_1779 | 111 |
| 745 | 3300047315 | Ga0495581_0810433 | Ga0495581_0810433_66_401 | 111 |
| 746 | 3300047317 | Ga0495604_0664575 | Ga0495604_0664575_185_526 | 111 |
| 747 | 3300047318 | Ga0495636_0057273 | Ga0495636_0057273_897_1238 | 111 |
| 748 | 3300047320 | Ga0495672_0361314 | Ga0495672_0361314_262_597 | 111 |
| 749 | 3300047321 | Ga0495676_0080205 | Ga0495676_0080205_393_734 | 111 |
| 750 | 3300047322 | Ga0495680_0462734 | Ga0495680_0462734_104_445 | 111 |
| 751 | 3300047469 | Ga0495673_0114584 | Ga0495673_0114584_17_352 | 111 |
| 752 | 3300047470 | Ga0495681_0398881 | Ga0495681_0398881_75_416 | 111 |
| 753 | 3300047472 | Ga0495686_0190739 | Ga0495686_0190739_524_859 | 111 |
| 754 | 3300047673 | Ga0495593_0352235 | Ga0495593_0352235_318_662 | 111 |
| 755 | 3300048089 | Ga0495614_0217491 | Ga0495614_0217491_20_361 | 111 |
| 756 | 3300048091 | Ga0495626_0090888 | Ga0495626_0090888_683_1024 | 111 |
| 757 | 3300048904 | Ga0496101_1573828 | Ga0496101_1573828_18_353 | 111 |
| 758 | 3300048911 | Ga0496108_0573947 | Ga0496108_0573947_93_428 | 111 |
| 759 | 3300048912 | Ga0496109_0570835 | Ga0496109_0570835_497_856 | 111 |
| 760 | 3300048916 | Ga0496113_1425773 | Ga0496113_1425773_103_462 | 111 |
| 761 | 3300048918 | Ga0496115_0046849 | Ga0496115_0046849_1899_2252 | 111 |
| 762 | 3300048924 | Ga0496121_0044798 | Ga0496121_0044798_988_1329 | 111 |
| 763 | 3300048924 | Ga0496121_0082049 | Ga0496121_0082049_940_1281 | 111 |
| 764 | 3300048924 | Ga0496121_0119094 | Ga0496121_0119094_705_1040 | 111 |
| 765 | 3300048924 | Ga0496121_0158250 | Ga0496121_0158250_1291_1632 | 111 |
| 766 | 3300048924 | Ga0496121_0507192 | Ga0496121_0507192_316_657 | 111 |
| 767 | 3300048927 | Ga0496124_0124232 | Ga0496124_0124232_1310_1651 | 111 |
| 768 | 3300048927 | Ga0496124_0990925 | Ga0496124_0990925_77_412 | 111 |
| 769 | 3300048928 | Ga0496125_0173573 | Ga0496125_0173573_653_994 | 111 |
| 770 | 3300048928 | Ga0496125_0312501 | Ga0496125_0312501_380_721 | 111 |
| 771 | 3300048928 | Ga0496125_0533178 | Ga0496125_0533178_236_577 | 111 |
| 772 | 3300048929 | Ga0496126_0048723 | Ga0496126_0048723_2227_2568 | 111 |
| 773 | 3300048929 | Ga0496126_0175444 | Ga0496126_0175444_490_831 | 111 |
| 774 | 3300048929 | Ga0496126_0275698 | Ga0496126_0275698_489_830 | 111 |
| 775 | 3300049459 | Ga0495678_184566 | Ga0495678_184566_101_436 | 111 |
| 776 | 3300049578 | Ga0501042_0158314 | Ga0501042_0158314_70_411 | 111 |
| 777 | 3300049583 | Ga0501067_0219605 | Ga0501067_0219605_63_398 | 111 |
| 778 | 3300049584 | Ga0501068_0838553 | Ga0501068_0838553_230_568 | 111 |
| 779 | 3300049586 | Ga0501070_1295502 | Ga0501070_1295502_87_428 | 111 |
| 780 | 3300049587 | Ga0501071_0171754 | Ga0501071_0171754_88_429 | 111 |
| 781 | 3300050489 | nmdc:mga03683_619723_c1 | nmdc:mga03683_619723_c1_157_492 | 111 |
| 782 | 3300050490 | nmdc:mga03n38_1510_c1 | nmdc:mga03n38_1510_c1_859_1200 | 111 |
| 783 | 3300050491 | nmdc:mga00v17_202351_c1 | nmdc:mga00v17_202351_c1_15_356 | 111 |
| 784 | 3300050491 | nmdc:mga00v17_693401_c1 | nmdc:mga00v17_693401_c1_60_401 | 111 |
| 785 | 3300050492 | nmdc:mga0yw44_1027711_c1 | nmdc:mga0yw44_1027711_c1_191_532 | 111 |
| 786 | 3300050493 | nmdc:mga0k408_210367_c1 | nmdc:mga0k408_210367_c1_558_899 | 111 |
| 787 | 3300050493 | nmdc:mga0k408_477043_c1 | nmdc:mga0k408_477043_c1_136_477 | 111 |
| 788 | 3300050493 | nmdc:mga0k408_668833_c1 | nmdc:mga0k408_668833_c1_65_406 | 111 |
| 789 | 3300050493 | nmdc:mga0k408_839441_c1 | nmdc:mga0k408_839441_c1_93_434 | 111 |
| 790 | 3300050494 | nmdc:mga06z11_180854_c1 | nmdc:mga06z11_180854_c1_670_1011 | 111 |
| 791 | 3300050494 | nmdc:mga06z11_283960_c1 | nmdc:mga06z11_283960_c1_237_572 | 111 |
| 792 | 3300050494 | nmdc:mga06z11_9242_c1 | nmdc:mga06z11_9242_c1_2626_2967 | 111 |
| 793 | 3300050495 | nmdc:mga04h51_114061_c1 | nmdc:mga04h51_114061_c1_190_531 | 111 |
| 794 | 3300050496 | nmdc:mga07m45_1327_c4 | nmdc:mga07m45_1327_c4_859_1200 | 111 |
| 795 | 3300050496 | nmdc:mga07m45_597371_c1 | nmdc:mga07m45_597371_c1_147_482 | 111 |
| 796 | 3300050507 | nmdc:mga05p37_239403_c1 | nmdc:mga05p37_239403_c1_1510_1851 | 111 |
| 797 | 3300050511 | nmdc:mga08y16_382743_c1 | nmdc:mga08y16_382743_c1_894_1235 | 111 |
| 798 | 3300050516 | nmdc:mga0sz30_219186_c1 | nmdc:mga0sz30_219186_c1_31_372 | 111 |
| 799 | 3300053092 | Ga0500583_0388232 | Ga0500583_0388232_99_440 | 111 |
| 800 | 3300053093 | Ga0500651_0116823 | Ga0500651_0116823_421_756 | 111 |
| 801 | 3300053096 | Ga0500641_0231654 | Ga0500641_0231654_185_526 | 111 |
| 802 | 3300053103 | Ga0500555_059939 | Ga0500555_059939_357_698 | 111 |
| 803 | 3300053106 | Ga0500558_281906 | Ga0500558_281906_132_467 | 111 |
| 804 | 3300053109 | Ga0500569_027872 | Ga0500569_027872_1074_1409 | 111 |
| 805 | 3300053119 | Ga0500595_004847 | Ga0500595_004847_672_1007 | 111 |
| 806 | 3300053130 | Ga0500642_0068424 | Ga0500642_0068424_338_679 | 111 |
| 807 | 3300053134 | Ga0500658_0056611 | Ga0500658_0056611_345_680 | 111 |
| 808 | 3300053134 | Ga0500658_0230499 | Ga0500658_0230499_234_575 | 111 |
| 809 | 3300053142 | Ga0500577_0133880 | Ga0500577_0133880_371_706 | 111 |
| 810 | 3300053151 | Ga0500604_0130673 | Ga0500604_0130673_166_507 | 111 |
| 811 | 3300053151 | Ga0500604_0143688 | Ga0500604_0143688_167_502 | 111 |
| 812 | 3300053156 | Ga0500622_0315320 | Ga0500622_0315320_254_595 | 111 |
| 813 | 3300053158 | Ga0500627_0411914 | Ga0500627_0411914_107_442 | 111 |
| 814 | 3300053160 | Ga0500633_0379459 | Ga0500633_0379459_129_470 | 111 |
| 815 | 3300053162 | Ga0500638_311554 | Ga0500638_311554_126_461 | 111 |
| 816 | 3300053177 | Ga0500636_0526123 | Ga0500636_0526123_63_398 | 111 |
| 817 | 3300053178 | Ga0500637_0501835 | Ga0500637_0501835_169_504 | 111 |
| 818 | 3300053730 | Ga0500645_205433 | Ga0500645_205433_168_503 | 111 |
| 819 | 3300053731 | Ga0500609_021098 | Ga0500609_021098_145_480 | 111 |
| 820 | 3300061734 | Ga0530510_0992105 | Ga0530510_0992105_196_537 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8r57-assembly1.cif.gz_T | cryoem structure of wheat 40s ribosomal subunit, head domain | 0.9345 | 59 | 92 |
| 4jba-assembly1.cif.gz_B | crystal structure of the oxidized form of marr from e.coli | 0.9337 | 34 | 96 |
| 6tmf-assembly1.cif.gz_V | structure of an archaeal abce1-bound ribosomal post-splitting complex | 0.9326 | 58 | 92 |
| 4v7e-assembly1.cif.gz_BT | model of the small subunit rna based on a 5.5 a cryo-em map of triticum aestivum translating 80s ribosome | 0.9239 | 58 | 92 |
| 6zj3-assembly1.cif.gz_SX | cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis | 0.9198 | 59 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LWR7_1_142_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9274 | 59 | 96 | 1.10.10.10 |
| af_Q59048_168_225_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9253 | 34 | 87 | 1.10.10.10 |
| af_Q9H171_1_74_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9243 | 34 | 86 | 1.10.10.10 |
| 5hs9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9139 | 22 | 106 | 1.10.10.10 |
| af_A4I1H2_999_1066_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9095 | 34 | 87 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6AIF2-F1-model_v4 | Transcriptional regulator | 0.9757 | 27 | 104 |
GO:0003677
|
| AF-A0A1H4SED5-F1-model_v4 | DNA-binding transcriptional regulator, HxlR family | 0.9708 | 23 | 110 |
GO:0003677
|
| AF-A0A5C5RFR2-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9667 | 27 | 105 |
GO:0003677
|
| AF-A0A4U8VYG9-F1-model_v4 | HxlR-like helix-turn-helix | 0.966 | 27 | 106 |
GO:0003677
|
| AF-A0A1A2KYN1-F1-model_v4 | Transcriptional regulator | 0.9611 | 23 | 107 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar