F482179

General Info

Members Datasets Scaffolds Average Seq Length
819 216 819 259

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0039882|Ga0395905_0039882_944_1816
Length 290
Sequence MAMIEAPGASMRRTAPNQESAMATVSRVSASKTKIPVRKISDEDLRWSLRQGLADFGDLRGDLVFAGLIYTFIGLAAVVMTTNGPLMPFFLPVVAGVGLMGPVAAVGFYELARRREAGQEVHWFNFLDVRKRPSVDDMGIVAGLLLAIFFAWLLAAGALYVALFGWATPTSIGGFITSVFTTPRGWALIILGGAIGAIFGWIVLAFSVASMPMLVDCDISAAEAVSASWRAAHANKAEMIRWGIIVTALLFLGSLPLFVGLAFVLPWLGYATWHLYTRLIDRDSLARRCD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003553 3300001979 Bacteria 6831
2 JGI24740J21852_10030528 3300001979 Bacteria 1751
3 JGI24739J22299_10016585 3300001989 Bacteria 2665
4 JGI24739J22299_10017154 3300001989 Bacteria 2615
5 JGI24739J22299_10031302 3300001989 Bacteria 1839
6 JGI24737J22298_10000542 3300001990 Bacteria 13246
7 JGI24737J22298_10000692 3300001990 Bacteria 11841
8 JGI24737J22298_10001584 3300001990 Bacteria 8090
9 JGI24737J22298_10016233 3300001990 Bacteria 2404
10 JGI24743J22301_10007926 3300001991 Bacteria 1853
11 JGI24743J22301_10027533 3300001991 Bacteria 1110
12 JGI24738J21930_10015309 3300002075 Bacteria 1634
13 JGI24738J21930_10020728 3300002075 Bacteria 1366
14 JGI24744J21845_10000329 3300002077 Bacteria 7969
15 rootL2_10016393 3300003322 Bacteria 2420
16 Ga0070658_10006175 3300005327 Bacteria 9714
17 Ga0070658_10025606 3300005327 Bacteria 4729
18 Ga0070658_10031623 3300005327 Bacteria 4251
19 Ga0070658_10054560 3300005327 Bacteria 3245
20 Ga0070658_10192827 3300005327 Bacteria 1718
21 Ga0070658_10204665 3300005327 Bacteria 1666
22 Ga0070658_10493271 3300005327 Bacteria 1057
23 Ga0070676_10009217 3300005328 Bacteria 5334
24 Ga0070676_10025188 3300005328 Bacteria 3360
25 Ga0070683_100000846 3300005329 Bacteria 22677
26 Ga0070683_100074027 3300005329 Bacteria 3181
27 Ga0070683_100140707 3300005329 Bacteria 2286
28 Ga0070683_100240111 3300005329 Bacteria 1723
29 Ga0070690_100015433 3300005330 Bacteria 4555
30 Ga0070690_100034476 3300005330 Bacteria 3172
31 Ga0070690_100370898 3300005330 Bacteria 1044
32 Ga0070670_100031775 3300005331 Bacteria 4547
33 Ga0070670_100040271 3300005331 Bacteria 4018
34 Ga0070670_100066321 3300005331 Bacteria 3097
35 Ga0070670_100068604 3300005331 Bacteria 3043
36 Ga0070670_100076321 3300005331 Bacteria 2879
37 Ga0070670_100228112 3300005331 Bacteria 1621
38 Ga0068869_100000728 3300005334 Bacteria 18720
39 Ga0068869_100092515 3300005334 Bacteria 2276
40 Ga0070666_10000784 3300005335 Bacteria 19242
41 Ga0070666_10003320 3300005335 Bacteria 9751
42 Ga0070666_10062089 3300005335 Bacteria 2530
43 Ga0070666_10098559 3300005335 Bacteria 2013
44 Ga0070666_10117760 3300005335 Bacteria 1840
45 Ga0070666_10213220 3300005335 Bacteria 1360
46 Ga0070680_100000971 3300005336 Bacteria 20306
47 Ga0070680_100016912 3300005336 Bacteria 5742
48 Ga0070680_100032124 3300005336 Bacteria 4223
49 Ga0070680_100072566 3300005336 Bacteria 2829
50 Ga0070682_100008674 3300005337 Bacteria 5734
51 Ga0070682_100125012 3300005337 Bacteria 1732
52 Ga0070682_100322990 3300005337 Bacteria 1141
53 Ga0070682_100354125 3300005337 Bacteria 1095
54 Ga0068868_100008379 3300005338 Bacteria 7401
55 Ga0068868_100010669 3300005338 Bacteria 6658
56 Ga0068868_100037007 3300005338 Bacteria 3781
57 Ga0068868_100054984 3300005338 Bacteria 3140
58 Ga0068868_100312205 3300005338 Bacteria 1338
59 Ga0070660_100004392 3300005339 Bacteria 9742
60 Ga0070660_100006501 3300005339 Bacteria 8107
61 Ga0070660_100011788 3300005339 Bacteria 6226
62 Ga0070660_100017265 3300005339 Bacteria 5258
63 Ga0070660_100024885 3300005339 Bacteria 4446
64 Ga0070660_100027054 3300005339 Bacteria 4277
65 Ga0070660_100062645 3300005339 Bacteria 2890
66 Ga0070660_100131426 3300005339 Bacteria 2004
67 Ga0070660_100180228 3300005339 Bacteria 1709
68 Ga0070660_100274541 3300005339 Bacteria 1378
69 Ga0070689_100277602 3300005340 Bacteria 1389
70 Ga0070691_10000317 3300005341 Bacteria 17038
71 Ga0070661_100003518 3300005344 Bacteria 10794
72 Ga0070661_100106266 3300005344 Bacteria 2093
73 Ga0070661_100163737 3300005344 Bacteria 1685
74 Ga0070661_100168430 3300005344 Bacteria 1663
75 Ga0070661_100345469 3300005344 Bacteria 1166
76 Ga0070661_100375654 3300005344 Bacteria 1120
77 Ga0070692_10005091 3300005345 Bacteria 5559
78 Ga0070669_100000565 3300005353 Bacteria 27565
79 Ga0070669_100047531 3300005353 Bacteria 3130
80 Ga0070669_100299215 3300005353 Bacteria 1293
81 Ga0070675_100047118 3300005354 Bacteria 3532
82 Ga0070675_100111392 3300005354 Bacteria 2316
83 Ga0070675_100464049 3300005354 Bacteria 1137
84 Ga0070671_100002084 3300005355 Bacteria 15396
85 Ga0070671_100009573 3300005355 Bacteria 7786
86 Ga0070671_100016983 3300005355 Bacteria 5885
87 Ga0070671_100023561 3300005355 Bacteria 5039
88 Ga0070674_100240171 3300005356 Bacteria 1418
89 Ga0070673_100003973 3300005364 Bacteria 9300
90 Ga0070673_100021894 3300005364 Bacteria 4645
91 Ga0070673_100028727 3300005364 Bacteria 4139
92 Ga0070673_100057329 3300005364 Bacteria 3077
93 Ga0070673_100075272 3300005364 Bacteria 2723
94 Ga0070673_100080104 3300005364 Bacteria 2645
95 Ga0070673_100126532 3300005364 Bacteria 2139
96 Ga0070673_100452846 3300005364 Bacteria 1155
97 Ga0070659_100000887 3300005366 Bacteria 21873
98 Ga0070659_100001567 3300005366 Bacteria 16465
99 Ga0070659_100032065 3300005366 Bacteria 4074
100 Ga0070659_100065993 3300005366 Bacteria 2867
101 Ga0070659_100069938 3300005366 Bacteria 2787
102 Ga0070659_100082828 3300005366 Bacteria 2563
103 Ga0070659_100100516 3300005366 Bacteria 2327
104 Ga0070659_100234005 3300005366 Bacteria 1519
105 Ga0070659_100248448 3300005366 Bacteria 1474
106 Ga0070659_100462408 3300005366 Unclassified 1078
107 Ga0070667_100000764 3300005367 Bacteria 30578
108 Ga0070667_100010885 3300005367 Bacteria 7523
109 Ga0070667_100035741 3300005367 Bacteria 4163
110 Ga0070667_100050410 3300005367 Bacteria 3508
111 Ga0070667_100075138 3300005367 Bacteria 2884
112 Ga0070667_100126572 3300005367 Bacteria 2227
113 Ga0070667_100244306 3300005367 Bacteria 1604
114 Ga0070709_10049343 3300005434 Bacteria 2631
115 Ga0070714_100335091 3300005435 Unclassified 1418
116 Ga0070714_100389813 3300005435 Bacteria 1315
117 Ga0070713_100210184 3300005436 Bacteria 1761
118 Ga0070694_100009204 3300005444 Bacteria 6057
119 Ga0070663_100001696 3300005455 Bacteria 12235
120 Ga0070663_100011726 3300005455 Bacteria 5514
121 Ga0070663_100043165 3300005455 Bacteria 3172
122 Ga0070663_100051506 3300005455 Bacteria 2933
123 Ga0070663_100171438 3300005455 Bacteria 1678
124 Ga0070678_100348807 3300005456 Bacteria 1272
125 Ga0070662_100000047 3300005457 Bacteria 66967
126 Ga0070662_100008398 3300005457 Bacteria 6732
127 Ga0070662_100026387 3300005457 Bacteria 4023
128 Ga0070662_100053388 3300005457 Bacteria 2925
129 Ga0070662_100070691 3300005457 Bacteria 2572
130 Ga0070662_100089457 3300005457 Bacteria 2309
131 Ga0070662_100099087 3300005457 Bacteria 2203
132 Ga0070662_100113433 3300005457 Bacteria 2068
133 Ga0070662_100189452 3300005457 Bacteria 1626
134 Ga0070681_10192961 3300005458 Bacteria 1956
135 Ga0068867_100012344 3300005459 Bacteria 6043
136 Ga0068867_100068213 3300005459 Unclassified 2654
137 Ga0070679_100061012 3300005530 Bacteria 3759
138 Ga0070679_100101931 3300005530 Bacteria 2857
139 Ga0070679_100131140 3300005530 Bacteria 2488
140 Ga0070679_100264835 3300005530 Unclassified 1674
141 Ga0070679_100347296 3300005530 Bacteria 1432
142 Ga0070679_100441914 3300005530 Bacteria 1245
143 Ga0070684_100015644 3300005535 Bacteria 6187
144 Ga0070684_100028521 3300005535 Bacteria 4723
145 Ga0070684_100187484 3300005535 Bacteria 1881
146 Ga0068853_100000033 3300005539 Bacteria 113700
147 Ga0068853_100005485 3300005539 Bacteria 9940
148 Ga0068853_100032634 3300005539 Bacteria 4412
149 Ga0068853_100125191 3300005539 Bacteria 2295
150 Ga0068853_100183860 3300005539 Bacteria 1896
151 Ga0068853_100230173 3300005539 Bacteria 1695
152 Ga0068853_100332233 3300005539 Bacteria 1411
153 Ga0070672_100010512 3300005543 Bacteria 6422
154 Ga0070672_100074735 3300005543 Bacteria 2704
155 Ga0070672_100204553 3300005543 Bacteria 1652
156 Ga0070686_100157745 3300005544 Bacteria 1595
157 Ga0070696_100199908 3300005546 Bacteria 1491
158 Ga0070693_100001255 3300005547 Bacteria 11477
159 Ga0070693_100105467 3300005547 Bacteria 1724
160 Ga0070693_100212860 3300005547 Bacteria 1262
161 Ga0070665_100009636 3300005548 Bacteria 9767
162 Ga0070665_100010704 3300005548 Bacteria 9286
163 Ga0070665_100022897 3300005548 Bacteria 6290
164 Ga0070665_100045989 3300005548 Bacteria 4384
165 Ga0070665_100067978 3300005548 Bacteria 3572
166 Ga0070704_100317540 3300005549 Bacteria 1304
167 Ga0068855_100005847 3300005563 Bacteria 15017
168 Ga0068855_100052849 3300005563 Bacteria 4782
169 Ga0068855_100072569 3300005563 Bacteria 4000
170 Ga0068855_100110052 3300005563 Bacteria 3163
171 Ga0068855_100222500 3300005563 Bacteria 2116
172 Ga0068855_100248015 3300005563 Unclassified 1987
173 Ga0068855_100250463 3300005563 Bacteria 1976
174 Ga0068855_100314468 3300005563 Bacteria 1732
175 Ga0068855_100387993 3300005563 Bacteria 1532
176 Ga0068855_100522439 3300005563 Bacteria 1288
177 Ga0070664_100000066 3300005564 Bacteria 65204
178 Ga0070664_100008785 3300005564 Bacteria 8184
179 Ga0070664_100012124 3300005564 Bacteria 7001
180 Ga0070664_100031007 3300005564 Bacteria 4464
181 Ga0070664_100036798 3300005564 Bacteria 4112
182 Ga0070664_100254465 3300005564 Bacteria 1579
183 Ga0070664_100405614 3300005564 Bacteria 1247
184 Ga0068857_100003003 3300005577 Bacteria 13924
185 Ga0068857_100007256 3300005577 Bacteria 9544
186 Ga0068857_100010273 3300005577 Bacteria 8136
187 Ga0068857_100020025 3300005577 Bacteria 5881
188 Ga0068857_100022914 3300005577 Bacteria 5494
189 Ga0068857_100027971 3300005577 Bacteria 4972
190 Ga0068857_100057007 3300005577 Bacteria 3467
191 Ga0068857_100115040 3300005577 Bacteria 2419
192 Ga0068854_100004155 3300005578 Bacteria 9104
193 Ga0068854_100009153 3300005578 Bacteria 6387
194 Ga0068854_100010935 3300005578 Bacteria 5888
195 Ga0068854_100034029 3300005578 Bacteria 3556
196 Ga0068854_100036074 3300005578 Bacteria 3464
197 Ga0068854_100089019 3300005578 Bacteria 2293
198 Ga0068854_100312939 3300005578 Unclassified 1274
199 Ga0068856_100000162 3300005614 Bacteria 69640
200 Ga0068856_100085927 3300005614 Bacteria 3125
201 Ga0068856_100103381 3300005614 Bacteria 2842
202 Ga0068856_100125238 3300005614 Bacteria 2573
203 Ga0068856_100229197 3300005614 Bacteria 1873
204 Ga0068856_100482665 3300005614 Bacteria 1260
205 Ga0068856_100814131 3300005614 Unclassified 953
206 Ga0068852_100002091 3300005616 Bacteria 13645
207 Ga0068852_100010396 3300005616 Bacteria 6953
208 Ga0068852_100045542 3300005616 Bacteria 3732
209 Ga0068852_100116450 3300005616 Bacteria 2438
210 Ga0068852_100132342 3300005616 Bacteria 2298
211 Ga0068852_100190166 3300005616 Bacteria 1936
212 Ga0068852_100197790 3300005616 Bacteria 1901
213 Ga0068852_100211182 3300005616 Unclassified 1841
214 Ga0068852_100268971 3300005616 Bacteria 1639
215 Ga0068859_100021639 3300005617 Bacteria 6453
216 Ga0068859_100275171 3300005617 Bacteria 1776
217 Ga0068859_100366815 3300005617 Bacteria 1535
218 Ga0068859_100742325 3300005617 Bacteria 1071
219 Ga0068864_100045578 3300005618 Bacteria 3761
220 Ga0068866_10081721 3300005718 Bacteria 1737
221 Ga0068866_10087687 3300005718 Unclassified 1687
222 Ga0068861_100039577 3300005719 Bacteria 3520
223 Ga0068851_10055765 3300005834 Bacteria 2014
224 Ga0068851_10104647 3300005834 Bacteria 1505
225 Ga0068870_10408811 3300005840 Unclassified 885
226 Ga0068863_100005669 3300005841 Bacteria 12265
227 Ga0068863_100007091 3300005841 Bacteria 10986
228 Ga0068863_100017811 3300005841 Bacteria 6799
229 Ga0068863_100023090 3300005841 Bacteria 5944
230 Ga0068863_100055734 3300005841 Bacteria 3743
231 Ga0068863_100728430 3300005841 Bacteria 987
232 Ga0068858_100006383 3300005842 Bacteria 11487
233 Ga0068858_100025462 3300005842 Bacteria 5504
234 Ga0068858_100041297 3300005842 Bacteria 4277
235 Ga0068858_100052236 3300005842 Bacteria 3781
236 Ga0068858_100246148 3300005842 Bacteria 1697
237 Ga0068858_100292225 3300005842 Bacteria 1554
238 Ga0068858_100482509 3300005842 Bacteria 1196
239 Ga0068860_100007040 3300005843 Bacteria 11261
240 Ga0068860_100051533 3300005843 Bacteria 3917
241 Ga0068860_100074629 3300005843 Unclassified 3225
242 Ga0068860_100615309 3300005843 Bacteria 1092
243 Ga0068862_100005282 3300005844 Bacteria 10824
244 Ga0068862_100077464 3300005844 Bacteria 2879
245 Ga0068862_100158906 3300005844 Bacteria 2016
246 Ga0068862_100247475 3300005844 Bacteria 1623
247 Ga0068862_100489479 3300005844 Bacteria 1165
248 Ga0070717_10010474 3300006028 Bacteria 7004
249 Ga0070712_100009442 3300006175 Bacteria 6148
250 Ga0070712_100565103 3300006175 Bacteria 960
251 Ga0097621_100055907 3300006237 Bacteria 3223
252 Ga0097621_100406897 3300006237 Bacteria 1219
253 Ga0068871_100066197 3300006358 Bacteria 2961
254 Ga0068865_100517064 3300006881 Bacteria 998
255 Ga0097620_100021638 3300006931 Bacteria 6453
256 Ga0097620_100275164 3300006931 Bacteria 1776
257 Ga0097620_100366790 3300006931 Bacteria 1535
258 Ga0097620_100742406 3300006931 Bacteria 1071
259 Ga0075435_100207109 3300007076 Bacteria 1663
260 Ga0105240_10032102 3300009093 Bacteria 6801
261 Ga0105240_10043569 3300009093 Bacteria 5709
262 Ga0105240_10070138 3300009093 Bacteria 4336
263 Ga0105240_10227895 3300009093 Bacteria 2167
264 Ga0105245_10000782 3300009098 Bacteria 28837
265 Ga0105245_10189780 3300009098 Unclassified 1968
266 Ga0105245_10420056 3300009098 Unclassified 1340
267 Ga0105245_10573464 3300009098 Bacteria 1152
268 Ga0105243_10169600 3300009148 Bacteria 1889
269 Ga0105243_10244561 3300009148 Bacteria 1598
270 Ga0105241_10030928 3300009174 Bacteria 4004
271 Ga0105241_10046203 3300009174 Bacteria 3306
272 Ga0105241_10117019 3300009174 Bacteria 2141
273 Ga0105241_10131570 3300009174 Bacteria 2026
274 Ga0105241_10603881 3300009174 Unclassified 991
275 Ga0105242_10053531 3300009176 Bacteria 3296
276 Ga0105242_10154828 3300009176 Bacteria 2001
277 Ga0105248_10003721 3300009177 Bacteria 16908
278 Ga0105248_10012199 3300009177 Bacteria 9479
279 Ga0105248_10048261 3300009177 Bacteria 4776
280 Ga0105248_10081065 3300009177 Bacteria 3648
281 Ga0105248_10191344 3300009177 Bacteria 2306
282 Ga0105237_10010459 3300009545 Bacteria 9865
283 Ga0105237_10078383 3300009545 Unclassified 3294
284 Ga0105238_10037975 3300009551 Bacteria 4894
285 Ga0105238_10041123 3300009551 Bacteria 4682
286 Ga0105238_10046723 3300009551 Bacteria 4367
287 Ga0105238_10096775 3300009551 Bacteria 2937
288 Ga0105238_10121785 3300009551 Bacteria 2588
289 Ga0105238_10384755 3300009551 Bacteria 1395
290 Ga0105238_10399044 3300009551 Bacteria 1368
291 Ga0105249_10129924 3300009553 Unclassified 2403
292 Ga0105249_10290631 3300009553 Bacteria 1636
293 Ga0105249_10749572 3300009553 Bacteria 1039
294 Ga0105239_10235909 3300010375 Unclassified 2053
295 Ga0105239_10300502 3300010375 Unclassified 1807
296 Ga0105246_10064863 3300011119 Bacteria 2553
297 Ga0105246_10229467 3300011119 Bacteria 1461
298 Ga0105246_10381103 3300011119 Bacteria 1165
299 Ga0157373_10004543 3300013100 Bacteria 10431
300 Ga0157373_10012009 3300013100 Bacteria 6366
301 Ga0157373_10026182 3300013100 Bacteria 4215
302 Ga0157373_10032530 3300013100 Bacteria 3754
303 Ga0157373_10039353 3300013100 Bacteria 3386
304 Ga0157373_10052668 3300013100 Bacteria 2895
305 Ga0157373_10076014 3300013100 Bacteria 2370
306 Ga0157373_10088159 3300013100 Bacteria 2186
307 Ga0157373_10130908 3300013100 Bacteria 1765
308 Ga0157373_10201820 3300013100 Bacteria 1402
309 Ga0157371_10039467 3300013102 Bacteria 3375
310 Ga0157371_10081208 3300013102 Bacteria 2295
311 Ga0157371_10093477 3300013102 Bacteria 2131
312 Ga0157371_10106406 3300013102 Bacteria 1990
313 Ga0157371_10151371 3300013102 Bacteria 1655
314 Ga0157371_10172066 3300013102 Bacteria 1548
315 Ga0157371_10183291 3300013102 Bacteria 1498
316 Ga0157370_10009228 3300013104 Bacteria 10573
317 Ga0157370_10009365 3300013104 Bacteria 10475
318 Ga0157370_10042285 3300013104 Bacteria 4393
319 Ga0157369_10011303 3300013105 Bacteria 10143
320 Ga0157369_10026642 3300013105 Bacteria 6411
321 Ga0157369_10029866 3300013105 Bacteria 6019
322 Ga0157369_10086612 3300013105 Bacteria 3345
323 Ga0157369_10111223 3300013105 Unclassified 2911
324 Ga0157369_10154089 3300013105 Bacteria 2428
325 Ga0157369_10190590 3300013105 Bacteria 2155
326 Ga0157369_10213548 3300013105 Bacteria 2022
327 Ga0157369_10318242 3300013105 Bacteria 1618
328 Ga0157369_10546448 3300013105 Bacteria 1197
329 Ga0157374_10012401 3300013296 Bacteria 7415
330 Ga0157374_10320997 3300013296 Bacteria 1535
331 Ga0157378_10341621 3300013297 Bacteria 1460
332 Ga0157378_10511267 3300013297 Bacteria 1201
333 Ga0157378_10786420 3300013297 Bacteria 976
334 Ga0163162_10037065 3300013306 Bacteria 4864
335 Ga0163162_10063325 3300013306 Bacteria 3740
336 Ga0163162_10120409 3300013306 Unclassified 2728
337 Ga0157372_10056188 3300013307 Bacteria 4398
338 Ga0157372_10065516 3300013307 Bacteria 4079
339 Ga0157372_10119882 3300013307 Bacteria 3020
340 Ga0157372_10525572 3300013307 Bacteria 1379
341 Ga0157372_10691631 3300013307 Bacteria 1187
342 Ga0157375_10180307 3300013308 Bacteria 2263
343 Ga0157375_10319983 3300013308 Bacteria 1716
344 Ga0163163_10217594 3300014325 Bacteria 1959
345 Ga0182008_10064369 3300014497 Bacteria 1805
346 Ga0157377_10058397 3300014745 Bacteria 2197
347 Ga0157377_10080839 3300014745 Bacteria 1900
348 Ga0157379_10017407 3300014968 Bacteria 6330
349 Ga0157376_10003636 3300014969 Bacteria 10641
350 Ga0197907_10160736 3300020069 Bacteria 1260
351 Ga0206356_11518027 3300020070 Bacteria 1056
352 Ga0224712_10135891 3300022467 Bacteria 1078
353 Ga0207697_10000162 3300025315 Bacteria 33553
354 Ga0207697_10024732 3300025315 Bacteria 2457
355 Ga0207697_10034827 3300025315 Bacteria 2061
356 Ga0207656_10201455 3300025321 Bacteria 961
357 Ga0207642_10063885 3300025899 Bacteria 1723
358 Ga0207688_10000909 3300025901 Bacteria 14961
359 Ga0207680_10001490 3300025903 Bacteria 11062
360 Ga0207680_10013511 3300025903 Bacteria 4197
361 Ga0207647_10000073 3300025904 Bacteria 76404
362 Ga0207647_10001093 3300025904 Bacteria 20911
363 Ga0207647_10001424 3300025904 Bacteria 18340
364 Ga0207647_10007124 3300025904 Bacteria 8108
365 Ga0207647_10027780 3300025904 Bacteria 3685
366 Ga0207647_10063967 3300025904 Bacteria 2236
367 Ga0207647_10114561 3300025904 Bacteria 1593
368 Ga0207647_10163935 3300025904 Bacteria 1296
369 Ga0207699_10046160 3300025906 Bacteria 2546
370 Ga0207645_10005215 3300025907 Bacteria 9473
371 Ga0207645_10025315 3300025907 Bacteria 3840
372 Ga0207645_10084702 3300025907 Bacteria 2035
373 Ga0207645_10090463 3300025907 Bacteria 1968
374 Ga0207705_10005195 3300025909 Bacteria 9759
375 Ga0207705_10043846 3300025909 Bacteria 3214
376 Ga0207705_10240702 3300025909 Bacteria 1378
377 Ga0207705_10246754 3300025909 Bacteria 1361
378 Ga0207654_10027047 3300025911 Bacteria 3114
379 Ga0207707_10084991 3300025912 Bacteria 2764
380 Ga0207707_10210340 3300025912 Bacteria 1695
381 Ga0207695_10012117 3300025913 Bacteria 10363
382 Ga0207695_10116166 3300025913 Bacteria 2650
383 Ga0207695_10184346 3300025913 Bacteria 2007
384 Ga0207671_10163149 3300025914 Bacteria 1726
385 Ga0207693_10012012 3300025915 Bacteria 7001
386 Ga0207693_10027018 3300025915 Bacteria 4539
387 Ga0207660_10001465 3300025917 Bacteria 15872
388 Ga0207660_10161929 3300025917 Bacteria 1727
389 Ga0207660_10362985 3300025917 Bacteria 1162
390 Ga0207660_10442184 3300025917 Bacteria 1051
391 Ga0207657_10005786 3300025919 Bacteria 12891
392 Ga0207657_10007431 3300025919 Bacteria 11239
393 Ga0207657_10009175 3300025919 Bacteria 9975
394 Ga0207657_10009587 3300025919 Bacteria 9719
395 Ga0207657_10030651 3300025919 Bacteria 4880
396 Ga0207657_10033906 3300025919 Bacteria 4597
397 Ga0207657_10034062 3300025919 Bacteria 4584
398 Ga0207657_10039012 3300025919 Bacteria 4223
399 Ga0207657_10040290 3300025919 Bacteria 4141
400 Ga0207657_10066559 3300025919 Bacteria 3066
401 Ga0207657_10075768 3300025919 Bacteria 2839
402 Ga0207657_10263064 3300025919 Unclassified 1372
403 Ga0207649_10002318 3300025920 Bacteria 10692
404 Ga0207649_10009296 3300025920 Bacteria 5377
405 Ga0207649_10013315 3300025920 Bacteria 4589
406 Ga0207649_10057339 3300025920 Bacteria 2435
407 Ga0207649_10091128 3300025920 Bacteria 1996
408 Ga0207649_10095186 3300025920 Bacteria 1959
409 Ga0207649_10212739 3300025920 Bacteria 1372
410 Ga0207649_10245283 3300025920 Bacteria 1288
411 Ga0207649_10368720 3300025920 Bacteria 1067
412 Ga0207652_10193911 3300025921 Bacteria 1827
413 Ga0207652_10202000 3300025921 Unclassified 1789
414 Ga0207652_10215420 3300025921 Bacteria 1730
415 Ga0207652_10249866 3300025921 Bacteria 1599
416 Ga0207681_10487061 3300025923 Bacteria 1008
417 Ga0207681_10652510 3300025923 Unclassified 872
418 Ga0207694_10003870 3300025924 Bacteria 11838
419 Ga0207694_10028276 3300025924 Bacteria 4274
420 Ga0207694_10045103 3300025924 Unclassified 3405
421 Ga0207650_10022685 3300025925 Bacteria 4446
422 Ga0207650_10051253 3300025925 Bacteria 3054
423 Ga0207650_10069072 3300025925 Bacteria 2654
424 Ga0207650_10100108 3300025925 Bacteria 2230
425 Ga0207650_10127311 3300025925 Bacteria 1989
426 Ga0207650_10150517 3300025925 Bacteria 1836
427 Ga0207650_10177023 3300025925 Bacteria 1698
428 Ga0207659_10062757 3300025926 Bacteria 2683
429 Ga0207659_10125168 3300025926 Bacteria 1975
430 Ga0207687_10008779 3300025927 Bacteria 6605
431 Ga0207687_10156335 3300025927 Bacteria 1745
432 Ga0207687_10268254 3300025927 Unclassified 1363
433 Ga0207700_10140519 3300025928 Bacteria 1983
434 Ga0207664_10270215 3300025929 Bacteria 1489
435 Ga0207664_10382513 3300025929 Unclassified 1249
436 Ga0207644_10030510 3300025931 Bacteria 3750
437 Ga0207644_10078102 3300025931 Bacteria 2439
438 Ga0207644_10116681 3300025931 Bacteria 2026
439 Ga0207644_10123093 3300025931 Unclassified 1977
440 Ga0207644_10472246 3300025931 Bacteria 1032
441 Ga0207690_10000777 3300025932 Bacteria 20661
442 Ga0207690_10002539 3300025932 Bacteria 11030
443 Ga0207690_10012424 3300025932 Bacteria 5092
444 Ga0207690_10031983 3300025932 Bacteria 3372
445 Ga0207690_10034134 3300025932 Unclassified 3276
446 Ga0207690_10064193 3300025932 Unclassified 2506
447 Ga0207690_10066305 3300025932 Bacteria 2472
448 Ga0207690_10093466 3300025932 Bacteria 2131
449 Ga0207690_10216174 3300025932 Bacteria 1464
450 Ga0207690_10410545 3300025932 Bacteria 1081
451 Ga0207690_10572433 3300025932 Bacteria 920
452 Ga0207706_10001063 3300025933 Bacteria 27913
453 Ga0207706_10006873 3300025933 Bacteria 10519
454 Ga0207706_10008071 3300025933 Bacteria 9716
455 Ga0207706_10020060 3300025933 Bacteria 6006
456 Ga0207706_10045866 3300025933 Bacteria 3871
457 Ga0207706_10057661 3300025933 Bacteria 3421
458 Ga0207706_10060769 3300025933 Bacteria 3328
459 Ga0207706_10388058 3300025933 Bacteria 1211
460 Ga0207686_10063874 3300025934 Bacteria 2343
461 Ga0207709_10167581 3300025935 Bacteria 1538
462 Ga0207709_10209660 3300025935 Bacteria 1397
463 Ga0207709_10297572 3300025935 Bacteria 1199
464 Ga0207669_10192884 3300025937 Bacteria 1471
465 Ga0207691_10001499 3300025940 Bacteria 23257
466 Ga0207691_10012981 3300025940 Bacteria 7977
467 Ga0207691_10051374 3300025940 Bacteria 3769
468 Ga0207691_10112349 3300025940 Bacteria 2422
469 Ga0207711_10000174 3300025941 Bacteria 69263
470 Ga0207711_10002763 3300025941 Bacteria 15458
471 Ga0207711_10006114 3300025941 Bacteria 10167
472 Ga0207711_10012069 3300025941 Bacteria 7182
473 Ga0207711_10185701 3300025941 Bacteria 1892
474 Ga0207711_10217053 3300025941 Bacteria 1748
475 Ga0207711_10545103 3300025941 Unclassified 1082
476 Ga0207689_10000167 3300025942 Bacteria 57116
477 Ga0207689_10054262 3300025942 Bacteria 3301
478 Ga0207689_10083687 3300025942 Bacteria 2623
479 Ga0207689_10136316 3300025942 Bacteria 2021
480 Ga0207661_10023773 3300025944 Bacteria 4635
481 Ga0207661_10033964 3300025944 Bacteria 3962
482 Ga0207661_10145331 3300025944 Unclassified 2045
483 Ga0207661_10209057 3300025944 Bacteria 1719
484 Ga0207661_10429043 3300025944 Bacteria 1201
485 Ga0207679_10000150 3300025945 Bacteria 57426
486 Ga0207679_10030926 3300025945 Bacteria 3743
487 Ga0207679_10064246 3300025945 Bacteria 2743
488 Ga0207679_10274539 3300025945 Bacteria 1443
489 Ga0207679_10388833 3300025945 Unclassified 1224
490 Ga0207679_10406272 3300025945 Unclassified 1199
491 Ga0207667_10000443 3300025949 Bacteria 55591
492 Ga0207667_10012419 3300025949 Bacteria 9816
493 Ga0207667_10084992 3300025949 Bacteria 3275
494 Ga0207667_10095828 3300025949 Bacteria 3063
495 Ga0207667_10115121 3300025949 Bacteria 2771
496 Ga0207667_10130830 3300025949 Bacteria 2585
497 Ga0207667_10200743 3300025949 Bacteria 2046
498 Ga0207667_10647519 3300025949 Bacteria 1062
499 Ga0207667_10735103 3300025949 Bacteria 987
500 Ga0207667_10825876 3300025949 Bacteria 922
501 Ga0207667_10870317 3300025949 Unclassified 894
502 Ga0207651_10011170 3300025960 Bacteria 5013
503 Ga0207651_10043708 3300025960 Bacteria 2993
504 Ga0207651_10083644 3300025960 Bacteria 2308
505 Ga0207651_10087729 3300025960 Bacteria 2265
506 Ga0207651_10103766 3300025960 Bacteria 2116
507 Ga0207651_10127485 3300025960 Bacteria 1942
508 Ga0207651_10168464 3300025960 Bacteria 1725
509 Ga0207712_10011567 3300025961 Bacteria 5626
510 Ga0207668_10119060 3300025972 Bacteria 1996
511 Ga0207668_10160699 3300025972 Bacteria 1750
512 Ga0207640_10029943 3300025981 Bacteria 3348
513 Ga0207640_10071530 3300025981 Bacteria 2336
514 Ga0207640_10122069 3300025981 Bacteria 1868
515 Ga0207640_10136322 3300025981 Bacteria 1782
516 Ga0207640_10616283 3300025981 Bacteria 921
517 Ga0207658_10004413 3300025986 Bacteria 9786
518 Ga0207658_10005682 3300025986 Bacteria 8529
519 Ga0207658_10006022 3300025986 Bacteria 8284
520 Ga0207658_10114190 3300025986 Bacteria 2141
521 Ga0207658_10423650 3300025986 Bacteria 1174
522 Ga0207677_10003531 3300026023 Bacteria 8284
523 Ga0207677_10141284 3300026023 Bacteria 1844
524 Ga0207677_10146424 3300026023 Bacteria 1816
525 Ga0207677_10282027 3300026023 Bacteria 1364
526 Ga0207677_10304529 3300026023 Bacteria 1318
527 Ga0207703_10004057 3300026035 Bacteria 12096
528 Ga0207703_10014553 3300026035 Bacteria 6138
529 Ga0207703_10020601 3300026035 Bacteria 5159
530 Ga0207703_10023164 3300026035 Bacteria 4877
531 Ga0207703_10037572 3300026035 Bacteria 3857
532 Ga0207703_10274036 3300026035 Bacteria 1530
533 Ga0207703_10382311 3300026035 Unclassified 1302
534 Ga0207703_10478409 3300026035 Bacteria 1167
535 Ga0207703_10720787 3300026035 Bacteria 949
536 Ga0207639_10000144 3300026041 Bacteria 53312
537 Ga0207639_10000851 3300026041 Bacteria 20742
538 Ga0207639_10008734 3300026041 Bacteria 6957
539 Ga0207639_10027181 3300026041 Bacteria 4165
540 Ga0207639_10031620 3300026041 Bacteria 3891
541 Ga0207639_10042855 3300026041 Bacteria 3394
542 Ga0207639_10111985 3300026041 Bacteria 2226
543 Ga0207639_10118008 3300026041 Bacteria 2175
544 Ga0207639_10138524 3300026041 Bacteria 2025
545 Ga0207639_10163407 3300026041 Bacteria 1878
546 Ga0207678_10005023 3300026067 Bacteria 11868
547 Ga0207678_10021716 3300026067 Bacteria 5629
548 Ga0207678_10024585 3300026067 Bacteria 5261
549 Ga0207678_10039002 3300026067 Bacteria 4124
550 Ga0207678_10041699 3300026067 Bacteria 3979
551 Ga0207678_10052954 3300026067 Bacteria 3499
552 Ga0207678_10062108 3300026067 Bacteria 3212
553 Ga0207702_10005597 3300026078 Bacteria 10968
554 Ga0207702_10010053 3300026078 Bacteria 7931
555 Ga0207702_10037906 3300026078 Bacteria 4037
556 Ga0207702_10186975 3300026078 Bacteria 1911
557 Ga0207702_10195004 3300026078 Bacteria 1874
558 Ga0207641_10011660 3300026088 Bacteria 7217
559 Ga0207641_10016621 3300026088 Bacteria 6024
560 Ga0207641_10175380 3300026088 Bacteria 1960
561 Ga0207641_10355789 3300026088 Bacteria 1396
562 Ga0207641_10394895 3300026088 Bacteria 1327
563 Ga0207648_10023887 3300026089 Bacteria 5466
564 Ga0207648_10046120 3300026089 Bacteria 3821
565 Ga0207648_10058078 3300026089 Unclassified 3375
566 Ga0207648_10138611 3300026089 Bacteria 2143
567 Ga0207676_10002947 3300026095 Bacteria 12135
568 Ga0207676_10374005 3300026095 Bacteria 1324
569 Ga0207676_10462491 3300026095 Unclassified 1198
570 Ga0207674_10002073 3300026116 Bacteria 25416
571 Ga0207674_10005768 3300026116 Bacteria 14688
572 Ga0207674_10007637 3300026116 Bacteria 12593
573 Ga0207674_10009450 3300026116 Bacteria 11141
574 Ga0207674_10016402 3300026116 Bacteria 8110
575 Ga0207674_10019921 3300026116 Bacteria 7259
576 Ga0207674_10033866 3300026116 Bacteria 5344
577 Ga0207674_10081185 3300026116 Bacteria 3244
578 Ga0207674_10107894 3300026116 Bacteria 2761
579 Ga0207674_10119424 3300026116 Bacteria 2605
580 Ga0207674_10482367 3300026116 Bacteria 1198
581 Ga0207675_100046661 3300026118 Bacteria 4048
582 Ga0207675_100268810 3300026118 Bacteria 1654
583 Ga0207683_10026205 3300026121 Bacteria 5032
584 Ga0207683_10296509 3300026121 Bacteria 1479
585 Ga0207698_10002267 3300026142 Bacteria 11384
586 Ga0207698_10006878 3300026142 Bacteria 7116
587 Ga0207698_10020567 3300026142 Bacteria 4545
588 Ga0207698_10030800 3300026142 Bacteria 3864
589 Ga0207698_10041600 3300026142 Bacteria 3426
590 Ga0207698_10085736 3300026142 Bacteria 2559
591 Ga0207698_10101990 3300026142 Bacteria 2381
592 Ga0207698_10152858 3300026142 Bacteria 2006
593 Ga0207698_10160349 3300026142 Bacteria 1966
594 Ga0207698_10378278 3300026142 Bacteria 1346
595 Ga0207698_10503527 3300026142 Bacteria 1179
596 Ga0207698_10633887 3300026142 Bacteria 1057
597 Ga0268266_10014546 3300028379 Bacteria 6762
598 Ga0268266_10025415 3300028379 Bacteria 5038
599 Ga0268266_10088056 3300028379 Bacteria 2717
600 Ga0268265_10008862 3300028380 Bacteria 6798
601 Ga0268265_10026471 3300028380 Bacteria 4127
602 Ga0268265_10060149 3300028380 Bacteria 2910
603 Ga0268264_10001230 3300028381 Bacteria 24597
604 Ga0268264_10008487 3300028381 Bacteria 8542
605 Ga0268264_10074618 3300028381 Bacteria 2882
606 Ga0268264_10216856 3300028381 Bacteria 1760
607 Ga0307408_100051958 3300031548 Bacteria 2955
608 Ga0307405_10341223 3300031731 Unclassified 1152
609 Ga0307413_10144753 3300031824 Bacteria 1648
610 Ga0307413_10193030 3300031824 Bacteria 1464
611 Ga0307410_10008595 3300031852 Bacteria 5672
612 Ga0307410_10012752 3300031852 Bacteria 4874
613 Ga0307407_10051571 3300031903 Bacteria 2359
614 Ga0307407_10130099 3300031903 Bacteria 1609
615 Ga0307409_100008491 3300031995 Bacteria 6240
616 Ga0307409_100104360 3300031995 Bacteria 2360
617 Ga0307409_100380131 3300031995 Bacteria 1342
618 Ga0307409_100489379 3300031995 Bacteria 1195
619 Ga0307414_10131779 3300032004 Bacteria 1942
620 Ga0307414_10217176 3300032004 Bacteria 1567
621 Ga0307411_10041808 3300032005 Bacteria 2920
622 Ga0307411_10099180 3300032005 Bacteria 2055
623 Ga0307411_10650256 3300032005 Bacteria 913
624 Ga0307415_100019598 3300032126 Bacteria 4111
625 Ga0307415_100216363 3300032126 Unclassified 1532
626 Ga0373932_0093526 3300035112 Bacteria 968
627 Ga0373941_0044643 3300035115 Bacteria 1384
628 Ga0373943_0010052 3300035170 Bacteria 4244
629 Ga0373931_0007229 3300035691 Bacteria 5226
630 Ga0373935_0033605 3300035692 Bacteria 3193
631 Ga0373927_0030225 3300035695 Bacteria 3535
632 Ga0395899_0001070 3300037312 Bacteria 24709
633 Ga0395899_0003599 3300037312 Bacteria 12253
634 Ga0395899_0004952 3300037312 Bacteria 10362
635 Ga0395899_0013798 3300037312 Bacteria 6176
636 Ga0395899_0043275 3300037312 Bacteria 3359
637 Ga0395899_0051492 3300037312 Bacteria 3055
638 Ga0395899_0052893 3300037312 Bacteria 3008
639 Ga0395899_0061498 3300037312 Unclassified 2766
640 Ga0395899_0064142 3300037312 Bacteria 2701
641 Ga0395899_0079880 3300037312 Bacteria 2382
642 Ga0395899_0158291 3300037312 Bacteria 1601
643 Ga0395899_0228285 3300037312 Bacteria 1286
644 Ga0395899_0247244 3300037312 Bacteria 1225
645 Ga0395900_0001041 3300037418 Bacteria 35559
646 Ga0395900_0011436 3300037418 Bacteria 9085
647 Ga0395900_0011750 3300037418 Bacteria 8952
648 Ga0395900_0015887 3300037418 Bacteria 7668
649 Ga0395900_0016938 3300037418 Bacteria 7438
650 Ga0395900_0018396 3300037418 Bacteria 7125
651 Ga0395900_0030614 3300037418 Bacteria 5526
652 Ga0395900_0036432 3300037418 Bacteria 5072
653 Ga0395900_0051015 3300037418 Bacteria 4262
654 Ga0395900_0051432 3300037418 Bacteria 4244
655 Ga0395900_0055439 3300037418 Bacteria 4081
656 Ga0395900_0060798 3300037418 Bacteria 3886
657 Ga0395900_0069555 3300037418 Bacteria 3618
658 Ga0395900_0073055 3300037418 Bacteria 3526
659 Ga0395900_0089716 3300037418 Bacteria 3159
660 Ga0395900_0135243 3300037418 Bacteria 2525
661 Ga0395900_0211647 3300037418 Bacteria 1957
662 Ga0395900_0256408 3300037418 Bacteria 1748
663 Ga0395900_0317046 3300037418 Bacteria 1540
664 Ga0395900_0342415 3300037418 Bacteria 1470
665 Ga0395900_0442876 3300037418 Unclassified 1256
666 Ga0395898_0000274 3300037466 Bacteria 125922
667 Ga0395898_0010300 3300037466 Bacteria 9783
668 Ga0395898_0012715 3300037466 Bacteria 8693
669 Ga0395898_0018438 3300037466 Bacteria 7116
670 Ga0395898_0018633 3300037466 Bacteria 7077
671 Ga0395898_0026753 3300037466 Bacteria 5798
672 Ga0395898_0052351 3300037466 Bacteria 3988
673 Ga0395898_0057015 3300037466 Bacteria 3806
674 Ga0395898_0070310 3300037466 Bacteria 3384
675 Ga0395898_0082203 3300037466 Bacteria 3105
676 Ga0395898_0098696 3300037466 Bacteria 2804
677 Ga0395898_0103557 3300037466 Bacteria 2731
678 Ga0395898_0110180 3300037466 Bacteria 2639
679 Ga0395898_0119310 3300037466 Bacteria 2526
680 Ga0395898_0128875 3300037466 Bacteria 2424
681 Ga0395898_0182841 3300037466 Bacteria 2003
682 Ga0395898_0204619 3300037466 Bacteria 1884
683 Ga0395898_0530800 3300037466 Bacteria 1118
684 Ga0395905_0000006 3300037471 Bacteria 549428
685 Ga0395905_0002330 3300037471 Bacteria 21202
686 Ga0395905_0006965 3300037471 Bacteria 11301
687 Ga0395905_0007371 3300037471 Bacteria 10948
688 Ga0395905_0008869 3300037471 Bacteria 9879
689 Ga0395905_0009804 3300037471 Bacteria 9334
690 Ga0395905_0012465 3300037471 Bacteria 8184
691 Ga0395905_0014564 3300037471 Bacteria 7502
692 Ga0395905_0015854 3300037471 Bacteria 7158
693 Ga0395905_0024002 3300037471 Bacteria 5757
694 Ga0395905_0028407 3300037471 Bacteria 5274
695 Ga0395905_0028927 3300037471 Bacteria 5223
696 Ga0395905_0030832 3300037471 Bacteria 5050
697 Ga0395905_0039882 3300037471 Bacteria 4405
698 Ga0395905_0040679 3300037471 Bacteria 4361
699 Ga0395905_0041117 3300037471 Bacteria 4337
700 Ga0395905_0041722 3300037471 Bacteria 4306
701 Ga0395905_0043636 3300037471 Bacteria 4206
702 Ga0395905_0043749 3300037471 Bacteria 4200
703 Ga0395905_0066910 3300037471 Bacteria 3365
704 Ga0395905_0079934 3300037471 Bacteria 3064
705 Ga0395905_0100472 3300037471 Bacteria 2716
706 Ga0395905_0123550 3300037471 Unclassified 2434
707 Ga0395905_0146543 3300037471 Bacteria 2221
708 Ga0395905_0158139 3300037471 Bacteria 2131
709 Ga0395905_0217418 3300037471 Bacteria 1789
710 Ga0395905_0217989 3300037471 Bacteria 1786
711 Ga0395905_0222917 3300037471 Bacteria 1764
712 Ga0395905_0241556 3300037471 Bacteria 1688
713 Ga0395905_0282326 3300037471 Bacteria 1546
714 Ga0395905_0292166 3300037471 Bacteria 1516
715 Ga0395905_0380693 3300037471 Unclassified 1305
716 Ga0395905_0547511 3300037471 Bacteria 1058
717 Ga0395905_0592253 3300037471 Bacteria 1010
718 Ga0395901_0001959 3300038443 Bacteria 21168
719 Ga0395901_0009696 3300038443 Bacteria 9767
720 Ga0395901_0019006 3300038443 Bacteria 7024
721 Ga0395901_0026433 3300038443 Bacteria 5960
722 Ga0395901_0027042 3300038443 Bacteria 5892
723 Ga0395901_0032560 3300038443 Bacteria 5379
724 Ga0395901_0040796 3300038443 Bacteria 4807
725 Ga0395901_0055766 3300038443 Bacteria 4110
726 Ga0395901_0067747 3300038443 Bacteria 3718
727 Ga0395901_0070145 3300038443 Bacteria 3651
728 Ga0395901_0070313 3300038443 Bacteria 3646
729 Ga0395901_0070384 3300038443 Bacteria 3644
730 Ga0395901_0091439 3300038443 Bacteria 3185
731 Ga0395901_0092854 3300038443 Bacteria 3159
732 Ga0395901_0093959 3300038443 Bacteria 3141
733 Ga0395901_0105170 3300038443 Bacteria 2962
734 Ga0395901_0155176 3300038443 Bacteria 2404
735 Ga0395901_0158354 3300038443 Bacteria 2378
736 Ga0395901_0544706 3300038443 Bacteria 1176
737 Ga0436365_0088937 3300039437 Bacteria 9210
738 Ga0436363_0494724 3300039450 Unclassified 3087
739 Ga0439448_0084479 3300042005 Bacteria 1069
740 Ga0439458_0000160 3300042157 Bacteria 14953
741 Ga0439458_0000210 3300042157 Bacteria 13702
742 Ga0439464_0001497 3300042439 Bacteria 5519
743 Ga0466969_0084563 3300044656 Bacteria 1510
744 Ga0466972_0059130 3300044658 Unclassified 1840
745 Ga0466966_0065027 3300044684 Bacteria 2294
746 Ga0466966_0090485 3300044684 Unclassified 1900
747 Ga0466961_0062189 3300044693 Bacteria 2372
748 Ga0466963_0002633 3300044694 Bacteria 10082
749 Ga0466963_0018355 3300044694 Bacteria 4372
750 Ga0466963_0036678 3300044694 Bacteria 3198
751 Ga0466963_0044717 3300044694 Bacteria 2915
752 Ga0466963_0048807 3300044694 Bacteria 2798
753 Ga0466963_0086494 3300044694 Bacteria 2130
754 Ga0466963_0128728 3300044694 Bacteria 1747
755 Ga0466963_0149665 3300044694 Bacteria 1620
756 Ga0466964_0038586 3300044706 Unclassified 1921
757 Ga0466968_0007068 3300044735 Bacteria 4256
758 Ga0466970_0017655 3300044765 Bacteria 3688
759 Ga0466970_0206689 3300044765 Unclassified 1093
760 Ga0466957_0010777 3300044842 Bacteria 5256
761 Ga0466957_0044633 3300044842 Bacteria 2687
762 Ga0466957_0052930 3300044842 Bacteria 2473
763 Ga0466957_0143719 3300044842 Bacteria 1539
764 Ga0466957_0171484 3300044842 Bacteria 1413
765 Ga0466957_0191531 3300044842 Bacteria 1340
766 Ga0466957_0323511 3300044842 Unclassified 1041
767 Ga0466960_0096498 3300044901 Bacteria 1516
768 Ga0466959_0102285 3300045049 Bacteria 2050
769 Ga0466959_0166311 3300045049 Bacteria 1549
770 Ga0466958_0025655 3300045836 Unclassified 3477
771 Ga0466958_0084515 3300045836 Bacteria 1957
772 Ga0466958_0145083 3300045836 Bacteria 1496
773 Ga0466958_0366852 3300045836 Bacteria 928
774 Ga0466967_0001266 3300045976 Bacteria 14316
775 Ga0466967_0001564 3300045976 Bacteria 13420
776 Ga0466967_0016471 3300045976 Bacteria 5831
777 Ga0466967_0026824 3300045976 Bacteria 4780
778 Ga0466967_0041175 3300045976 Bacteria 3981
779 Ga0466967_0114265 3300045976 Bacteria 2485
780 Ga0466967_0159908 3300045976 Bacteria 2113
781 Ga0466967_0421432 3300045976 Bacteria 1301
782 Ga0466967_0450821 3300045976 Bacteria 1257
783 Ga0466967_0544825 3300045976 Bacteria 1142
784 Ga0495598_0002323 3300046537 Bacteria 3914
785 Ga0495621_0013285 3300046539 Bacteria 2583
786 Ga0495669_0000565 3300046684 Bacteria 16363
787 Ga0495669_0015372 3300046684 Bacteria 3277
788 Ga0495669_0049680 3300046684 Bacteria 1879
789 Ga0495669_0092589 3300046684 Bacteria 1397
790 Ga0495670_0002417 3300046691 Bacteria 9216
791 Ga0495680_0443954 3300047322 Bacteria 889
792 Ga0495677_0098655 3300047445 Bacteria 1104
793 Ga0496102_0118775 3300048905 Bacteria 2468
794 Ga0496102_0770591 3300048905 Bacteria 885
795 Ga0496103_0139436 3300048906 Bacteria 1550
796 Ga0496103_0230677 3300048906 Bacteria 1191
797 Ga0496105_0113231 3300048908 Bacteria 2239
798 Ga0496105_0495936 3300048908 Unclassified 959
799 Ga0496107_0038682 3300048910 Bacteria 3421
800 Ga0496108_0000974 3300048911 Bacteria 22322
801 Ga0496108_0019724 3300048911 Bacteria 5538
802 Ga0496109_0072772 3300048912 Bacteria 3158
803 Ga0496110_0016722 3300048913 Bacteria 6127
804 Ga0496110_0127035 3300048913 Bacteria 2301
805 Ga0496111_0038294 3300048914 Bacteria 3435
806 Ga0496111_0118684 3300048914 Bacteria 1953
807 Ga0496112_0001713 3300048915 Bacteria 17129
808 Ga0496112_0067660 3300048915 Bacteria 3526
809 Ga0496112_0098255 3300048915 Bacteria 2897
810 Ga0496112_0111558 3300048915 Bacteria 2704
811 Ga0496113_0014119 3300048916 Bacteria 5437
812 Ga0496113_0040294 3300048916 Unclassified 3442
813 Ga0501074_0363173 3300049590 Bacteria 1027
814 Ga0501079_0271079 3300049741 Bacteria 1327
815 Ga0501080_0019604 3300049742 Bacteria 6266
816 Ga0501268_012010 3300049765 Bacteria 1378
817 nmdc:mga0n895_311061_c1 3300050512 Bacteria 1596
818 nmdc:mga0sz30_175949_c1 3300050516 Bacteria 949
819 Ga0466962_0138593 3300061719 Unclassified 1178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10177023 Ga0207650_101770232 202
2 3300025907 Ga0207645_10084702 Ga0207645_100847021 203
3 3300001990 JGI24737J22298_10016233 JGI24737J22298_100162333 206
4 3300005345 Ga0070692_10005091 Ga0070692_100050915 206
5 3300005353 Ga0070669_100299215 Ga0070669_1002992151 206
6 3300005444 Ga0070694_100009204 Ga0070694_1000092045 206
7 3300005457 Ga0070662_100008398 Ga0070662_1000083986 206
8 3300005543 Ga0070672_100010512 Ga0070672_1000105122 206
9 3300005563 Ga0068855_100072569 Ga0068855_1000725692 206
10 3300005564 Ga0070664_100405614 Ga0070664_1004056142 206
11 3300005577 Ga0068857_100115040 Ga0068857_1001150402 206
12 3300005841 Ga0068863_100728430 Ga0068863_1007284302 206
13 3300005843 Ga0068860_100074629 Ga0068860_1000746291 206
14 3300005844 Ga0068862_100077464 Ga0068862_1000774642 206
15 3300006881 Ga0068865_100517064 Ga0068865_1005170641 206
16 3300009093 Ga0105240_10227895 Ga0105240_102278952 206
17 3300009174 Ga0105241_10603881 Ga0105241_106038812 206
18 3300009553 Ga0105249_10129924 Ga0105249_101299241 206
19 3300010375 Ga0105239_10235909 Ga0105239_102359092 206
20 3300013102 Ga0157371_10093477 Ga0157371_100934772 206
21 3300013306 Ga0163162_10120409 Ga0163162_101204092 206
22 3300025904 Ga0207647_10000073 Ga0207647_1000007368 206
23 3300025919 Ga0207657_10034062 Ga0207657_100340623 206
24 3300025933 Ga0207706_10001063 Ga0207706_100010637 206
25 3300025940 Ga0207691_10012981 Ga0207691_100129812 206
26 3300025945 Ga0207679_10388833 Ga0207679_103888332 206
27 3300025949 Ga0207667_10115121 Ga0207667_101151214 206
28 3300025961 Ga0207712_10011567 Ga0207712_100115671 206
29 3300028380 Ga0268265_10026471 Ga0268265_100264712 206
30 3300028381 Ga0268264_10001230 Ga0268264_1000123019 206
31 3300005344 Ga0070661_100375654 Ga0070661_1003756542 209
32 3300005331 Ga0070670_100040271 Ga0070670_1000402712 219
33 3300005455 Ga0070663_100051506 Ga0070663_1000515062 219
34 3300005618 Ga0068864_100045578 Ga0068864_1000455782 219
35 3300025315 Ga0207697_10034827 Ga0207697_100348272 219
36 3300025925 Ga0207650_10022685 Ga0207650_100226852 219
37 3300025926 Ga0207659_10125168 Ga0207659_101251682 219
38 3300048915 Ga0496112_0067660 Ga0496112_0067660_690_1487 219
39 3300005564 Ga0070664_100031007 Ga0070664_1000310072 220
40 3300025942 Ga0207689_10083687 Ga0207689_100836872 220
41 3300005327 Ga0070658_10192827 Ga0070658_101928272 222
42 3300005455 Ga0070663_100171438 Ga0070663_1001714383 222
43 3300005530 Ga0070679_100347296 Ga0070679_1003472961 222
44 3300005614 Ga0068856_100103381 Ga0068856_1001033811 222
45 3300005614 Ga0068856_100814131 Ga0068856_1008141311 222
46 3300005616 Ga0068852_100268971 Ga0068852_1002689712 222
47 3300025909 Ga0207705_10240702 Ga0207705_102407023 222
48 3300025921 Ga0207652_10249866 Ga0207652_102498661 222
49 3300025941 Ga0207711_10545103 Ga0207711_105451031 222
50 3300026095 Ga0207676_10462491 Ga0207676_104624912 222
51 3300026142 Ga0207698_10160349 Ga0207698_101603493 222
52 3300037471 Ga0395905_0014564 Ga0395905_0014564_5184_5990 222
53 3300042005 Ga0439448_0084479 Ga0439448_0084479_112_918 223
54 3300042157 Ga0439458_0000210 Ga0439458_0000210_2764_3570 223
55 3300046537 Ga0495598_0002323 Ga0495598_0002323_1106_1906 223
56 3300046539 Ga0495621_0013285 Ga0495621_0013285_1150_1950 223
57 3300046684 Ga0495669_0049680 Ga0495669_0049680_551_1351 223
58 3300046691 Ga0495670_0002417 Ga0495670_0002417_1403_2203 223
59 3300047322 Ga0495680_0443954 Ga0495680_0443954_54_854 223
60 3300045836 Ga0466958_0025655 Ga0466958_0025655_869_1690 224
61 3300045976 Ga0466967_0001564 Ga0466967_0001564_12_833 224
62 3300005327 Ga0070658_10204665 Ga0070658_102046652 225
63 3300005338 Ga0068868_100008379 Ga0068868_1000083793 225
64 3300005364 Ga0070673_100452846 Ga0070673_1004528461 225
65 3300009098 Ga0105245_10420056 Ga0105245_104200562 225
66 3300025927 Ga0207687_10268254 Ga0207687_102682542 225
67 3300025960 Ga0207651_10127485 Ga0207651_101274852 225
68 3300026023 Ga0207677_10003531 Ga0207677_100035313 225
69 3300037418 Ga0395900_0256408 Ga0395900_0256408_230_1063 226
70 3300037466 Ga0395898_0204619 Ga0395898_0204619_650_1477 226
71 3300037471 Ga0395905_0024002 Ga0395905_0024002_3160_3993 226
72 3300037471 Ga0395905_0123550 Ga0395905_0123550_1498_2325 226
73 3300038443 Ga0395901_0032560 Ga0395901_0032560_2335_3162 226
74 3300046684 Ga0495669_0000565 Ga0495669_0000565_13322_14152 226
75 3300046684 Ga0495669_0015372 Ga0495669_0015372_642_1472 226
76 3300047445 Ga0495677_0098655 Ga0495677_0098655_219_1049 226
77 3300025929 Ga0207664_10270215 Ga0207664_102702152 227
78 3300037418 Ga0395900_0030614 Ga0395900_0030614_2118_2939 227
79 3300037466 Ga0395898_0012715 Ga0395898_0012715_5402_6223 227
80 3300037471 Ga0395905_0028927 Ga0395905_0028927_2326_3147 227
81 3300038443 Ga0395901_0009696 Ga0395901_0009696_4994_5815 227
82 3300005548 Ga0070665_100010704 Ga0070665_1000107049 228
83 3300025972 Ga0207668_10119060 Ga0207668_101190602 228
84 3300028379 Ga0268266_10025415 Ga0268266_100254153 228
85 3300005548 Ga0070665_100022897 Ga0070665_1000228976 229
86 3300013306 Ga0163162_10063325 Ga0163162_100633252 229
87 3300025315 Ga0207697_10024732 Ga0207697_100247323 229
88 3300037312 Ga0395899_0004952 Ga0395899_0004952_791_1609 229
89 3300037418 Ga0395900_0055439 Ga0395900_0055439_2731_3549 229
90 3300037466 Ga0395898_0010300 Ga0395898_0010300_1116_1934 229
91 3300037471 Ga0395905_0041117 Ga0395905_0041117_2859_3677 229
92 3300038443 Ga0395901_0070384 Ga0395901_0070384_791_1609 229
93 3300005344 Ga0070661_100106266 Ga0070661_1001062662 231
94 3300005543 Ga0070672_100204553 Ga0070672_1002045532 231
95 3300005842 Ga0068858_100292225 Ga0068858_1002922251 231
96 3300009551 Ga0105238_10121785 Ga0105238_101217852 231
97 3300025920 Ga0207649_10095186 Ga0207649_100951862 231
98 3300025940 Ga0207691_10112349 Ga0207691_101123492 231
99 3300025960 Ga0207651_10087729 Ga0207651_100877292 231
100 3300025986 Ga0207658_10114190 Ga0207658_101141902 231
101 3300026035 Ga0207703_10274036 Ga0207703_102740361 231
102 3300005842 Ga0068858_100025462 Ga0068858_1000254625 232
103 3300009174 Ga0105241_10117019 Ga0105241_101170192 232
104 3300013296 Ga0157374_10012401 Ga0157374_100124015 232
105 3300013297 Ga0157378_10341621 Ga0157378_103416212 232
106 3300025931 Ga0207644_10123093 Ga0207644_101230932 232
107 3300025945 Ga0207679_10406272 Ga0207679_104062722 232
108 3300026023 Ga0207677_10304529 Ga0207677_103045291 232
109 3300026035 Ga0207703_10037572 Ga0207703_100375723 232
110 3300039437 Ga0436365_0088937 Ga0436365_0088937_6273_7088 232
111 3300039450 Ga0436363_0494724 Ga0436363_0494724_1986_2801 232
112 3300005344 Ga0070661_100345469 Ga0070661_1003454691 233
113 3300005435 Ga0070714_100389813 Ga0070714_1003898131 233
114 3300013307 Ga0157372_10691631 Ga0157372_106916312 233
115 3300026041 Ga0207639_10027181 Ga0207639_100271812 233
116 3300005578 Ga0068854_100312939 Ga0068854_1003129392 234
117 3300046684 Ga0495669_0092589 Ga0495669_0092589_274_1101 234
118 3300048911 Ga0496108_0000974 Ga0496108_0000974_16295_17122 234
119 3300009148 Ga0105243_10169600 Ga0105243_101696002 235
120 3300025935 Ga0207709_10167581 Ga0207709_101675812 235
121 3300037471 Ga0395905_0006965 Ga0395905_0006965_9874_10692 235
122 3300044684 Ga0466966_0065027 Ga0466966_0065027_1387_2202 235
123 3300044693 Ga0466961_0062189 Ga0466961_0062189_1438_2253 235
124 3300044694 Ga0466963_0086494 Ga0466963_0086494_1009_1824 235
125 3300044765 Ga0466970_0017655 Ga0466970_0017655_62_877 235
126 3300044842 Ga0466957_0171484 Ga0466957_0171484_163_978 235
127 3300005338 Ga0068868_100054984 Ga0068868_1000549844 236
128 3300005344 Ga0070661_100163737 Ga0070661_1001637372 236
129 3300005366 Ga0070659_100100516 Ga0070659_1001005162 236
130 3300005366 Ga0070659_100234005 Ga0070659_1002340051 236
131 3300005367 Ga0070667_100126572 Ga0070667_1001265722 236
132 3300005457 Ga0070662_100053388 Ga0070662_1000533882 236
133 3300005578 Ga0068854_100089019 Ga0068854_1000890192 236
134 3300005718 Ga0068866_10081721 Ga0068866_100817213 236
135 3300005834 Ga0068851_10104647 Ga0068851_101046472 236
136 3300005842 Ga0068858_100052236 Ga0068858_1000522362 236
137 3300005844 Ga0068862_100247475 Ga0068862_1002474752 236
138 3300006358 Ga0068871_100066197 Ga0068871_1000661972 236
139 3300007076 Ga0075435_100207109 Ga0075435_1002071092 236
140 3300009098 Ga0105245_10573464 Ga0105245_105734641 236
141 3300009148 Ga0105243_10244561 Ga0105243_102445612 236
142 3300009176 Ga0105242_10154828 Ga0105242_101548282 236
143 3300011119 Ga0105246_10064863 Ga0105246_100648632 236
144 3300011119 Ga0105246_10381103 Ga0105246_103811031 236
145 3300013100 Ga0157373_10076014 Ga0157373_100760142 236
146 3300013100 Ga0157373_10201820 Ga0157373_102018202 236
147 3300013105 Ga0157369_10011303 Ga0157369_100113032 236
148 3300014745 Ga0157377_10058397 Ga0157377_100583972 236
149 3300025919 Ga0207657_10066559 Ga0207657_100665592 236
150 3300025920 Ga0207649_10368720 Ga0207649_103687201 236
151 3300025923 Ga0207681_10652510 Ga0207681_106525101 236
152 3300025927 Ga0207687_10156335 Ga0207687_101563352 236
153 3300025934 Ga0207686_10063874 Ga0207686_100638742 236
154 3300025935 Ga0207709_10297572 Ga0207709_102975722 236
155 3300025940 Ga0207691_10051374 Ga0207691_100513742 236
156 3300025942 Ga0207689_10054262 Ga0207689_100542622 236
157 3300025960 Ga0207651_10103766 Ga0207651_101037662 236
158 3300025972 Ga0207668_10160699 Ga0207668_101606992 236
159 3300026035 Ga0207703_10004057 Ga0207703_100040572 236
160 3300026088 Ga0207641_10175380 Ga0207641_101753802 236
161 3300026116 Ga0207674_10119424 Ga0207674_101194244 236
162 3300026118 Ga0207675_100268810 Ga0207675_1002688102 236
163 3300037471 Ga0395905_0217418 Ga0395905_0217418_822_1652 236
164 3300044694 Ga0466963_0044717 Ga0466963_0044717_511_1332 236
165 3300044842 Ga0466957_0323511 Ga0466957_0323511_51_872 236
166 3300048905 Ga0496102_0770591 Ga0496102_0770591_42_842 236
167 3300050512 nmdc:mga0n895_311061_c1 nmdc:mga0n895_311061_c1_207_1031 236
168 3300002077 JGI24744J21845_10000329 JGI24744J21845_100003293 237
169 3300005330 Ga0070690_100015433 Ga0070690_1000154333 237
170 3300005331 Ga0070670_100228112 Ga0070670_1002281122 237
171 3300005334 Ga0068869_100092515 Ga0068869_1000925152 237
172 3300005335 Ga0070666_10000784 Ga0070666_1000078420 237
173 3300005338 Ga0068868_100037007 Ga0068868_1000370073 237
174 3300005354 Ga0070675_100111392 Ga0070675_1001113922 237
175 3300005355 Ga0070671_100016983 Ga0070671_1000169834 237
176 3300005364 Ga0070673_100021894 Ga0070673_1000218942 237
177 3300005364 Ga0070673_100057329 Ga0070673_1000573294 237
178 3300005364 Ga0070673_100075272 Ga0070673_1000752722 237
179 3300005367 Ga0070667_100000764 Ga0070667_10000076431 237
180 3300005434 Ga0070709_10049343 Ga0070709_100493432 237
181 3300005435 Ga0070714_100335091 Ga0070714_1003350911 237
182 3300005436 Ga0070713_100210184 Ga0070713_1002101842 237
183 3300005543 Ga0070672_100074735 Ga0070672_1000747352 237
184 3300005718 Ga0068866_10087687 Ga0068866_100876872 237
185 3300005842 Ga0068858_100006383 Ga0068858_10000638311 237
186 3300006175 Ga0070712_100565103 Ga0070712_1005651032 237
187 3300006237 Ga0097621_100406897 Ga0097621_1004068972 237
188 3300009098 Ga0105245_10189780 Ga0105245_101897802 237
189 3300009176 Ga0105242_10053531 Ga0105242_100535312 237
190 3300009177 Ga0105248_10048261 Ga0105248_100482613 237
191 3300009177 Ga0105248_10191344 Ga0105248_101913442 237
192 3300013100 Ga0157373_10039353 Ga0157373_100393532 237
193 3300013297 Ga0157378_10786420 Ga0157378_107864201 237
194 3300013308 Ga0157375_10180307 Ga0157375_101803073 237
195 3300025899 Ga0207642_10063885 Ga0207642_100638852 237
196 3300025903 Ga0207680_10001490 Ga0207680_100014903 237
197 3300025904 Ga0207647_10007124 Ga0207647_100071243 237
198 3300025906 Ga0207699_10046160 Ga0207699_100461602 237
199 3300025915 Ga0207693_10027018 Ga0207693_100270184 237
200 3300025928 Ga0207700_10140519 Ga0207700_101405192 237
201 3300025929 Ga0207664_10382513 Ga0207664_103825131 237
202 3300025931 Ga0207644_10116681 Ga0207644_101166812 237
203 3300025941 Ga0207711_10000174 Ga0207711_1000017432 237
204 3300025941 Ga0207711_10217053 Ga0207711_102170532 237
205 3300025945 Ga0207679_10274539 Ga0207679_102745392 237
206 3300025960 Ga0207651_10011170 Ga0207651_100111703 237
207 3300025960 Ga0207651_10043708 Ga0207651_100437084 237
208 3300025986 Ga0207658_10005682 Ga0207658_100056822 237
209 3300026023 Ga0207677_10146424 Ga0207677_101464242 237
210 3300026023 Ga0207677_10282027 Ga0207677_102820272 237
211 3300026035 Ga0207703_10023164 Ga0207703_100231641 237
212 3300026089 Ga0207648_10023887 Ga0207648_100238872 237
213 3300026121 Ga0207683_10026205 Ga0207683_100262053 237
214 3300028381 Ga0268264_10216856 Ga0268264_102168562 237
215 3300031995 Ga0307409_100489379 Ga0307409_1004893792 237
216 3300035692 Ga0373935_0033605 Ga0373935_0033605_1683_2483 237
217 3300037418 Ga0395900_0011750 Ga0395900_0011750_1326_2132 237
218 3300037418 Ga0395900_0211647 Ga0395900_0211647_801_1601 237
219 3300037466 Ga0395898_0057015 Ga0395898_0057015_1130_1936 237
220 3300037466 Ga0395898_0110180 Ga0395898_0110180_627_1427 237
221 3300037471 Ga0395905_0146543 Ga0395905_0146543_92_898 237
222 3300038443 Ga0395901_0019006 Ga0395901_0019006_2769_3575 237
223 3300048912 Ga0496109_0072772 Ga0496109_0072772_2054_2878 237
224 3300005331 Ga0070670_100068604 Ga0070670_1000686042 238
225 3300006175 Ga0070712_100009442 Ga0070712_1000094425 238
226 3300011119 Ga0105246_10229467 Ga0105246_102294671 238
227 3300025915 Ga0207693_10012012 Ga0207693_100120128 238
228 3300025925 Ga0207650_10069072 Ga0207650_100690722 238
229 3300037312 Ga0395899_0061498 Ga0395899_0061498_1904_2707 238
230 3300037312 Ga0395899_0158291 Ga0395899_0158291_62_874 238
231 3300037418 Ga0395900_0016938 Ga0395900_0016938_4911_5714 238
232 3300037418 Ga0395900_0089716 Ga0395900_0089716_600_1412 238
233 3300037466 Ga0395898_0082203 Ga0395898_0082203_1649_2452 238
234 3300037466 Ga0395898_0119310 Ga0395898_0119310_62_874 238
235 3300037471 Ga0395905_0015854 Ga0395905_0015854_282_1085 238
236 3300037471 Ga0395905_0043636 Ga0395905_0043636_3333_4145 238
237 3300037471 Ga0395905_0066910 Ga0395905_0066910_2144_2956 238
238 3300038443 Ga0395901_0027042 Ga0395901_0027042_1748_2560 238
239 3300044694 Ga0466963_0002633 Ga0466963_0002633_3304_4113 238
240 3300045976 Ga0466967_0001266 Ga0466967_0001266_5377_6186 238
241 3300048908 Ga0496105_0495936 Ga0496105_0495936_136_948 238
242 3300037471 Ga0395905_0039882 Ga0395905_0039882_944_1816 239
243 3300038443 Ga0395901_0105170 Ga0395901_0105170_1151_1957 239
244 3300050516 nmdc:mga0sz30_175949_c1 nmdc:mga0sz30_175949_c1_11_817 239
245 3300005327 Ga0070658_10054560 Ga0070658_100545602 240
246 3300005327 Ga0070658_10493271 Ga0070658_104932712 240
247 3300005330 Ga0070690_100370898 Ga0070690_1003708982 240
248 3300005331 Ga0070670_100076321 Ga0070670_1000763214 240
249 3300005335 Ga0070666_10098559 Ga0070666_100985592 240
250 3300005336 Ga0070680_100072566 Ga0070680_1000725662 240
251 3300005337 Ga0070682_100322990 Ga0070682_1003229902 240
252 3300005339 Ga0070660_100006501 Ga0070660_1000065013 240
253 3300005339 Ga0070660_100131426 Ga0070660_1001314262 240
254 3300005339 Ga0070660_100274541 Ga0070660_1002745412 240
255 3300005355 Ga0070671_100023561 Ga0070671_1000235613 240
256 3300005364 Ga0070673_100080104 Ga0070673_1000801042 240
257 3300005366 Ga0070659_100069938 Ga0070659_1000699382 240
258 3300005367 Ga0070667_100035741 Ga0070667_1000357413 240
259 3300005367 Ga0070667_100075138 Ga0070667_1000751383 240
260 3300005367 Ga0070667_100244306 Ga0070667_1002443062 240
261 3300005455 Ga0070663_100043165 Ga0070663_1000431653 240
262 3300005457 Ga0070662_100189452 Ga0070662_1001894522 240
263 3300005530 Ga0070679_100061012 Ga0070679_1000610122 240
264 3300005530 Ga0070679_100441914 Ga0070679_1004419141 240
265 3300005539 Ga0068853_100332233 Ga0068853_1003322332 240
266 3300005546 Ga0070696_100199908 Ga0070696_1001999081 240
267 3300005547 Ga0070693_100105467 Ga0070693_1001054671 240
268 3300005563 Ga0068855_100522439 Ga0068855_1005224392 240
269 3300005564 Ga0070664_100012124 Ga0070664_1000121249 240
270 3300005564 Ga0070664_100036798 Ga0070664_1000367983 240
271 3300005577 Ga0068857_100027971 Ga0068857_1000279712 240
272 3300005614 Ga0068856_100482665 Ga0068856_1004826652 240
273 3300005616 Ga0068852_100132342 Ga0068852_1001323422 240
274 3300005841 Ga0068863_100017811 Ga0068863_1000178112 240
275 3300005842 Ga0068858_100246148 Ga0068858_1002461483 240
276 3300005843 Ga0068860_100051533 Ga0068860_1000515332 240
277 3300009177 Ga0105248_10012199 Ga0105248_100121993 240
278 3300009545 Ga0105237_10078383 Ga0105237_100783832 240
279 3300009551 Ga0105238_10384755 Ga0105238_103847552 240
280 3300013100 Ga0157373_10004543 Ga0157373_100045432 240
281 3300013102 Ga0157371_10151371 Ga0157371_101513712 240
282 3300013296 Ga0157374_10320997 Ga0157374_103209972 240
283 3300014325 Ga0163163_10217594 Ga0163163_102175942 240
284 3300014497 Ga0182008_10064369 Ga0182008_100643692 240
285 3300014968 Ga0157379_10017407 Ga0157379_100174077 240
286 3300025907 Ga0207645_10090463 Ga0207645_100904632 240
287 3300025912 Ga0207707_10210340 Ga0207707_102103402 240
288 3300025914 Ga0207671_10163149 Ga0207671_101631492 240
289 3300025917 Ga0207660_10442184 Ga0207660_104421842 240
290 3300025919 Ga0207657_10005786 Ga0207657_1000578612 240
291 3300025920 Ga0207649_10009296 Ga0207649_100092964 240
292 3300025920 Ga0207649_10212739 Ga0207649_102127392 240
293 3300025920 Ga0207649_10245283 Ga0207649_102452832 240
294 3300025921 Ga0207652_10193911 Ga0207652_101939112 240
295 3300025931 Ga0207644_10078102 Ga0207644_100781022 240
296 3300025932 Ga0207690_10216174 Ga0207690_102161742 240
297 3300025932 Ga0207690_10410545 Ga0207690_104105452 240
298 3300025933 Ga0207706_10045866 Ga0207706_100458662 240
299 3300025933 Ga0207706_10057661 Ga0207706_100576613 240
300 3300025941 Ga0207711_10006114 Ga0207711_100061145 240
301 3300025945 Ga0207679_10030926 Ga0207679_100309262 240
302 3300025949 Ga0207667_10735103 Ga0207667_107351031 240
303 3300025960 Ga0207651_10168464 Ga0207651_101684642 240
304 3300025981 Ga0207640_10071530 Ga0207640_100715302 240
305 3300025981 Ga0207640_10616283 Ga0207640_106162831 240
306 3300025986 Ga0207658_10006022 Ga0207658_100060225 240
307 3300025986 Ga0207658_10423650 Ga0207658_104236502 240
308 3300026035 Ga0207703_10478409 Ga0207703_104784092 240
309 3300026041 Ga0207639_10118008 Ga0207639_101180081 240
310 3300026067 Ga0207678_10039002 Ga0207678_100390023 240
311 3300026067 Ga0207678_10041699 Ga0207678_100416993 240
312 3300026067 Ga0207678_10062108 Ga0207678_100621082 240
313 3300026116 Ga0207674_10005768 Ga0207674_100057685 240
314 3300026116 Ga0207674_10081185 Ga0207674_100811853 240
315 3300026142 Ga0207698_10378278 Ga0207698_103782782 240
316 3300026142 Ga0207698_10503527 Ga0207698_105035272 240
317 3300028381 Ga0268264_10074618 Ga0268264_100746182 240
318 3300037312 Ga0395899_0001070 Ga0395899_0001070_2973_3800 240
319 3300037418 Ga0395900_0001041 Ga0395900_0001041_3133_3960 240
320 3300037418 Ga0395900_0015887 Ga0395900_0015887_2851_3663 240
321 3300037418 Ga0395900_0051015 Ga0395900_0051015_1904_2716 240
322 3300037466 Ga0395898_0000274 Ga0395898_0000274_468_1295 240
323 3300037466 Ga0395898_0128875 Ga0395898_0128875_1516_2328 240
324 3300037471 Ga0395905_0000006 Ga0395905_0000006_51947_52774 240
325 3300037471 Ga0395905_0012465 Ga0395905_0012465_3005_3817 240
326 3300037471 Ga0395905_0028407 Ga0395905_0028407_205_1023 240
327 3300038443 Ga0395901_0001959 Ga0395901_0001959_10005_10832 240
328 3300038443 Ga0395901_0093959 Ga0395901_0093959_109_921 240
329 3300045976 Ga0466967_0544825 Ga0466967_0544825_77_898 240
330 3300048905 Ga0496102_0118775 Ga0496102_0118775_213_1079 240
331 3300048906 Ga0496103_0230677 Ga0496103_0230677_290_1156 240
332 3300048908 Ga0496105_0113231 Ga0496105_0113231_1152_2018 240
333 3300048911 Ga0496108_0019724 Ga0496108_0019724_2080_2946 240
334 3300048913 Ga0496110_0016722 Ga0496110_0016722_151_1017 240
335 3300048913 Ga0496110_0127035 Ga0496110_0127035_946_1773 240
336 3300048914 Ga0496111_0038294 Ga0496111_0038294_937_1803 240
337 3300048914 Ga0496111_0118684 Ga0496111_0118684_188_1015 240
338 3300048915 Ga0496112_0111558 Ga0496112_0111558_1409_2275 240
339 3300048916 Ga0496113_0014119 Ga0496113_0014119_4080_4946 240
340 3300003322 rootL2_10016393 rootL2_100163932 241
341 3300005329 Ga0070683_100240111 Ga0070683_1002401112 241
342 3300005335 Ga0070666_10117760 Ga0070666_101177602 241
343 3300005336 Ga0070680_100016912 Ga0070680_1000169123 241
344 3300005337 Ga0070682_100354125 Ga0070682_1003541251 241
345 3300005339 Ga0070660_100017265 Ga0070660_1000172652 241
346 3300005339 Ga0070660_100024885 Ga0070660_1000248854 241
347 3300005353 Ga0070669_100047531 Ga0070669_1000475312 241
348 3300005366 Ga0070659_100032065 Ga0070659_1000320652 241
349 3300005366 Ga0070659_100248448 Ga0070659_1002484482 241
350 3300005455 Ga0070663_100011726 Ga0070663_1000117261 241
351 3300005458 Ga0070681_10192961 Ga0070681_101929612 241
352 3300005530 Ga0070679_100264835 Ga0070679_1002648351 241
353 3300005535 Ga0070684_100028521 Ga0070684_1000285213 241
354 3300005539 Ga0068853_100183860 Ga0068853_1001838602 241
355 3300005563 Ga0068855_100222500 Ga0068855_1002225002 241
356 3300005563 Ga0068855_100387993 Ga0068855_1003879932 241
357 3300005564 Ga0070664_100254465 Ga0070664_1002544652 241
358 3300005577 Ga0068857_100022914 Ga0068857_1000229145 241
359 3300005577 Ga0068857_100057007 Ga0068857_1000570075 241
360 3300005578 Ga0068854_100034029 Ga0068854_1000340292 241
361 3300005616 Ga0068852_100190166 Ga0068852_1001901662 241
362 3300005616 Ga0068852_100197790 Ga0068852_1001977902 241
363 3300005616 Ga0068852_100211182 Ga0068852_1002111822 241
364 3300005617 Ga0068859_100366815 Ga0068859_1003668153 241
365 3300005841 Ga0068863_100023090 Ga0068863_1000230905 241
366 3300005842 Ga0068858_100482509 Ga0068858_1004825092 241
367 3300005844 Ga0068862_100158906 Ga0068862_1001589063 241
368 3300006931 Ga0097620_100366790 Ga0097620_1003667903 241
369 3300009093 Ga0105240_10032102 Ga0105240_100321023 241
370 3300009093 Ga0105240_10043569 Ga0105240_100435696 241
371 3300009551 Ga0105238_10046723 Ga0105238_100467233 241
372 3300009551 Ga0105238_10096775 Ga0105238_100967752 241
373 3300009551 Ga0105238_10399044 Ga0105238_103990441 241
374 3300009553 Ga0105249_10290631 Ga0105249_102906312 241
375 3300010375 Ga0105239_10300502 Ga0105239_103005022 241
376 3300013100 Ga0157373_10088159 Ga0157373_100881592 241
377 3300013104 Ga0157370_10009228 Ga0157370_1000922810 241
378 3300013105 Ga0157369_10111223 Ga0157369_101112232 241
379 3300013307 Ga0157372_10065516 Ga0157372_100655162 241
380 3300013307 Ga0157372_10525572 Ga0157372_105255722 241
381 3300014969 Ga0157376_10003636 Ga0157376_100036362 241
382 3300020069 Ga0197907_10160736 Ga0197907_101607362 241
383 3300025904 Ga0207647_10027780 Ga0207647_100277802 241
384 3300025909 Ga0207705_10246754 Ga0207705_102467542 241
385 3300025912 Ga0207707_10084991 Ga0207707_100849912 241
386 3300025913 Ga0207695_10184346 Ga0207695_101843462 241
387 3300025919 Ga0207657_10009175 Ga0207657_100091755 241
388 3300025919 Ga0207657_10039012 Ga0207657_100390122 241
389 3300025919 Ga0207657_10040290 Ga0207657_100402903 241
390 3300025920 Ga0207649_10091128 Ga0207649_100911281 241
391 3300025921 Ga0207652_10202000 Ga0207652_102020001 241
392 3300025921 Ga0207652_10215420 Ga0207652_102154202 241
393 3300025924 Ga0207694_10003870 Ga0207694_100038704 241
394 3300025932 Ga0207690_10034134 Ga0207690_100341342 241
395 3300025932 Ga0207690_10064193 Ga0207690_100641932 241
396 3300025941 Ga0207711_10185701 Ga0207711_101857012 241
397 3300025944 Ga0207661_10033964 Ga0207661_100339643 241
398 3300025949 Ga0207667_10200743 Ga0207667_102007432 241
399 3300025949 Ga0207667_10825876 Ga0207667_108258761 241
400 3300025981 Ga0207640_10029943 Ga0207640_100299432 241
401 3300026035 Ga0207703_10020601 Ga0207703_100206016 241
402 3300026041 Ga0207639_10000144 Ga0207639_1000014435 241
403 3300026067 Ga0207678_10021716 Ga0207678_100217165 241
404 3300026078 Ga0207702_10037906 Ga0207702_100379062 241
405 3300026088 Ga0207641_10355789 Ga0207641_103557892 241
406 3300026116 Ga0207674_10016402 Ga0207674_100164023 241
407 3300026116 Ga0207674_10019921 Ga0207674_100199213 241
408 3300026116 Ga0207674_10107894 Ga0207674_101078942 241
409 3300026116 Ga0207674_10482367 Ga0207674_104823671 241
410 3300026142 Ga0207698_10041600 Ga0207698_100416002 241
411 3300026142 Ga0207698_10085736 Ga0207698_100857362 241
412 3300028380 Ga0268265_10060149 Ga0268265_100601491 241
413 3300031852 Ga0307410_10008595 Ga0307410_100085954 241
414 3300031995 Ga0307409_100104360 Ga0307409_1001043601 241
415 3300032005 Ga0307411_10650256 Ga0307411_106502561 241
416 3300037312 Ga0395899_0003599 Ga0395899_0003599_6430_7254 241
417 3300037312 Ga0395899_0051492 Ga0395899_0051492_631_1446 241
418 3300037418 Ga0395900_0011436 Ga0395900_0011436_7339_8163 241
419 3300037466 Ga0395898_0018438 Ga0395898_0018438_2414_3238 241
420 3300037466 Ga0395898_0052351 Ga0395898_0052351_2422_3237 241
421 3300037466 Ga0395898_0182841 Ga0395898_0182841_752_1567 241
422 3300037471 Ga0395905_0007371 Ga0395905_0007371_5128_5952 241
423 3300037471 Ga0395905_0282326 Ga0395905_0282326_663_1478 241
424 3300038443 Ga0395901_0040796 Ga0395901_0040796_1091_1906 241
425 3300038443 Ga0395901_0091439 Ga0395901_0091439_770_1594 241
426 3300044658 Ga0466972_0059130 Ga0466972_0059130_810_1631 241
427 3300044694 Ga0466963_0018355 Ga0466963_0018355_2824_3717 241
428 3300044706 Ga0466964_0038586 Ga0466964_0038586_759_1580 241
429 3300044735 Ga0466968_0007068 Ga0466968_0007068_485_1306 241
430 3300044901 Ga0466960_0096498 Ga0466960_0096498_93_905 241
431 3300045976 Ga0466967_0016471 Ga0466967_0016471_4243_5073 241
432 3300045976 Ga0466967_0159908 Ga0466967_0159908_545_1366 241
433 3300048906 Ga0496103_0139436 Ga0496103_0139436_204_1016 241
434 3300048915 Ga0496112_0098255 Ga0496112_0098255_1769_2581 241
435 3300005329 Ga0070683_100074027 Ga0070683_1000740272 242
436 3300005336 Ga0070680_100000971 Ga0070680_1000009714 242
437 3300005339 Ga0070660_100027054 Ga0070660_1000270543 242
438 3300005339 Ga0070660_100062645 Ga0070660_1000626452 242
439 3300005340 Ga0070689_100277602 Ga0070689_1002776022 242
440 3300005344 Ga0070661_100168430 Ga0070661_1001684302 242
441 3300005366 Ga0070659_100082828 Ga0070659_1000828282 242
442 3300005366 Ga0070659_100462408 Ga0070659_1004624082 242
443 3300005457 Ga0070662_100099087 Ga0070662_1000990872 242
444 3300005459 Ga0068867_100068213 Ga0068867_1000682133 242
445 3300005530 Ga0070679_100131140 Ga0070679_1001311402 242
446 3300005539 Ga0068853_100125191 Ga0068853_1001251911 242
447 3300005563 Ga0068855_100052849 Ga0068855_1000528493 242
448 3300005563 Ga0068855_100110052 Ga0068855_1001100522 242
449 3300005563 Ga0068855_100248015 Ga0068855_1002480152 242
450 3300005614 Ga0068856_100085927 Ga0068856_1000859272 242
451 3300005616 Ga0068852_100010396 Ga0068852_1000103962 242
452 3300005617 Ga0068859_100742325 Ga0068859_1007423252 242
453 3300005843 Ga0068860_100615309 Ga0068860_1006153092 242
454 3300006028 Ga0070717_10010474 Ga0070717_100104745 242
455 3300006931 Ga0097620_100742406 Ga0097620_1007424062 242
456 3300013102 Ga0157371_10039467 Ga0157371_100394672 242
457 3300013102 Ga0157371_10106406 Ga0157371_101064061 242
458 3300013105 Ga0157369_10026642 Ga0157369_100266423 242
459 3300013105 Ga0157369_10154089 Ga0157369_101540893 242
460 3300013105 Ga0157369_10190590 Ga0157369_101905902 242
461 3300025904 Ga0207647_10163935 Ga0207647_101639352 242
462 3300025917 Ga0207660_10001465 Ga0207660_100014657 242
463 3300025917 Ga0207660_10161929 Ga0207660_101619292 242
464 3300025919 Ga0207657_10075768 Ga0207657_100757682 242
465 3300025919 Ga0207657_10263064 Ga0207657_102630642 242
466 3300025923 Ga0207681_10487061 Ga0207681_104870611 242
467 3300025925 Ga0207650_10100108 Ga0207650_101001082 242
468 3300025932 Ga0207690_10012424 Ga0207690_100124242 242
469 3300025932 Ga0207690_10066305 Ga0207690_100663052 242
470 3300025932 Ga0207690_10093466 Ga0207690_100934661 242
471 3300025942 Ga0207689_10136316 Ga0207689_101363162 242
472 3300025944 Ga0207661_10145331 Ga0207661_101453312 242
473 3300025945 Ga0207679_10064246 Ga0207679_100642462 242
474 3300025949 Ga0207667_10084992 Ga0207667_100849922 242
475 3300025949 Ga0207667_10095828 Ga0207667_100958282 242
476 3300025949 Ga0207667_10647519 Ga0207667_106475192 242
477 3300026035 Ga0207703_10382311 Ga0207703_103823112 242
478 3300026041 Ga0207639_10031620 Ga0207639_100316202 242
479 3300026041 Ga0207639_10138524 Ga0207639_101385242 242
480 3300026088 Ga0207641_10394895 Ga0207641_103948952 242
481 3300026089 Ga0207648_10058078 Ga0207648_100580781 242
482 3300026142 Ga0207698_10006878 Ga0207698_100068782 242
483 3300026142 Ga0207698_10633887 Ga0207698_106338872 242
484 3300035115 Ga0373941_0044643 Ga0373941_0044643_108_923 242
485 3300037312 Ga0395899_0052893 Ga0395899_0052893_1604_2431 242
486 3300037312 Ga0395899_0079880 Ga0395899_0079880_956_1777 242
487 3300037312 Ga0395899_0247244 Ga0395899_0247244_361_1188 242
488 3300037418 Ga0395900_0018396 Ga0395900_0018396_1799_2626 242
489 3300037418 Ga0395900_0060798 Ga0395900_0060798_2876_3736 242
490 3300037418 Ga0395900_0135243 Ga0395900_0135243_106_930 242
491 3300037418 Ga0395900_0342415 Ga0395900_0342415_306_1133 242
492 3300037466 Ga0395898_0070310 Ga0395898_0070310_1124_1954 242
493 3300037466 Ga0395898_0098696 Ga0395898_0098696_1834_2661 242
494 3300037471 Ga0395905_0030832 Ga0395905_0030832_4015_4833 242
495 3300037471 Ga0395905_0079934 Ga0395905_0079934_1761_2591 242
496 3300037471 Ga0395905_0292166 Ga0395905_0292166_28_852 242
497 3300037471 Ga0395905_0547511 Ga0395905_0547511_142_969 242
498 3300038443 Ga0395901_0158354 Ga0395901_0158354_769_1593 242
499 3300044684 Ga0466966_0090485 Ga0466966_0090485_1042_1860 242
500 3300044765 Ga0466970_0206689 Ga0466970_0206689_87_905 242
501 3300045049 Ga0466959_0102285 Ga0466959_0102285_223_1041 242
502 3300045976 Ga0466967_0026824 Ga0466967_0026824_1326_2153 242
503 3300048910 Ga0496107_0038682 Ga0496107_0038682_787_1605 242
504 3300001979 JGI24740J21852_10030528 JGI24740J21852_100305283 243
505 3300001989 JGI24739J22299_10016585 JGI24739J22299_100165853 243
506 3300001989 JGI24739J22299_10031302 JGI24739J22299_100313022 243
507 3300001990 JGI24737J22298_10000542 JGI24737J22298_1000054211 243
508 3300001990 JGI24737J22298_10000692 JGI24737J22298_100006922 243
509 3300002075 JGI24738J21930_10015309 JGI24738J21930_100153092 243
510 3300005327 Ga0070658_10006175 Ga0070658_100061757 243
511 3300005327 Ga0070658_10031623 Ga0070658_100316233 243
512 3300005328 Ga0070676_10009217 Ga0070676_100092176 243
513 3300005329 Ga0070683_100000846 Ga0070683_10000084613 243
514 3300005330 Ga0070690_100034476 Ga0070690_1000344764 243
515 3300005334 Ga0068869_100000728 Ga0068869_10000072826 243
516 3300005335 Ga0070666_10003320 Ga0070666_100033207 243
517 3300005335 Ga0070666_10062089 Ga0070666_100620892 243
518 3300005337 Ga0070682_100125012 Ga0070682_1001250122 243
519 3300005338 Ga0068868_100010669 Ga0068868_1000106696 243
520 3300005339 Ga0070660_100004392 Ga0070660_1000043923 243
521 3300005339 Ga0070660_100011788 Ga0070660_1000117885 243
522 3300005344 Ga0070661_100003518 Ga0070661_1000035188 243
523 3300005353 Ga0070669_100000565 Ga0070669_10000056530 243
524 3300005354 Ga0070675_100047118 Ga0070675_1000471182 243
525 3300005355 Ga0070671_100002084 Ga0070671_1000020842 243
526 3300005355 Ga0070671_100009573 Ga0070671_1000095732 243
527 3300005356 Ga0070674_100240171 Ga0070674_1002401712 243
528 3300005364 Ga0070673_100003973 Ga0070673_1000039732 243
529 3300005366 Ga0070659_100000887 Ga0070659_10000088720 243
530 3300005366 Ga0070659_100001567 Ga0070659_10000156713 243
531 3300005367 Ga0070667_100010885 Ga0070667_1000108853 243
532 3300005367 Ga0070667_100050410 Ga0070667_1000504102 243
533 3300005455 Ga0070663_100001696 Ga0070663_1000016963 243
534 3300005456 Ga0070678_100348807 Ga0070678_1003488072 243
535 3300005457 Ga0070662_100000047 Ga0070662_10000004769 243
536 3300005457 Ga0070662_100026387 Ga0070662_1000263872 243
537 3300005459 Ga0068867_100012344 Ga0068867_1000123446 243
538 3300005539 Ga0068853_100000033 Ga0068853_100000033120 243
539 3300005539 Ga0068853_100005485 Ga0068853_1000054853 243
540 3300005544 Ga0070686_100157745 Ga0070686_1001577452 243
541 3300005547 Ga0070693_100001255 Ga0070693_1000012559 243
542 3300005547 Ga0070693_100212860 Ga0070693_1002128602 243
543 3300005548 Ga0070665_100009636 Ga0070665_1000096364 243
544 3300005548 Ga0070665_100067978 Ga0070665_1000679782 243
545 3300005563 Ga0068855_100005847 Ga0068855_1000058478 243
546 3300005563 Ga0068855_100250463 Ga0068855_1002504632 243
547 3300005563 Ga0068855_100314468 Ga0068855_1003144682 243
548 3300005564 Ga0070664_100000066 Ga0070664_10000006637 243
549 3300005577 Ga0068857_100010273 Ga0068857_1000102732 243
550 3300005578 Ga0068854_100009153 Ga0068854_1000091533 243
551 3300005578 Ga0068854_100010935 Ga0068854_1000109353 243
552 3300005614 Ga0068856_100000162 Ga0068856_10000016268 243
553 3300005614 Ga0068856_100125238 Ga0068856_1001252383 243
554 3300005614 Ga0068856_100229197 Ga0068856_1002291972 243
555 3300005616 Ga0068852_100002091 Ga0068852_10000209112 243
556 3300005616 Ga0068852_100045542 Ga0068852_1000455425 243
557 3300005617 Ga0068859_100021639 Ga0068859_1000216393 243
558 3300005617 Ga0068859_100275171 Ga0068859_1002751712 243
559 3300005719 Ga0068861_100039577 Ga0068861_1000395773 243
560 3300005840 Ga0068870_10408811 Ga0068870_104088111 243
561 3300005841 Ga0068863_100007091 Ga0068863_1000070916 243
562 3300005842 Ga0068858_100041297 Ga0068858_1000412973 243
563 3300005843 Ga0068860_100007040 Ga0068860_1000070409 243
564 3300005844 Ga0068862_100005282 Ga0068862_1000052823 243
565 3300005844 Ga0068862_100489479 Ga0068862_1004894792 243
566 3300006237 Ga0097621_100055907 Ga0097621_1000559072 243
567 3300006931 Ga0097620_100021638 Ga0097620_1000216383 243
568 3300006931 Ga0097620_100275164 Ga0097620_1002751642 243
569 3300009098 Ga0105245_10000782 Ga0105245_100007825 243
570 3300009174 Ga0105241_10030928 Ga0105241_100309283 243
571 3300009174 Ga0105241_10046203 Ga0105241_100462034 243
572 3300009174 Ga0105241_10131570 Ga0105241_101315702 243
573 3300009177 Ga0105248_10003721 Ga0105248_100037213 243
574 3300009177 Ga0105248_10081065 Ga0105248_100810652 243
575 3300009551 Ga0105238_10041123 Ga0105238_100411233 243
576 3300013100 Ga0157373_10032530 Ga0157373_100325303 243
577 3300013100 Ga0157373_10052668 Ga0157373_100526682 243
578 3300013100 Ga0157373_10130908 Ga0157373_101309082 243
579 3300013102 Ga0157371_10172066 Ga0157371_101720662 243
580 3300013102 Ga0157371_10183291 Ga0157371_101832912 243
581 3300013104 Ga0157370_10042285 Ga0157370_100422853 243
582 3300013105 Ga0157369_10029866 Ga0157369_100298662 243
583 3300013105 Ga0157369_10086612 Ga0157369_100866123 243
584 3300013105 Ga0157369_10213548 Ga0157369_102135482 243
585 3300013105 Ga0157369_10318242 Ga0157369_103182422 243
586 3300013297 Ga0157378_10511267 Ga0157378_105112672 243
587 3300013306 Ga0163162_10037065 Ga0163162_100370653 243
588 3300013308 Ga0157375_10319983 Ga0157375_103199832 243
589 3300014745 Ga0157377_10080839 Ga0157377_100808392 243
590 3300025315 Ga0207697_10000162 Ga0207697_1000016226 243
591 3300025901 Ga0207688_10000909 Ga0207688_100009097 243
592 3300025903 Ga0207680_10013511 Ga0207680_100135114 243
593 3300025904 Ga0207647_10001093 Ga0207647_100010938 243
594 3300025904 Ga0207647_10063967 Ga0207647_100639672 243
595 3300025907 Ga0207645_10025315 Ga0207645_100253152 243
596 3300025909 Ga0207705_10005195 Ga0207705_100051954 243
597 3300025909 Ga0207705_10043846 Ga0207705_100438463 243
598 3300025911 Ga0207654_10027047 Ga0207654_100270474 243
599 3300025913 Ga0207695_10116166 Ga0207695_101161662 243
600 3300025919 Ga0207657_10009587 Ga0207657_100095873 243
601 3300025919 Ga0207657_10030651 Ga0207657_100306514 243
602 3300025920 Ga0207649_10002318 Ga0207649_100023184 243
603 3300025924 Ga0207694_10028276 Ga0207694_100282762 243
604 3300025925 Ga0207650_10127311 Ga0207650_101273113 243
605 3300025926 Ga0207659_10062757 Ga0207659_100627572 243
606 3300025927 Ga0207687_10008779 Ga0207687_100087792 243
607 3300025931 Ga0207644_10030510 Ga0207644_100305102 243
608 3300025932 Ga0207690_10000777 Ga0207690_100007772 243
609 3300025933 Ga0207706_10006873 Ga0207706_100068732 243
610 3300025933 Ga0207706_10008071 Ga0207706_100080713 243
611 3300025935 Ga0207709_10209660 Ga0207709_102096602 243
612 3300025940 Ga0207691_10001499 Ga0207691_1000149917 243
613 3300025941 Ga0207711_10002763 Ga0207711_1000276315 243
614 3300025941 Ga0207711_10012069 Ga0207711_100120692 243
615 3300025942 Ga0207689_10000167 Ga0207689_1000016723 243
616 3300025944 Ga0207661_10023773 Ga0207661_100237734 243
617 3300025945 Ga0207679_10000150 Ga0207679_1000015016 243
618 3300025949 Ga0207667_10000443 Ga0207667_1000044312 243
619 3300025949 Ga0207667_10130830 Ga0207667_101308302 243
620 3300025949 Ga0207667_10870317 Ga0207667_108703171 243
621 3300025960 Ga0207651_10083644 Ga0207651_100836443 243
622 3300025981 Ga0207640_10122069 Ga0207640_101220692 243
623 3300025981 Ga0207640_10136322 Ga0207640_101363222 243
624 3300025986 Ga0207658_10004413 Ga0207658_1000441311 243
625 3300026023 Ga0207677_10141284 Ga0207677_101412842 243
626 3300026035 Ga0207703_10014553 Ga0207703_100145537 243
627 3300026035 Ga0207703_10720787 Ga0207703_107207871 243
628 3300026041 Ga0207639_10000851 Ga0207639_1000085120 243
629 3300026041 Ga0207639_10008734 Ga0207639_100087342 243
630 3300026041 Ga0207639_10163407 Ga0207639_101634072 243
631 3300026067 Ga0207678_10052954 Ga0207678_100529543 243
632 3300026078 Ga0207702_10005597 Ga0207702_100055972 243
633 3300026078 Ga0207702_10186975 Ga0207702_101869752 243
634 3300026078 Ga0207702_10195004 Ga0207702_101950042 243
635 3300026088 Ga0207641_10016621 Ga0207641_100166217 243
636 3300026089 Ga0207648_10046120 Ga0207648_100461202 243
637 3300026095 Ga0207676_10002947 Ga0207676_100029472 243
638 3300026095 Ga0207676_10374005 Ga0207676_103740051 243
639 3300026116 Ga0207674_10002073 Ga0207674_100020737 243
640 3300026118 Ga0207675_100046661 Ga0207675_1000466614 243
641 3300026121 Ga0207683_10296509 Ga0207683_102965092 243
642 3300026142 Ga0207698_10020567 Ga0207698_100205672 243
643 3300026142 Ga0207698_10030800 Ga0207698_100308004 243
644 3300026142 Ga0207698_10101990 Ga0207698_101019902 243
645 3300026142 Ga0207698_10152858 Ga0207698_101528582 243
646 3300028379 Ga0268266_10014546 Ga0268266_100145469 243
647 3300028380 Ga0268265_10008862 Ga0268265_100088623 243
648 3300028381 Ga0268264_10008487 Ga0268264_100084879 243
649 3300031548 Ga0307408_100051958 Ga0307408_1000519582 243
650 3300031824 Ga0307413_10193030 Ga0307413_101930302 243
651 3300031852 Ga0307410_10012752 Ga0307410_100127524 243
652 3300031903 Ga0307407_10051571 Ga0307407_100515712 243
653 3300031903 Ga0307407_10130099 Ga0307407_101300992 243
654 3300031995 Ga0307409_100008491 Ga0307409_1000084917 243
655 3300031995 Ga0307409_100380131 Ga0307409_1003801312 243
656 3300032004 Ga0307414_10131779 Ga0307414_101317791 243
657 3300032005 Ga0307411_10041808 Ga0307411_100418082 243
658 3300032126 Ga0307415_100019598 Ga0307415_1000195982 243
659 3300035112 Ga0373932_0093526 Ga0373932_0093526_26_916 243
660 3300035170 Ga0373943_0010052 Ga0373943_0010052_2884_3711 243
661 3300035691 Ga0373931_0007229 Ga0373931_0007229_2459_3349 243
662 3300035695 Ga0373927_0030225 Ga0373927_0030225_942_1769 243
663 3300037312 Ga0395899_0013798 Ga0395899_0013798_639_1460 243
664 3300037312 Ga0395899_0228285 Ga0395899_0228285_365_1192 243
665 3300037418 Ga0395900_0036432 Ga0395900_0036432_1730_2551 243
666 3300037418 Ga0395900_0051432 Ga0395900_0051432_587_1408 243
667 3300037418 Ga0395900_0073055 Ga0395900_0073055_595_1422 243
668 3300037418 Ga0395900_0442876 Ga0395900_0442876_87_908 243
669 3300037466 Ga0395898_0103557 Ga0395898_0103557_873_1700 243
670 3300037471 Ga0395905_0008869 Ga0395905_0008869_7519_8340 243
671 3300037471 Ga0395905_0040679 Ga0395905_0040679_1357_2178 243
672 3300037471 Ga0395905_0041722 Ga0395905_0041722_1740_2567 243
673 3300037471 Ga0395905_0043749 Ga0395905_0043749_1157_1975 243
674 3300037471 Ga0395905_0100472 Ga0395905_0100472_737_1558 243
675 3300037471 Ga0395905_0222917 Ga0395905_0222917_17_838 243
676 3300037471 Ga0395905_0241556 Ga0395905_0241556_415_1242 243
677 3300037471 Ga0395905_0380693 Ga0395905_0380693_43_873 243
678 3300037471 Ga0395905_0592253 Ga0395905_0592253_95_922 243
679 3300038443 Ga0395901_0055766 Ga0395901_0055766_1675_2502 243
680 3300038443 Ga0395901_0067747 Ga0395901_0067747_293_1111 243
681 3300038443 Ga0395901_0070145 Ga0395901_0070145_175_996 243
682 3300038443 Ga0395901_0070313 Ga0395901_0070313_308_1129 243
683 3300038443 Ga0395901_0092854 Ga0395901_0092854_1871_2692 243
684 3300038443 Ga0395901_0155176 Ga0395901_0155176_89_916 243
685 3300042157 Ga0439458_0000160 Ga0439458_0000160_8456_9277 243
686 3300042439 Ga0439464_0001497 Ga0439464_0001497_2857_3675 243
687 3300044656 Ga0466969_0084563 Ga0466969_0084563_289_1116 243
688 3300044694 Ga0466963_0036678 Ga0466963_0036678_1477_2304 243
689 3300044694 Ga0466963_0128728 Ga0466963_0128728_879_1709 243
690 3300044694 Ga0466963_0149665 Ga0466963_0149665_15_842 243
691 3300044842 Ga0466957_0010777 Ga0466957_0010777_1830_2654 243
692 3300044842 Ga0466957_0044633 Ga0466957_0044633_1224_2045 243
693 3300044842 Ga0466957_0052930 Ga0466957_0052930_141_968 243
694 3300044842 Ga0466957_0191531 Ga0466957_0191531_223_1044 243
695 3300045049 Ga0466959_0166311 Ga0466959_0166311_205_1032 243
696 3300045836 Ga0466958_0145083 Ga0466958_0145083_134_955 243
697 3300045836 Ga0466958_0366852 Ga0466958_0366852_39_866 243
698 3300045976 Ga0466967_0114265 Ga0466967_0114265_369_1238 243
699 3300045976 Ga0466967_0421432 Ga0466967_0421432_412_1239 243
700 3300045976 Ga0466967_0450821 Ga0466967_0450821_363_1184 243
701 3300049590 Ga0501074_0363173 Ga0501074_0363173_41_868 243
702 3300049741 Ga0501079_0271079 Ga0501079_0271079_387_1214 243
703 3300049742 Ga0501080_0019604 Ga0501080_0019604_2388_3215 243
704 3300049765 Ga0501268_012010 Ga0501268_012010_212_1033 243
705 3300061719 Ga0466962_0138593 Ga0466962_0138593_315_1142 243
706 3300001989 JGI24739J22299_10017154 JGI24739J22299_100171542 244
707 3300001990 JGI24737J22298_10001584 JGI24737J22298_100015842 244
708 3300001991 JGI24743J22301_10007926 JGI24743J22301_100079262 244
709 3300001991 JGI24743J22301_10027533 JGI24743J22301_100275331 244
710 3300002075 JGI24738J21930_10020728 JGI24738J21930_100207281 244
711 3300005328 Ga0070676_10025188 Ga0070676_100251882 244
712 3300005329 Ga0070683_100140707 Ga0070683_1001407072 244
713 3300005331 Ga0070670_100031775 Ga0070670_1000317752 244
714 3300005331 Ga0070670_100066321 Ga0070670_1000663212 244
715 3300005335 Ga0070666_10213220 Ga0070666_102132202 244
716 3300005338 Ga0068868_100312205 Ga0068868_1003122052 244
717 3300005339 Ga0070660_100180228 Ga0070660_1001802282 244
718 3300005354 Ga0070675_100464049 Ga0070675_1004640492 244
719 3300005364 Ga0070673_100028727 Ga0070673_1000287272 244
720 3300005364 Ga0070673_100126532 Ga0070673_1001265322 244
721 3300005366 Ga0070659_100065993 Ga0070659_1000659932 244
722 3300005457 Ga0070662_100070691 Ga0070662_1000706912 244
723 3300005457 Ga0070662_100089457 Ga0070662_1000894572 244
724 3300005535 Ga0070684_100187484 Ga0070684_1001874842 244
725 3300005539 Ga0068853_100230173 Ga0068853_1002301732 244
726 3300005548 Ga0070665_100045989 Ga0070665_1000459893 244
727 3300005549 Ga0070704_100317540 Ga0070704_1003175402 244
728 3300005577 Ga0068857_100003003 Ga0068857_1000030039 244
729 3300005577 Ga0068857_100020025 Ga0068857_1000200255 244
730 3300005578 Ga0068854_100004155 Ga0068854_1000041552 244
731 3300005616 Ga0068852_100116450 Ga0068852_1001164502 244
732 3300005841 Ga0068863_100005669 Ga0068863_10000566912 244
733 3300005841 Ga0068863_100055734 Ga0068863_1000557342 244
734 3300009553 Ga0105249_10749572 Ga0105249_107495721 244
735 3300013100 Ga0157373_10012009 Ga0157373_100120097 244
736 3300013102 Ga0157371_10081208 Ga0157371_100812082 244
737 3300013307 Ga0157372_10119882 Ga0157372_101198822 244
738 3300025904 Ga0207647_10114561 Ga0207647_101145612 244
739 3300025907 Ga0207645_10005215 Ga0207645_100052155 244
740 3300025919 Ga0207657_10033906 Ga0207657_100339063 244
741 3300025920 Ga0207649_10057339 Ga0207649_100573392 244
742 3300025925 Ga0207650_10051253 Ga0207650_100512532 244
743 3300025925 Ga0207650_10150517 Ga0207650_101505172 244
744 3300025931 Ga0207644_10472246 Ga0207644_104722462 244
745 3300025932 Ga0207690_10031983 Ga0207690_100319832 244
746 3300025932 Ga0207690_10572433 Ga0207690_105724331 244
747 3300025933 Ga0207706_10020060 Ga0207706_100200605 244
748 3300025933 Ga0207706_10060769 Ga0207706_100607693 244
749 3300025937 Ga0207669_10192884 Ga0207669_101928841 244
750 3300025944 Ga0207661_10209057 Ga0207661_102090571 244
751 3300026041 Ga0207639_10111985 Ga0207639_101119852 244
752 3300026067 Ga0207678_10005023 Ga0207678_100050232 244
753 3300026088 Ga0207641_10011660 Ga0207641_100116608 244
754 3300026089 Ga0207648_10138611 Ga0207648_101386113 244
755 3300026116 Ga0207674_10007637 Ga0207674_100076373 244
756 3300026116 Ga0207674_10033866 Ga0207674_100338662 244
757 3300028379 Ga0268266_10088056 Ga0268266_100880562 244
758 3300031731 Ga0307405_10341223 Ga0307405_103412232 244
759 3300031824 Ga0307413_10144753 Ga0307413_101447532 244
760 3300032004 Ga0307414_10217176 Ga0307414_102171761 244
761 3300032005 Ga0307411_10099180 Ga0307411_100991802 244
762 3300032126 Ga0307415_100216363 Ga0307415_1002163632 244
763 3300037312 Ga0395899_0064142 Ga0395899_0064142_1231_2052 244
764 3300037418 Ga0395900_0069555 Ga0395900_0069555_2293_3114 244
765 3300037418 Ga0395900_0317046 Ga0395900_0317046_75_896 244
766 3300037466 Ga0395898_0018633 Ga0395898_0018633_459_1280 244
767 3300037466 Ga0395898_0530800 Ga0395898_0530800_156_977 244
768 3300037471 Ga0395905_0002330 Ga0395905_0002330_9793_10614 244
769 3300037471 Ga0395905_0009804 Ga0395905_0009804_7291_8112 244
770 3300037471 Ga0395905_0158139 Ga0395905_0158139_1126_1953 244
771 3300037471 Ga0395905_0217989 Ga0395905_0217989_191_1012 244
772 3300038443 Ga0395901_0026433 Ga0395901_0026433_3545_4366 244
773 3300001979 JGI24740J21852_10003553 JGI24740J21852_100035533 245
774 3300005327 Ga0070658_10025606 Ga0070658_100256063 245
775 3300005336 Ga0070680_100032124 Ga0070680_1000321243 245
776 3300005337 Ga0070682_100008674 Ga0070682_1000086743 245
777 3300005341 Ga0070691_10000317 Ga0070691_1000031713 245
778 3300005457 Ga0070662_100113433 Ga0070662_1001134332 245
779 3300005530 Ga0070679_100101931 Ga0070679_1001019312 245
780 3300005535 Ga0070684_100015644 Ga0070684_1000156443 245
781 3300005539 Ga0068853_100032634 Ga0068853_1000326343 245
782 3300005564 Ga0070664_100008785 Ga0070664_1000087854 245
783 3300005577 Ga0068857_100007256 Ga0068857_1000072566 245
784 3300005578 Ga0068854_100036074 Ga0068854_1000360742 245
785 3300005834 Ga0068851_10055765 Ga0068851_100557652 245
786 3300009093 Ga0105240_10070138 Ga0105240_100701381 245
787 3300009545 Ga0105237_10010459 Ga0105237_100104594 245
788 3300009551 Ga0105238_10037975 Ga0105238_100379753 245
789 3300013100 Ga0157373_10026182 Ga0157373_100261822 245
790 3300013104 Ga0157370_10009365 Ga0157370_100093653 245
791 3300013105 Ga0157369_10546448 Ga0157369_105464482 245
792 3300013307 Ga0157372_10056188 Ga0157372_100561881 245
793 3300020070 Ga0206356_11518027 Ga0206356_115180272 245
794 3300022467 Ga0224712_10135891 Ga0224712_101358912 245
795 3300025321 Ga0207656_10201455 Ga0207656_102014551 245
796 3300025904 Ga0207647_10001424 Ga0207647_100014244 245
797 3300025913 Ga0207695_10012117 Ga0207695_100121177 245
798 3300025917 Ga0207660_10362985 Ga0207660_103629851 245
799 3300025919 Ga0207657_10007431 Ga0207657_100074314 245
800 3300025920 Ga0207649_10013315 Ga0207649_100133153 245
801 3300025924 Ga0207694_10045103 Ga0207694_100451032 245
802 3300025932 Ga0207690_10002539 Ga0207690_100025392 245
803 3300025933 Ga0207706_10388058 Ga0207706_103880582 245
804 3300025944 Ga0207661_10429043 Ga0207661_104290432 245
805 3300025949 Ga0207667_10012419 Ga0207667_100124192 245
806 3300026041 Ga0207639_10042855 Ga0207639_100428552 245
807 3300026067 Ga0207678_10024585 Ga0207678_100245852 245
808 3300026078 Ga0207702_10010053 Ga0207702_100100533 245
809 3300026116 Ga0207674_10009450 Ga0207674_100094504 245
810 3300026142 Ga0207698_10002267 Ga0207698_100022673 245
811 3300037312 Ga0395899_0043275 Ga0395899_0043275_826_1650 245
812 3300037466 Ga0395898_0026753 Ga0395898_0026753_2609_3433 245
813 3300038443 Ga0395901_0544706 Ga0395901_0544706_133_960 245
814 3300044694 Ga0466963_0048807 Ga0466963_0048807_712_1536 245
815 3300044842 Ga0466957_0143719 Ga0466957_0143719_278_1102 245
816 3300045836 Ga0466958_0084515 Ga0466958_0084515_390_1214 245
817 3300045976 Ga0466967_0041175 Ga0466967_0041175_2923_3810 245
818 3300048915 Ga0496112_0001713 Ga0496112_0001713_2626_3453 245
819 3300048916 Ga0496113_0040294 Ga0496113_0040294_2297_3124 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09955

DUF2189

Predicted integral membrane protein (DUF2189)

90

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.5352 40 230
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.5122 21 240
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.5 21 240
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.4413 40 230
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.3175 27 225
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4278 14 233 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3942 14 233 1.20.1070.10
af_Q18000_173_429_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3414 1 234 1.20.1070.10
af_Q18000_173_429_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.329 1 234 1.20.1070.10
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.3143 26 185 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A848U517-F1-model_v4 DUF2189 domain-containing protein 0.8111 12 244 GO:0016020
AF-A0A7W6WV38-F1-model_v4 Putative membrane protein 0.8077 13 245 GO:0016020
AF-A0A7Y5UKM6-F1-model_v4 DUF2189 domain-containing protein 0.8062 4 237 GO:0016020
AF-X7EH69-F1-model_v4 Cytochrome C oxidase subunit I 0.8036 14 237 GO:0016020
AF-A0A4V3CX01-F1-model_v4 Putative membrane protein 0.8025 13 237 GO:0016020

Feature Viewer

pLDDT pTM Quality
73.7 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map