F482179
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 216 | 819 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0039882|Ga0395905_0039882_944_1816 |
| Length | 290 |
| Sequence | MAMIEAPGASMRRTAPNQESAMATVSRVSASKTKIPVRKISDEDLRWSLRQGLADFGDLRGDLVFAGLIYTFIGLAAVVMTTNGPLMPFFLPVVAGVGLMGPVAAVGFYELARRREAGQEVHWFNFLDVRKRPSVDDMGIVAGLLLAIFFAWLLAAGALYVALFGWATPTSIGGFITSVFTTPRGWALIILGGAIGAIFGWIVLAFSVASMPMLVDCDISAAEAVSASWRAAHANKAEMIRWGIIVTALLFLGSLPLFVGLAFVLPWLGYATWHLYTRLIDRDSLARRCD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 214 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 2.44 |
| Rhizosphere | 97.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003553 | 3300001979 | Bacteria | 6831 |
| 2 | JGI24740J21852_10030528 | 3300001979 | Bacteria | 1751 |
| 3 | JGI24739J22299_10016585 | 3300001989 | Bacteria | 2665 |
| 4 | JGI24739J22299_10017154 | 3300001989 | Bacteria | 2615 |
| 5 | JGI24739J22299_10031302 | 3300001989 | Bacteria | 1839 |
| 6 | JGI24737J22298_10000542 | 3300001990 | Bacteria | 13246 |
| 7 | JGI24737J22298_10000692 | 3300001990 | Bacteria | 11841 |
| 8 | JGI24737J22298_10001584 | 3300001990 | Bacteria | 8090 |
| 9 | JGI24737J22298_10016233 | 3300001990 | Bacteria | 2404 |
| 10 | JGI24743J22301_10007926 | 3300001991 | Bacteria | 1853 |
| 11 | JGI24743J22301_10027533 | 3300001991 | Bacteria | 1110 |
| 12 | JGI24738J21930_10015309 | 3300002075 | Bacteria | 1634 |
| 13 | JGI24738J21930_10020728 | 3300002075 | Bacteria | 1366 |
| 14 | JGI24744J21845_10000329 | 3300002077 | Bacteria | 7969 |
| 15 | rootL2_10016393 | 3300003322 | Bacteria | 2420 |
| 16 | Ga0070658_10006175 | 3300005327 | Bacteria | 9714 |
| 17 | Ga0070658_10025606 | 3300005327 | Bacteria | 4729 |
| 18 | Ga0070658_10031623 | 3300005327 | Bacteria | 4251 |
| 19 | Ga0070658_10054560 | 3300005327 | Bacteria | 3245 |
| 20 | Ga0070658_10192827 | 3300005327 | Bacteria | 1718 |
| 21 | Ga0070658_10204665 | 3300005327 | Bacteria | 1666 |
| 22 | Ga0070658_10493271 | 3300005327 | Bacteria | 1057 |
| 23 | Ga0070676_10009217 | 3300005328 | Bacteria | 5334 |
| 24 | Ga0070676_10025188 | 3300005328 | Bacteria | 3360 |
| 25 | Ga0070683_100000846 | 3300005329 | Bacteria | 22677 |
| 26 | Ga0070683_100074027 | 3300005329 | Bacteria | 3181 |
| 27 | Ga0070683_100140707 | 3300005329 | Bacteria | 2286 |
| 28 | Ga0070683_100240111 | 3300005329 | Bacteria | 1723 |
| 29 | Ga0070690_100015433 | 3300005330 | Bacteria | 4555 |
| 30 | Ga0070690_100034476 | 3300005330 | Bacteria | 3172 |
| 31 | Ga0070690_100370898 | 3300005330 | Bacteria | 1044 |
| 32 | Ga0070670_100031775 | 3300005331 | Bacteria | 4547 |
| 33 | Ga0070670_100040271 | 3300005331 | Bacteria | 4018 |
| 34 | Ga0070670_100066321 | 3300005331 | Bacteria | 3097 |
| 35 | Ga0070670_100068604 | 3300005331 | Bacteria | 3043 |
| 36 | Ga0070670_100076321 | 3300005331 | Bacteria | 2879 |
| 37 | Ga0070670_100228112 | 3300005331 | Bacteria | 1621 |
| 38 | Ga0068869_100000728 | 3300005334 | Bacteria | 18720 |
| 39 | Ga0068869_100092515 | 3300005334 | Bacteria | 2276 |
| 40 | Ga0070666_10000784 | 3300005335 | Bacteria | 19242 |
| 41 | Ga0070666_10003320 | 3300005335 | Bacteria | 9751 |
| 42 | Ga0070666_10062089 | 3300005335 | Bacteria | 2530 |
| 43 | Ga0070666_10098559 | 3300005335 | Bacteria | 2013 |
| 44 | Ga0070666_10117760 | 3300005335 | Bacteria | 1840 |
| 45 | Ga0070666_10213220 | 3300005335 | Bacteria | 1360 |
| 46 | Ga0070680_100000971 | 3300005336 | Bacteria | 20306 |
| 47 | Ga0070680_100016912 | 3300005336 | Bacteria | 5742 |
| 48 | Ga0070680_100032124 | 3300005336 | Bacteria | 4223 |
| 49 | Ga0070680_100072566 | 3300005336 | Bacteria | 2829 |
| 50 | Ga0070682_100008674 | 3300005337 | Bacteria | 5734 |
| 51 | Ga0070682_100125012 | 3300005337 | Bacteria | 1732 |
| 52 | Ga0070682_100322990 | 3300005337 | Bacteria | 1141 |
| 53 | Ga0070682_100354125 | 3300005337 | Bacteria | 1095 |
| 54 | Ga0068868_100008379 | 3300005338 | Bacteria | 7401 |
| 55 | Ga0068868_100010669 | 3300005338 | Bacteria | 6658 |
| 56 | Ga0068868_100037007 | 3300005338 | Bacteria | 3781 |
| 57 | Ga0068868_100054984 | 3300005338 | Bacteria | 3140 |
| 58 | Ga0068868_100312205 | 3300005338 | Bacteria | 1338 |
| 59 | Ga0070660_100004392 | 3300005339 | Bacteria | 9742 |
| 60 | Ga0070660_100006501 | 3300005339 | Bacteria | 8107 |
| 61 | Ga0070660_100011788 | 3300005339 | Bacteria | 6226 |
| 62 | Ga0070660_100017265 | 3300005339 | Bacteria | 5258 |
| 63 | Ga0070660_100024885 | 3300005339 | Bacteria | 4446 |
| 64 | Ga0070660_100027054 | 3300005339 | Bacteria | 4277 |
| 65 | Ga0070660_100062645 | 3300005339 | Bacteria | 2890 |
| 66 | Ga0070660_100131426 | 3300005339 | Bacteria | 2004 |
| 67 | Ga0070660_100180228 | 3300005339 | Bacteria | 1709 |
| 68 | Ga0070660_100274541 | 3300005339 | Bacteria | 1378 |
| 69 | Ga0070689_100277602 | 3300005340 | Bacteria | 1389 |
| 70 | Ga0070691_10000317 | 3300005341 | Bacteria | 17038 |
| 71 | Ga0070661_100003518 | 3300005344 | Bacteria | 10794 |
| 72 | Ga0070661_100106266 | 3300005344 | Bacteria | 2093 |
| 73 | Ga0070661_100163737 | 3300005344 | Bacteria | 1685 |
| 74 | Ga0070661_100168430 | 3300005344 | Bacteria | 1663 |
| 75 | Ga0070661_100345469 | 3300005344 | Bacteria | 1166 |
| 76 | Ga0070661_100375654 | 3300005344 | Bacteria | 1120 |
| 77 | Ga0070692_10005091 | 3300005345 | Bacteria | 5559 |
| 78 | Ga0070669_100000565 | 3300005353 | Bacteria | 27565 |
| 79 | Ga0070669_100047531 | 3300005353 | Bacteria | 3130 |
| 80 | Ga0070669_100299215 | 3300005353 | Bacteria | 1293 |
| 81 | Ga0070675_100047118 | 3300005354 | Bacteria | 3532 |
| 82 | Ga0070675_100111392 | 3300005354 | Bacteria | 2316 |
| 83 | Ga0070675_100464049 | 3300005354 | Bacteria | 1137 |
| 84 | Ga0070671_100002084 | 3300005355 | Bacteria | 15396 |
| 85 | Ga0070671_100009573 | 3300005355 | Bacteria | 7786 |
| 86 | Ga0070671_100016983 | 3300005355 | Bacteria | 5885 |
| 87 | Ga0070671_100023561 | 3300005355 | Bacteria | 5039 |
| 88 | Ga0070674_100240171 | 3300005356 | Bacteria | 1418 |
| 89 | Ga0070673_100003973 | 3300005364 | Bacteria | 9300 |
| 90 | Ga0070673_100021894 | 3300005364 | Bacteria | 4645 |
| 91 | Ga0070673_100028727 | 3300005364 | Bacteria | 4139 |
| 92 | Ga0070673_100057329 | 3300005364 | Bacteria | 3077 |
| 93 | Ga0070673_100075272 | 3300005364 | Bacteria | 2723 |
| 94 | Ga0070673_100080104 | 3300005364 | Bacteria | 2645 |
| 95 | Ga0070673_100126532 | 3300005364 | Bacteria | 2139 |
| 96 | Ga0070673_100452846 | 3300005364 | Bacteria | 1155 |
| 97 | Ga0070659_100000887 | 3300005366 | Bacteria | 21873 |
| 98 | Ga0070659_100001567 | 3300005366 | Bacteria | 16465 |
| 99 | Ga0070659_100032065 | 3300005366 | Bacteria | 4074 |
| 100 | Ga0070659_100065993 | 3300005366 | Bacteria | 2867 |
| 101 | Ga0070659_100069938 | 3300005366 | Bacteria | 2787 |
| 102 | Ga0070659_100082828 | 3300005366 | Bacteria | 2563 |
| 103 | Ga0070659_100100516 | 3300005366 | Bacteria | 2327 |
| 104 | Ga0070659_100234005 | 3300005366 | Bacteria | 1519 |
| 105 | Ga0070659_100248448 | 3300005366 | Bacteria | 1474 |
| 106 | Ga0070659_100462408 | 3300005366 | Unclassified | 1078 |
| 107 | Ga0070667_100000764 | 3300005367 | Bacteria | 30578 |
| 108 | Ga0070667_100010885 | 3300005367 | Bacteria | 7523 |
| 109 | Ga0070667_100035741 | 3300005367 | Bacteria | 4163 |
| 110 | Ga0070667_100050410 | 3300005367 | Bacteria | 3508 |
| 111 | Ga0070667_100075138 | 3300005367 | Bacteria | 2884 |
| 112 | Ga0070667_100126572 | 3300005367 | Bacteria | 2227 |
| 113 | Ga0070667_100244306 | 3300005367 | Bacteria | 1604 |
| 114 | Ga0070709_10049343 | 3300005434 | Bacteria | 2631 |
| 115 | Ga0070714_100335091 | 3300005435 | Unclassified | 1418 |
| 116 | Ga0070714_100389813 | 3300005435 | Bacteria | 1315 |
| 117 | Ga0070713_100210184 | 3300005436 | Bacteria | 1761 |
| 118 | Ga0070694_100009204 | 3300005444 | Bacteria | 6057 |
| 119 | Ga0070663_100001696 | 3300005455 | Bacteria | 12235 |
| 120 | Ga0070663_100011726 | 3300005455 | Bacteria | 5514 |
| 121 | Ga0070663_100043165 | 3300005455 | Bacteria | 3172 |
| 122 | Ga0070663_100051506 | 3300005455 | Bacteria | 2933 |
| 123 | Ga0070663_100171438 | 3300005455 | Bacteria | 1678 |
| 124 | Ga0070678_100348807 | 3300005456 | Bacteria | 1272 |
| 125 | Ga0070662_100000047 | 3300005457 | Bacteria | 66967 |
| 126 | Ga0070662_100008398 | 3300005457 | Bacteria | 6732 |
| 127 | Ga0070662_100026387 | 3300005457 | Bacteria | 4023 |
| 128 | Ga0070662_100053388 | 3300005457 | Bacteria | 2925 |
| 129 | Ga0070662_100070691 | 3300005457 | Bacteria | 2572 |
| 130 | Ga0070662_100089457 | 3300005457 | Bacteria | 2309 |
| 131 | Ga0070662_100099087 | 3300005457 | Bacteria | 2203 |
| 132 | Ga0070662_100113433 | 3300005457 | Bacteria | 2068 |
| 133 | Ga0070662_100189452 | 3300005457 | Bacteria | 1626 |
| 134 | Ga0070681_10192961 | 3300005458 | Bacteria | 1956 |
| 135 | Ga0068867_100012344 | 3300005459 | Bacteria | 6043 |
| 136 | Ga0068867_100068213 | 3300005459 | Unclassified | 2654 |
| 137 | Ga0070679_100061012 | 3300005530 | Bacteria | 3759 |
| 138 | Ga0070679_100101931 | 3300005530 | Bacteria | 2857 |
| 139 | Ga0070679_100131140 | 3300005530 | Bacteria | 2488 |
| 140 | Ga0070679_100264835 | 3300005530 | Unclassified | 1674 |
| 141 | Ga0070679_100347296 | 3300005530 | Bacteria | 1432 |
| 142 | Ga0070679_100441914 | 3300005530 | Bacteria | 1245 |
| 143 | Ga0070684_100015644 | 3300005535 | Bacteria | 6187 |
| 144 | Ga0070684_100028521 | 3300005535 | Bacteria | 4723 |
| 145 | Ga0070684_100187484 | 3300005535 | Bacteria | 1881 |
| 146 | Ga0068853_100000033 | 3300005539 | Bacteria | 113700 |
| 147 | Ga0068853_100005485 | 3300005539 | Bacteria | 9940 |
| 148 | Ga0068853_100032634 | 3300005539 | Bacteria | 4412 |
| 149 | Ga0068853_100125191 | 3300005539 | Bacteria | 2295 |
| 150 | Ga0068853_100183860 | 3300005539 | Bacteria | 1896 |
| 151 | Ga0068853_100230173 | 3300005539 | Bacteria | 1695 |
| 152 | Ga0068853_100332233 | 3300005539 | Bacteria | 1411 |
| 153 | Ga0070672_100010512 | 3300005543 | Bacteria | 6422 |
| 154 | Ga0070672_100074735 | 3300005543 | Bacteria | 2704 |
| 155 | Ga0070672_100204553 | 3300005543 | Bacteria | 1652 |
| 156 | Ga0070686_100157745 | 3300005544 | Bacteria | 1595 |
| 157 | Ga0070696_100199908 | 3300005546 | Bacteria | 1491 |
| 158 | Ga0070693_100001255 | 3300005547 | Bacteria | 11477 |
| 159 | Ga0070693_100105467 | 3300005547 | Bacteria | 1724 |
| 160 | Ga0070693_100212860 | 3300005547 | Bacteria | 1262 |
| 161 | Ga0070665_100009636 | 3300005548 | Bacteria | 9767 |
| 162 | Ga0070665_100010704 | 3300005548 | Bacteria | 9286 |
| 163 | Ga0070665_100022897 | 3300005548 | Bacteria | 6290 |
| 164 | Ga0070665_100045989 | 3300005548 | Bacteria | 4384 |
| 165 | Ga0070665_100067978 | 3300005548 | Bacteria | 3572 |
| 166 | Ga0070704_100317540 | 3300005549 | Bacteria | 1304 |
| 167 | Ga0068855_100005847 | 3300005563 | Bacteria | 15017 |
| 168 | Ga0068855_100052849 | 3300005563 | Bacteria | 4782 |
| 169 | Ga0068855_100072569 | 3300005563 | Bacteria | 4000 |
| 170 | Ga0068855_100110052 | 3300005563 | Bacteria | 3163 |
| 171 | Ga0068855_100222500 | 3300005563 | Bacteria | 2116 |
| 172 | Ga0068855_100248015 | 3300005563 | Unclassified | 1987 |
| 173 | Ga0068855_100250463 | 3300005563 | Bacteria | 1976 |
| 174 | Ga0068855_100314468 | 3300005563 | Bacteria | 1732 |
| 175 | Ga0068855_100387993 | 3300005563 | Bacteria | 1532 |
| 176 | Ga0068855_100522439 | 3300005563 | Bacteria | 1288 |
| 177 | Ga0070664_100000066 | 3300005564 | Bacteria | 65204 |
| 178 | Ga0070664_100008785 | 3300005564 | Bacteria | 8184 |
| 179 | Ga0070664_100012124 | 3300005564 | Bacteria | 7001 |
| 180 | Ga0070664_100031007 | 3300005564 | Bacteria | 4464 |
| 181 | Ga0070664_100036798 | 3300005564 | Bacteria | 4112 |
| 182 | Ga0070664_100254465 | 3300005564 | Bacteria | 1579 |
| 183 | Ga0070664_100405614 | 3300005564 | Bacteria | 1247 |
| 184 | Ga0068857_100003003 | 3300005577 | Bacteria | 13924 |
| 185 | Ga0068857_100007256 | 3300005577 | Bacteria | 9544 |
| 186 | Ga0068857_100010273 | 3300005577 | Bacteria | 8136 |
| 187 | Ga0068857_100020025 | 3300005577 | Bacteria | 5881 |
| 188 | Ga0068857_100022914 | 3300005577 | Bacteria | 5494 |
| 189 | Ga0068857_100027971 | 3300005577 | Bacteria | 4972 |
| 190 | Ga0068857_100057007 | 3300005577 | Bacteria | 3467 |
| 191 | Ga0068857_100115040 | 3300005577 | Bacteria | 2419 |
| 192 | Ga0068854_100004155 | 3300005578 | Bacteria | 9104 |
| 193 | Ga0068854_100009153 | 3300005578 | Bacteria | 6387 |
| 194 | Ga0068854_100010935 | 3300005578 | Bacteria | 5888 |
| 195 | Ga0068854_100034029 | 3300005578 | Bacteria | 3556 |
| 196 | Ga0068854_100036074 | 3300005578 | Bacteria | 3464 |
| 197 | Ga0068854_100089019 | 3300005578 | Bacteria | 2293 |
| 198 | Ga0068854_100312939 | 3300005578 | Unclassified | 1274 |
| 199 | Ga0068856_100000162 | 3300005614 | Bacteria | 69640 |
| 200 | Ga0068856_100085927 | 3300005614 | Bacteria | 3125 |
| 201 | Ga0068856_100103381 | 3300005614 | Bacteria | 2842 |
| 202 | Ga0068856_100125238 | 3300005614 | Bacteria | 2573 |
| 203 | Ga0068856_100229197 | 3300005614 | Bacteria | 1873 |
| 204 | Ga0068856_100482665 | 3300005614 | Bacteria | 1260 |
| 205 | Ga0068856_100814131 | 3300005614 | Unclassified | 953 |
| 206 | Ga0068852_100002091 | 3300005616 | Bacteria | 13645 |
| 207 | Ga0068852_100010396 | 3300005616 | Bacteria | 6953 |
| 208 | Ga0068852_100045542 | 3300005616 | Bacteria | 3732 |
| 209 | Ga0068852_100116450 | 3300005616 | Bacteria | 2438 |
| 210 | Ga0068852_100132342 | 3300005616 | Bacteria | 2298 |
| 211 | Ga0068852_100190166 | 3300005616 | Bacteria | 1936 |
| 212 | Ga0068852_100197790 | 3300005616 | Bacteria | 1901 |
| 213 | Ga0068852_100211182 | 3300005616 | Unclassified | 1841 |
| 214 | Ga0068852_100268971 | 3300005616 | Bacteria | 1639 |
| 215 | Ga0068859_100021639 | 3300005617 | Bacteria | 6453 |
| 216 | Ga0068859_100275171 | 3300005617 | Bacteria | 1776 |
| 217 | Ga0068859_100366815 | 3300005617 | Bacteria | 1535 |
| 218 | Ga0068859_100742325 | 3300005617 | Bacteria | 1071 |
| 219 | Ga0068864_100045578 | 3300005618 | Bacteria | 3761 |
| 220 | Ga0068866_10081721 | 3300005718 | Bacteria | 1737 |
| 221 | Ga0068866_10087687 | 3300005718 | Unclassified | 1687 |
| 222 | Ga0068861_100039577 | 3300005719 | Bacteria | 3520 |
| 223 | Ga0068851_10055765 | 3300005834 | Bacteria | 2014 |
| 224 | Ga0068851_10104647 | 3300005834 | Bacteria | 1505 |
| 225 | Ga0068870_10408811 | 3300005840 | Unclassified | 885 |
| 226 | Ga0068863_100005669 | 3300005841 | Bacteria | 12265 |
| 227 | Ga0068863_100007091 | 3300005841 | Bacteria | 10986 |
| 228 | Ga0068863_100017811 | 3300005841 | Bacteria | 6799 |
| 229 | Ga0068863_100023090 | 3300005841 | Bacteria | 5944 |
| 230 | Ga0068863_100055734 | 3300005841 | Bacteria | 3743 |
| 231 | Ga0068863_100728430 | 3300005841 | Bacteria | 987 |
| 232 | Ga0068858_100006383 | 3300005842 | Bacteria | 11487 |
| 233 | Ga0068858_100025462 | 3300005842 | Bacteria | 5504 |
| 234 | Ga0068858_100041297 | 3300005842 | Bacteria | 4277 |
| 235 | Ga0068858_100052236 | 3300005842 | Bacteria | 3781 |
| 236 | Ga0068858_100246148 | 3300005842 | Bacteria | 1697 |
| 237 | Ga0068858_100292225 | 3300005842 | Bacteria | 1554 |
| 238 | Ga0068858_100482509 | 3300005842 | Bacteria | 1196 |
| 239 | Ga0068860_100007040 | 3300005843 | Bacteria | 11261 |
| 240 | Ga0068860_100051533 | 3300005843 | Bacteria | 3917 |
| 241 | Ga0068860_100074629 | 3300005843 | Unclassified | 3225 |
| 242 | Ga0068860_100615309 | 3300005843 | Bacteria | 1092 |
| 243 | Ga0068862_100005282 | 3300005844 | Bacteria | 10824 |
| 244 | Ga0068862_100077464 | 3300005844 | Bacteria | 2879 |
| 245 | Ga0068862_100158906 | 3300005844 | Bacteria | 2016 |
| 246 | Ga0068862_100247475 | 3300005844 | Bacteria | 1623 |
| 247 | Ga0068862_100489479 | 3300005844 | Bacteria | 1165 |
| 248 | Ga0070717_10010474 | 3300006028 | Bacteria | 7004 |
| 249 | Ga0070712_100009442 | 3300006175 | Bacteria | 6148 |
| 250 | Ga0070712_100565103 | 3300006175 | Bacteria | 960 |
| 251 | Ga0097621_100055907 | 3300006237 | Bacteria | 3223 |
| 252 | Ga0097621_100406897 | 3300006237 | Bacteria | 1219 |
| 253 | Ga0068871_100066197 | 3300006358 | Bacteria | 2961 |
| 254 | Ga0068865_100517064 | 3300006881 | Bacteria | 998 |
| 255 | Ga0097620_100021638 | 3300006931 | Bacteria | 6453 |
| 256 | Ga0097620_100275164 | 3300006931 | Bacteria | 1776 |
| 257 | Ga0097620_100366790 | 3300006931 | Bacteria | 1535 |
| 258 | Ga0097620_100742406 | 3300006931 | Bacteria | 1071 |
| 259 | Ga0075435_100207109 | 3300007076 | Bacteria | 1663 |
| 260 | Ga0105240_10032102 | 3300009093 | Bacteria | 6801 |
| 261 | Ga0105240_10043569 | 3300009093 | Bacteria | 5709 |
| 262 | Ga0105240_10070138 | 3300009093 | Bacteria | 4336 |
| 263 | Ga0105240_10227895 | 3300009093 | Bacteria | 2167 |
| 264 | Ga0105245_10000782 | 3300009098 | Bacteria | 28837 |
| 265 | Ga0105245_10189780 | 3300009098 | Unclassified | 1968 |
| 266 | Ga0105245_10420056 | 3300009098 | Unclassified | 1340 |
| 267 | Ga0105245_10573464 | 3300009098 | Bacteria | 1152 |
| 268 | Ga0105243_10169600 | 3300009148 | Bacteria | 1889 |
| 269 | Ga0105243_10244561 | 3300009148 | Bacteria | 1598 |
| 270 | Ga0105241_10030928 | 3300009174 | Bacteria | 4004 |
| 271 | Ga0105241_10046203 | 3300009174 | Bacteria | 3306 |
| 272 | Ga0105241_10117019 | 3300009174 | Bacteria | 2141 |
| 273 | Ga0105241_10131570 | 3300009174 | Bacteria | 2026 |
| 274 | Ga0105241_10603881 | 3300009174 | Unclassified | 991 |
| 275 | Ga0105242_10053531 | 3300009176 | Bacteria | 3296 |
| 276 | Ga0105242_10154828 | 3300009176 | Bacteria | 2001 |
| 277 | Ga0105248_10003721 | 3300009177 | Bacteria | 16908 |
| 278 | Ga0105248_10012199 | 3300009177 | Bacteria | 9479 |
| 279 | Ga0105248_10048261 | 3300009177 | Bacteria | 4776 |
| 280 | Ga0105248_10081065 | 3300009177 | Bacteria | 3648 |
| 281 | Ga0105248_10191344 | 3300009177 | Bacteria | 2306 |
| 282 | Ga0105237_10010459 | 3300009545 | Bacteria | 9865 |
| 283 | Ga0105237_10078383 | 3300009545 | Unclassified | 3294 |
| 284 | Ga0105238_10037975 | 3300009551 | Bacteria | 4894 |
| 285 | Ga0105238_10041123 | 3300009551 | Bacteria | 4682 |
| 286 | Ga0105238_10046723 | 3300009551 | Bacteria | 4367 |
| 287 | Ga0105238_10096775 | 3300009551 | Bacteria | 2937 |
| 288 | Ga0105238_10121785 | 3300009551 | Bacteria | 2588 |
| 289 | Ga0105238_10384755 | 3300009551 | Bacteria | 1395 |
| 290 | Ga0105238_10399044 | 3300009551 | Bacteria | 1368 |
| 291 | Ga0105249_10129924 | 3300009553 | Unclassified | 2403 |
| 292 | Ga0105249_10290631 | 3300009553 | Bacteria | 1636 |
| 293 | Ga0105249_10749572 | 3300009553 | Bacteria | 1039 |
| 294 | Ga0105239_10235909 | 3300010375 | Unclassified | 2053 |
| 295 | Ga0105239_10300502 | 3300010375 | Unclassified | 1807 |
| 296 | Ga0105246_10064863 | 3300011119 | Bacteria | 2553 |
| 297 | Ga0105246_10229467 | 3300011119 | Bacteria | 1461 |
| 298 | Ga0105246_10381103 | 3300011119 | Bacteria | 1165 |
| 299 | Ga0157373_10004543 | 3300013100 | Bacteria | 10431 |
| 300 | Ga0157373_10012009 | 3300013100 | Bacteria | 6366 |
| 301 | Ga0157373_10026182 | 3300013100 | Bacteria | 4215 |
| 302 | Ga0157373_10032530 | 3300013100 | Bacteria | 3754 |
| 303 | Ga0157373_10039353 | 3300013100 | Bacteria | 3386 |
| 304 | Ga0157373_10052668 | 3300013100 | Bacteria | 2895 |
| 305 | Ga0157373_10076014 | 3300013100 | Bacteria | 2370 |
| 306 | Ga0157373_10088159 | 3300013100 | Bacteria | 2186 |
| 307 | Ga0157373_10130908 | 3300013100 | Bacteria | 1765 |
| 308 | Ga0157373_10201820 | 3300013100 | Bacteria | 1402 |
| 309 | Ga0157371_10039467 | 3300013102 | Bacteria | 3375 |
| 310 | Ga0157371_10081208 | 3300013102 | Bacteria | 2295 |
| 311 | Ga0157371_10093477 | 3300013102 | Bacteria | 2131 |
| 312 | Ga0157371_10106406 | 3300013102 | Bacteria | 1990 |
| 313 | Ga0157371_10151371 | 3300013102 | Bacteria | 1655 |
| 314 | Ga0157371_10172066 | 3300013102 | Bacteria | 1548 |
| 315 | Ga0157371_10183291 | 3300013102 | Bacteria | 1498 |
| 316 | Ga0157370_10009228 | 3300013104 | Bacteria | 10573 |
| 317 | Ga0157370_10009365 | 3300013104 | Bacteria | 10475 |
| 318 | Ga0157370_10042285 | 3300013104 | Bacteria | 4393 |
| 319 | Ga0157369_10011303 | 3300013105 | Bacteria | 10143 |
| 320 | Ga0157369_10026642 | 3300013105 | Bacteria | 6411 |
| 321 | Ga0157369_10029866 | 3300013105 | Bacteria | 6019 |
| 322 | Ga0157369_10086612 | 3300013105 | Bacteria | 3345 |
| 323 | Ga0157369_10111223 | 3300013105 | Unclassified | 2911 |
| 324 | Ga0157369_10154089 | 3300013105 | Bacteria | 2428 |
| 325 | Ga0157369_10190590 | 3300013105 | Bacteria | 2155 |
| 326 | Ga0157369_10213548 | 3300013105 | Bacteria | 2022 |
| 327 | Ga0157369_10318242 | 3300013105 | Bacteria | 1618 |
| 328 | Ga0157369_10546448 | 3300013105 | Bacteria | 1197 |
| 329 | Ga0157374_10012401 | 3300013296 | Bacteria | 7415 |
| 330 | Ga0157374_10320997 | 3300013296 | Bacteria | 1535 |
| 331 | Ga0157378_10341621 | 3300013297 | Bacteria | 1460 |
| 332 | Ga0157378_10511267 | 3300013297 | Bacteria | 1201 |
| 333 | Ga0157378_10786420 | 3300013297 | Bacteria | 976 |
| 334 | Ga0163162_10037065 | 3300013306 | Bacteria | 4864 |
| 335 | Ga0163162_10063325 | 3300013306 | Bacteria | 3740 |
| 336 | Ga0163162_10120409 | 3300013306 | Unclassified | 2728 |
| 337 | Ga0157372_10056188 | 3300013307 | Bacteria | 4398 |
| 338 | Ga0157372_10065516 | 3300013307 | Bacteria | 4079 |
| 339 | Ga0157372_10119882 | 3300013307 | Bacteria | 3020 |
| 340 | Ga0157372_10525572 | 3300013307 | Bacteria | 1379 |
| 341 | Ga0157372_10691631 | 3300013307 | Bacteria | 1187 |
| 342 | Ga0157375_10180307 | 3300013308 | Bacteria | 2263 |
| 343 | Ga0157375_10319983 | 3300013308 | Bacteria | 1716 |
| 344 | Ga0163163_10217594 | 3300014325 | Bacteria | 1959 |
| 345 | Ga0182008_10064369 | 3300014497 | Bacteria | 1805 |
| 346 | Ga0157377_10058397 | 3300014745 | Bacteria | 2197 |
| 347 | Ga0157377_10080839 | 3300014745 | Bacteria | 1900 |
| 348 | Ga0157379_10017407 | 3300014968 | Bacteria | 6330 |
| 349 | Ga0157376_10003636 | 3300014969 | Bacteria | 10641 |
| 350 | Ga0197907_10160736 | 3300020069 | Bacteria | 1260 |
| 351 | Ga0206356_11518027 | 3300020070 | Bacteria | 1056 |
| 352 | Ga0224712_10135891 | 3300022467 | Bacteria | 1078 |
| 353 | Ga0207697_10000162 | 3300025315 | Bacteria | 33553 |
| 354 | Ga0207697_10024732 | 3300025315 | Bacteria | 2457 |
| 355 | Ga0207697_10034827 | 3300025315 | Bacteria | 2061 |
| 356 | Ga0207656_10201455 | 3300025321 | Bacteria | 961 |
| 357 | Ga0207642_10063885 | 3300025899 | Bacteria | 1723 |
| 358 | Ga0207688_10000909 | 3300025901 | Bacteria | 14961 |
| 359 | Ga0207680_10001490 | 3300025903 | Bacteria | 11062 |
| 360 | Ga0207680_10013511 | 3300025903 | Bacteria | 4197 |
| 361 | Ga0207647_10000073 | 3300025904 | Bacteria | 76404 |
| 362 | Ga0207647_10001093 | 3300025904 | Bacteria | 20911 |
| 363 | Ga0207647_10001424 | 3300025904 | Bacteria | 18340 |
| 364 | Ga0207647_10007124 | 3300025904 | Bacteria | 8108 |
| 365 | Ga0207647_10027780 | 3300025904 | Bacteria | 3685 |
| 366 | Ga0207647_10063967 | 3300025904 | Bacteria | 2236 |
| 367 | Ga0207647_10114561 | 3300025904 | Bacteria | 1593 |
| 368 | Ga0207647_10163935 | 3300025904 | Bacteria | 1296 |
| 369 | Ga0207699_10046160 | 3300025906 | Bacteria | 2546 |
| 370 | Ga0207645_10005215 | 3300025907 | Bacteria | 9473 |
| 371 | Ga0207645_10025315 | 3300025907 | Bacteria | 3840 |
| 372 | Ga0207645_10084702 | 3300025907 | Bacteria | 2035 |
| 373 | Ga0207645_10090463 | 3300025907 | Bacteria | 1968 |
| 374 | Ga0207705_10005195 | 3300025909 | Bacteria | 9759 |
| 375 | Ga0207705_10043846 | 3300025909 | Bacteria | 3214 |
| 376 | Ga0207705_10240702 | 3300025909 | Bacteria | 1378 |
| 377 | Ga0207705_10246754 | 3300025909 | Bacteria | 1361 |
| 378 | Ga0207654_10027047 | 3300025911 | Bacteria | 3114 |
| 379 | Ga0207707_10084991 | 3300025912 | Bacteria | 2764 |
| 380 | Ga0207707_10210340 | 3300025912 | Bacteria | 1695 |
| 381 | Ga0207695_10012117 | 3300025913 | Bacteria | 10363 |
| 382 | Ga0207695_10116166 | 3300025913 | Bacteria | 2650 |
| 383 | Ga0207695_10184346 | 3300025913 | Bacteria | 2007 |
| 384 | Ga0207671_10163149 | 3300025914 | Bacteria | 1726 |
| 385 | Ga0207693_10012012 | 3300025915 | Bacteria | 7001 |
| 386 | Ga0207693_10027018 | 3300025915 | Bacteria | 4539 |
| 387 | Ga0207660_10001465 | 3300025917 | Bacteria | 15872 |
| 388 | Ga0207660_10161929 | 3300025917 | Bacteria | 1727 |
| 389 | Ga0207660_10362985 | 3300025917 | Bacteria | 1162 |
| 390 | Ga0207660_10442184 | 3300025917 | Bacteria | 1051 |
| 391 | Ga0207657_10005786 | 3300025919 | Bacteria | 12891 |
| 392 | Ga0207657_10007431 | 3300025919 | Bacteria | 11239 |
| 393 | Ga0207657_10009175 | 3300025919 | Bacteria | 9975 |
| 394 | Ga0207657_10009587 | 3300025919 | Bacteria | 9719 |
| 395 | Ga0207657_10030651 | 3300025919 | Bacteria | 4880 |
| 396 | Ga0207657_10033906 | 3300025919 | Bacteria | 4597 |
| 397 | Ga0207657_10034062 | 3300025919 | Bacteria | 4584 |
| 398 | Ga0207657_10039012 | 3300025919 | Bacteria | 4223 |
| 399 | Ga0207657_10040290 | 3300025919 | Bacteria | 4141 |
| 400 | Ga0207657_10066559 | 3300025919 | Bacteria | 3066 |
| 401 | Ga0207657_10075768 | 3300025919 | Bacteria | 2839 |
| 402 | Ga0207657_10263064 | 3300025919 | Unclassified | 1372 |
| 403 | Ga0207649_10002318 | 3300025920 | Bacteria | 10692 |
| 404 | Ga0207649_10009296 | 3300025920 | Bacteria | 5377 |
| 405 | Ga0207649_10013315 | 3300025920 | Bacteria | 4589 |
| 406 | Ga0207649_10057339 | 3300025920 | Bacteria | 2435 |
| 407 | Ga0207649_10091128 | 3300025920 | Bacteria | 1996 |
| 408 | Ga0207649_10095186 | 3300025920 | Bacteria | 1959 |
| 409 | Ga0207649_10212739 | 3300025920 | Bacteria | 1372 |
| 410 | Ga0207649_10245283 | 3300025920 | Bacteria | 1288 |
| 411 | Ga0207649_10368720 | 3300025920 | Bacteria | 1067 |
| 412 | Ga0207652_10193911 | 3300025921 | Bacteria | 1827 |
| 413 | Ga0207652_10202000 | 3300025921 | Unclassified | 1789 |
| 414 | Ga0207652_10215420 | 3300025921 | Bacteria | 1730 |
| 415 | Ga0207652_10249866 | 3300025921 | Bacteria | 1599 |
| 416 | Ga0207681_10487061 | 3300025923 | Bacteria | 1008 |
| 417 | Ga0207681_10652510 | 3300025923 | Unclassified | 872 |
| 418 | Ga0207694_10003870 | 3300025924 | Bacteria | 11838 |
| 419 | Ga0207694_10028276 | 3300025924 | Bacteria | 4274 |
| 420 | Ga0207694_10045103 | 3300025924 | Unclassified | 3405 |
| 421 | Ga0207650_10022685 | 3300025925 | Bacteria | 4446 |
| 422 | Ga0207650_10051253 | 3300025925 | Bacteria | 3054 |
| 423 | Ga0207650_10069072 | 3300025925 | Bacteria | 2654 |
| 424 | Ga0207650_10100108 | 3300025925 | Bacteria | 2230 |
| 425 | Ga0207650_10127311 | 3300025925 | Bacteria | 1989 |
| 426 | Ga0207650_10150517 | 3300025925 | Bacteria | 1836 |
| 427 | Ga0207650_10177023 | 3300025925 | Bacteria | 1698 |
| 428 | Ga0207659_10062757 | 3300025926 | Bacteria | 2683 |
| 429 | Ga0207659_10125168 | 3300025926 | Bacteria | 1975 |
| 430 | Ga0207687_10008779 | 3300025927 | Bacteria | 6605 |
| 431 | Ga0207687_10156335 | 3300025927 | Bacteria | 1745 |
| 432 | Ga0207687_10268254 | 3300025927 | Unclassified | 1363 |
| 433 | Ga0207700_10140519 | 3300025928 | Bacteria | 1983 |
| 434 | Ga0207664_10270215 | 3300025929 | Bacteria | 1489 |
| 435 | Ga0207664_10382513 | 3300025929 | Unclassified | 1249 |
| 436 | Ga0207644_10030510 | 3300025931 | Bacteria | 3750 |
| 437 | Ga0207644_10078102 | 3300025931 | Bacteria | 2439 |
| 438 | Ga0207644_10116681 | 3300025931 | Bacteria | 2026 |
| 439 | Ga0207644_10123093 | 3300025931 | Unclassified | 1977 |
| 440 | Ga0207644_10472246 | 3300025931 | Bacteria | 1032 |
| 441 | Ga0207690_10000777 | 3300025932 | Bacteria | 20661 |
| 442 | Ga0207690_10002539 | 3300025932 | Bacteria | 11030 |
| 443 | Ga0207690_10012424 | 3300025932 | Bacteria | 5092 |
| 444 | Ga0207690_10031983 | 3300025932 | Bacteria | 3372 |
| 445 | Ga0207690_10034134 | 3300025932 | Unclassified | 3276 |
| 446 | Ga0207690_10064193 | 3300025932 | Unclassified | 2506 |
| 447 | Ga0207690_10066305 | 3300025932 | Bacteria | 2472 |
| 448 | Ga0207690_10093466 | 3300025932 | Bacteria | 2131 |
| 449 | Ga0207690_10216174 | 3300025932 | Bacteria | 1464 |
| 450 | Ga0207690_10410545 | 3300025932 | Bacteria | 1081 |
| 451 | Ga0207690_10572433 | 3300025932 | Bacteria | 920 |
| 452 | Ga0207706_10001063 | 3300025933 | Bacteria | 27913 |
| 453 | Ga0207706_10006873 | 3300025933 | Bacteria | 10519 |
| 454 | Ga0207706_10008071 | 3300025933 | Bacteria | 9716 |
| 455 | Ga0207706_10020060 | 3300025933 | Bacteria | 6006 |
| 456 | Ga0207706_10045866 | 3300025933 | Bacteria | 3871 |
| 457 | Ga0207706_10057661 | 3300025933 | Bacteria | 3421 |
| 458 | Ga0207706_10060769 | 3300025933 | Bacteria | 3328 |
| 459 | Ga0207706_10388058 | 3300025933 | Bacteria | 1211 |
| 460 | Ga0207686_10063874 | 3300025934 | Bacteria | 2343 |
| 461 | Ga0207709_10167581 | 3300025935 | Bacteria | 1538 |
| 462 | Ga0207709_10209660 | 3300025935 | Bacteria | 1397 |
| 463 | Ga0207709_10297572 | 3300025935 | Bacteria | 1199 |
| 464 | Ga0207669_10192884 | 3300025937 | Bacteria | 1471 |
| 465 | Ga0207691_10001499 | 3300025940 | Bacteria | 23257 |
| 466 | Ga0207691_10012981 | 3300025940 | Bacteria | 7977 |
| 467 | Ga0207691_10051374 | 3300025940 | Bacteria | 3769 |
| 468 | Ga0207691_10112349 | 3300025940 | Bacteria | 2422 |
| 469 | Ga0207711_10000174 | 3300025941 | Bacteria | 69263 |
| 470 | Ga0207711_10002763 | 3300025941 | Bacteria | 15458 |
| 471 | Ga0207711_10006114 | 3300025941 | Bacteria | 10167 |
| 472 | Ga0207711_10012069 | 3300025941 | Bacteria | 7182 |
| 473 | Ga0207711_10185701 | 3300025941 | Bacteria | 1892 |
| 474 | Ga0207711_10217053 | 3300025941 | Bacteria | 1748 |
| 475 | Ga0207711_10545103 | 3300025941 | Unclassified | 1082 |
| 476 | Ga0207689_10000167 | 3300025942 | Bacteria | 57116 |
| 477 | Ga0207689_10054262 | 3300025942 | Bacteria | 3301 |
| 478 | Ga0207689_10083687 | 3300025942 | Bacteria | 2623 |
| 479 | Ga0207689_10136316 | 3300025942 | Bacteria | 2021 |
| 480 | Ga0207661_10023773 | 3300025944 | Bacteria | 4635 |
| 481 | Ga0207661_10033964 | 3300025944 | Bacteria | 3962 |
| 482 | Ga0207661_10145331 | 3300025944 | Unclassified | 2045 |
| 483 | Ga0207661_10209057 | 3300025944 | Bacteria | 1719 |
| 484 | Ga0207661_10429043 | 3300025944 | Bacteria | 1201 |
| 485 | Ga0207679_10000150 | 3300025945 | Bacteria | 57426 |
| 486 | Ga0207679_10030926 | 3300025945 | Bacteria | 3743 |
| 487 | Ga0207679_10064246 | 3300025945 | Bacteria | 2743 |
| 488 | Ga0207679_10274539 | 3300025945 | Bacteria | 1443 |
| 489 | Ga0207679_10388833 | 3300025945 | Unclassified | 1224 |
| 490 | Ga0207679_10406272 | 3300025945 | Unclassified | 1199 |
| 491 | Ga0207667_10000443 | 3300025949 | Bacteria | 55591 |
| 492 | Ga0207667_10012419 | 3300025949 | Bacteria | 9816 |
| 493 | Ga0207667_10084992 | 3300025949 | Bacteria | 3275 |
| 494 | Ga0207667_10095828 | 3300025949 | Bacteria | 3063 |
| 495 | Ga0207667_10115121 | 3300025949 | Bacteria | 2771 |
| 496 | Ga0207667_10130830 | 3300025949 | Bacteria | 2585 |
| 497 | Ga0207667_10200743 | 3300025949 | Bacteria | 2046 |
| 498 | Ga0207667_10647519 | 3300025949 | Bacteria | 1062 |
| 499 | Ga0207667_10735103 | 3300025949 | Bacteria | 987 |
| 500 | Ga0207667_10825876 | 3300025949 | Bacteria | 922 |
| 501 | Ga0207667_10870317 | 3300025949 | Unclassified | 894 |
| 502 | Ga0207651_10011170 | 3300025960 | Bacteria | 5013 |
| 503 | Ga0207651_10043708 | 3300025960 | Bacteria | 2993 |
| 504 | Ga0207651_10083644 | 3300025960 | Bacteria | 2308 |
| 505 | Ga0207651_10087729 | 3300025960 | Bacteria | 2265 |
| 506 | Ga0207651_10103766 | 3300025960 | Bacteria | 2116 |
| 507 | Ga0207651_10127485 | 3300025960 | Bacteria | 1942 |
| 508 | Ga0207651_10168464 | 3300025960 | Bacteria | 1725 |
| 509 | Ga0207712_10011567 | 3300025961 | Bacteria | 5626 |
| 510 | Ga0207668_10119060 | 3300025972 | Bacteria | 1996 |
| 511 | Ga0207668_10160699 | 3300025972 | Bacteria | 1750 |
| 512 | Ga0207640_10029943 | 3300025981 | Bacteria | 3348 |
| 513 | Ga0207640_10071530 | 3300025981 | Bacteria | 2336 |
| 514 | Ga0207640_10122069 | 3300025981 | Bacteria | 1868 |
| 515 | Ga0207640_10136322 | 3300025981 | Bacteria | 1782 |
| 516 | Ga0207640_10616283 | 3300025981 | Bacteria | 921 |
| 517 | Ga0207658_10004413 | 3300025986 | Bacteria | 9786 |
| 518 | Ga0207658_10005682 | 3300025986 | Bacteria | 8529 |
| 519 | Ga0207658_10006022 | 3300025986 | Bacteria | 8284 |
| 520 | Ga0207658_10114190 | 3300025986 | Bacteria | 2141 |
| 521 | Ga0207658_10423650 | 3300025986 | Bacteria | 1174 |
| 522 | Ga0207677_10003531 | 3300026023 | Bacteria | 8284 |
| 523 | Ga0207677_10141284 | 3300026023 | Bacteria | 1844 |
| 524 | Ga0207677_10146424 | 3300026023 | Bacteria | 1816 |
| 525 | Ga0207677_10282027 | 3300026023 | Bacteria | 1364 |
| 526 | Ga0207677_10304529 | 3300026023 | Bacteria | 1318 |
| 527 | Ga0207703_10004057 | 3300026035 | Bacteria | 12096 |
| 528 | Ga0207703_10014553 | 3300026035 | Bacteria | 6138 |
| 529 | Ga0207703_10020601 | 3300026035 | Bacteria | 5159 |
| 530 | Ga0207703_10023164 | 3300026035 | Bacteria | 4877 |
| 531 | Ga0207703_10037572 | 3300026035 | Bacteria | 3857 |
| 532 | Ga0207703_10274036 | 3300026035 | Bacteria | 1530 |
| 533 | Ga0207703_10382311 | 3300026035 | Unclassified | 1302 |
| 534 | Ga0207703_10478409 | 3300026035 | Bacteria | 1167 |
| 535 | Ga0207703_10720787 | 3300026035 | Bacteria | 949 |
| 536 | Ga0207639_10000144 | 3300026041 | Bacteria | 53312 |
| 537 | Ga0207639_10000851 | 3300026041 | Bacteria | 20742 |
| 538 | Ga0207639_10008734 | 3300026041 | Bacteria | 6957 |
| 539 | Ga0207639_10027181 | 3300026041 | Bacteria | 4165 |
| 540 | Ga0207639_10031620 | 3300026041 | Bacteria | 3891 |
| 541 | Ga0207639_10042855 | 3300026041 | Bacteria | 3394 |
| 542 | Ga0207639_10111985 | 3300026041 | Bacteria | 2226 |
| 543 | Ga0207639_10118008 | 3300026041 | Bacteria | 2175 |
| 544 | Ga0207639_10138524 | 3300026041 | Bacteria | 2025 |
| 545 | Ga0207639_10163407 | 3300026041 | Bacteria | 1878 |
| 546 | Ga0207678_10005023 | 3300026067 | Bacteria | 11868 |
| 547 | Ga0207678_10021716 | 3300026067 | Bacteria | 5629 |
| 548 | Ga0207678_10024585 | 3300026067 | Bacteria | 5261 |
| 549 | Ga0207678_10039002 | 3300026067 | Bacteria | 4124 |
| 550 | Ga0207678_10041699 | 3300026067 | Bacteria | 3979 |
| 551 | Ga0207678_10052954 | 3300026067 | Bacteria | 3499 |
| 552 | Ga0207678_10062108 | 3300026067 | Bacteria | 3212 |
| 553 | Ga0207702_10005597 | 3300026078 | Bacteria | 10968 |
| 554 | Ga0207702_10010053 | 3300026078 | Bacteria | 7931 |
| 555 | Ga0207702_10037906 | 3300026078 | Bacteria | 4037 |
| 556 | Ga0207702_10186975 | 3300026078 | Bacteria | 1911 |
| 557 | Ga0207702_10195004 | 3300026078 | Bacteria | 1874 |
| 558 | Ga0207641_10011660 | 3300026088 | Bacteria | 7217 |
| 559 | Ga0207641_10016621 | 3300026088 | Bacteria | 6024 |
| 560 | Ga0207641_10175380 | 3300026088 | Bacteria | 1960 |
| 561 | Ga0207641_10355789 | 3300026088 | Bacteria | 1396 |
| 562 | Ga0207641_10394895 | 3300026088 | Bacteria | 1327 |
| 563 | Ga0207648_10023887 | 3300026089 | Bacteria | 5466 |
| 564 | Ga0207648_10046120 | 3300026089 | Bacteria | 3821 |
| 565 | Ga0207648_10058078 | 3300026089 | Unclassified | 3375 |
| 566 | Ga0207648_10138611 | 3300026089 | Bacteria | 2143 |
| 567 | Ga0207676_10002947 | 3300026095 | Bacteria | 12135 |
| 568 | Ga0207676_10374005 | 3300026095 | Bacteria | 1324 |
| 569 | Ga0207676_10462491 | 3300026095 | Unclassified | 1198 |
| 570 | Ga0207674_10002073 | 3300026116 | Bacteria | 25416 |
| 571 | Ga0207674_10005768 | 3300026116 | Bacteria | 14688 |
| 572 | Ga0207674_10007637 | 3300026116 | Bacteria | 12593 |
| 573 | Ga0207674_10009450 | 3300026116 | Bacteria | 11141 |
| 574 | Ga0207674_10016402 | 3300026116 | Bacteria | 8110 |
| 575 | Ga0207674_10019921 | 3300026116 | Bacteria | 7259 |
| 576 | Ga0207674_10033866 | 3300026116 | Bacteria | 5344 |
| 577 | Ga0207674_10081185 | 3300026116 | Bacteria | 3244 |
| 578 | Ga0207674_10107894 | 3300026116 | Bacteria | 2761 |
| 579 | Ga0207674_10119424 | 3300026116 | Bacteria | 2605 |
| 580 | Ga0207674_10482367 | 3300026116 | Bacteria | 1198 |
| 581 | Ga0207675_100046661 | 3300026118 | Bacteria | 4048 |
| 582 | Ga0207675_100268810 | 3300026118 | Bacteria | 1654 |
| 583 | Ga0207683_10026205 | 3300026121 | Bacteria | 5032 |
| 584 | Ga0207683_10296509 | 3300026121 | Bacteria | 1479 |
| 585 | Ga0207698_10002267 | 3300026142 | Bacteria | 11384 |
| 586 | Ga0207698_10006878 | 3300026142 | Bacteria | 7116 |
| 587 | Ga0207698_10020567 | 3300026142 | Bacteria | 4545 |
| 588 | Ga0207698_10030800 | 3300026142 | Bacteria | 3864 |
| 589 | Ga0207698_10041600 | 3300026142 | Bacteria | 3426 |
| 590 | Ga0207698_10085736 | 3300026142 | Bacteria | 2559 |
| 591 | Ga0207698_10101990 | 3300026142 | Bacteria | 2381 |
| 592 | Ga0207698_10152858 | 3300026142 | Bacteria | 2006 |
| 593 | Ga0207698_10160349 | 3300026142 | Bacteria | 1966 |
| 594 | Ga0207698_10378278 | 3300026142 | Bacteria | 1346 |
| 595 | Ga0207698_10503527 | 3300026142 | Bacteria | 1179 |
| 596 | Ga0207698_10633887 | 3300026142 | Bacteria | 1057 |
| 597 | Ga0268266_10014546 | 3300028379 | Bacteria | 6762 |
| 598 | Ga0268266_10025415 | 3300028379 | Bacteria | 5038 |
| 599 | Ga0268266_10088056 | 3300028379 | Bacteria | 2717 |
| 600 | Ga0268265_10008862 | 3300028380 | Bacteria | 6798 |
| 601 | Ga0268265_10026471 | 3300028380 | Bacteria | 4127 |
| 602 | Ga0268265_10060149 | 3300028380 | Bacteria | 2910 |
| 603 | Ga0268264_10001230 | 3300028381 | Bacteria | 24597 |
| 604 | Ga0268264_10008487 | 3300028381 | Bacteria | 8542 |
| 605 | Ga0268264_10074618 | 3300028381 | Bacteria | 2882 |
| 606 | Ga0268264_10216856 | 3300028381 | Bacteria | 1760 |
| 607 | Ga0307408_100051958 | 3300031548 | Bacteria | 2955 |
| 608 | Ga0307405_10341223 | 3300031731 | Unclassified | 1152 |
| 609 | Ga0307413_10144753 | 3300031824 | Bacteria | 1648 |
| 610 | Ga0307413_10193030 | 3300031824 | Bacteria | 1464 |
| 611 | Ga0307410_10008595 | 3300031852 | Bacteria | 5672 |
| 612 | Ga0307410_10012752 | 3300031852 | Bacteria | 4874 |
| 613 | Ga0307407_10051571 | 3300031903 | Bacteria | 2359 |
| 614 | Ga0307407_10130099 | 3300031903 | Bacteria | 1609 |
| 615 | Ga0307409_100008491 | 3300031995 | Bacteria | 6240 |
| 616 | Ga0307409_100104360 | 3300031995 | Bacteria | 2360 |
| 617 | Ga0307409_100380131 | 3300031995 | Bacteria | 1342 |
| 618 | Ga0307409_100489379 | 3300031995 | Bacteria | 1195 |
| 619 | Ga0307414_10131779 | 3300032004 | Bacteria | 1942 |
| 620 | Ga0307414_10217176 | 3300032004 | Bacteria | 1567 |
| 621 | Ga0307411_10041808 | 3300032005 | Bacteria | 2920 |
| 622 | Ga0307411_10099180 | 3300032005 | Bacteria | 2055 |
| 623 | Ga0307411_10650256 | 3300032005 | Bacteria | 913 |
| 624 | Ga0307415_100019598 | 3300032126 | Bacteria | 4111 |
| 625 | Ga0307415_100216363 | 3300032126 | Unclassified | 1532 |
| 626 | Ga0373932_0093526 | 3300035112 | Bacteria | 968 |
| 627 | Ga0373941_0044643 | 3300035115 | Bacteria | 1384 |
| 628 | Ga0373943_0010052 | 3300035170 | Bacteria | 4244 |
| 629 | Ga0373931_0007229 | 3300035691 | Bacteria | 5226 |
| 630 | Ga0373935_0033605 | 3300035692 | Bacteria | 3193 |
| 631 | Ga0373927_0030225 | 3300035695 | Bacteria | 3535 |
| 632 | Ga0395899_0001070 | 3300037312 | Bacteria | 24709 |
| 633 | Ga0395899_0003599 | 3300037312 | Bacteria | 12253 |
| 634 | Ga0395899_0004952 | 3300037312 | Bacteria | 10362 |
| 635 | Ga0395899_0013798 | 3300037312 | Bacteria | 6176 |
| 636 | Ga0395899_0043275 | 3300037312 | Bacteria | 3359 |
| 637 | Ga0395899_0051492 | 3300037312 | Bacteria | 3055 |
| 638 | Ga0395899_0052893 | 3300037312 | Bacteria | 3008 |
| 639 | Ga0395899_0061498 | 3300037312 | Unclassified | 2766 |
| 640 | Ga0395899_0064142 | 3300037312 | Bacteria | 2701 |
| 641 | Ga0395899_0079880 | 3300037312 | Bacteria | 2382 |
| 642 | Ga0395899_0158291 | 3300037312 | Bacteria | 1601 |
| 643 | Ga0395899_0228285 | 3300037312 | Bacteria | 1286 |
| 644 | Ga0395899_0247244 | 3300037312 | Bacteria | 1225 |
| 645 | Ga0395900_0001041 | 3300037418 | Bacteria | 35559 |
| 646 | Ga0395900_0011436 | 3300037418 | Bacteria | 9085 |
| 647 | Ga0395900_0011750 | 3300037418 | Bacteria | 8952 |
| 648 | Ga0395900_0015887 | 3300037418 | Bacteria | 7668 |
| 649 | Ga0395900_0016938 | 3300037418 | Bacteria | 7438 |
| 650 | Ga0395900_0018396 | 3300037418 | Bacteria | 7125 |
| 651 | Ga0395900_0030614 | 3300037418 | Bacteria | 5526 |
| 652 | Ga0395900_0036432 | 3300037418 | Bacteria | 5072 |
| 653 | Ga0395900_0051015 | 3300037418 | Bacteria | 4262 |
| 654 | Ga0395900_0051432 | 3300037418 | Bacteria | 4244 |
| 655 | Ga0395900_0055439 | 3300037418 | Bacteria | 4081 |
| 656 | Ga0395900_0060798 | 3300037418 | Bacteria | 3886 |
| 657 | Ga0395900_0069555 | 3300037418 | Bacteria | 3618 |
| 658 | Ga0395900_0073055 | 3300037418 | Bacteria | 3526 |
| 659 | Ga0395900_0089716 | 3300037418 | Bacteria | 3159 |
| 660 | Ga0395900_0135243 | 3300037418 | Bacteria | 2525 |
| 661 | Ga0395900_0211647 | 3300037418 | Bacteria | 1957 |
| 662 | Ga0395900_0256408 | 3300037418 | Bacteria | 1748 |
| 663 | Ga0395900_0317046 | 3300037418 | Bacteria | 1540 |
| 664 | Ga0395900_0342415 | 3300037418 | Bacteria | 1470 |
| 665 | Ga0395900_0442876 | 3300037418 | Unclassified | 1256 |
| 666 | Ga0395898_0000274 | 3300037466 | Bacteria | 125922 |
| 667 | Ga0395898_0010300 | 3300037466 | Bacteria | 9783 |
| 668 | Ga0395898_0012715 | 3300037466 | Bacteria | 8693 |
| 669 | Ga0395898_0018438 | 3300037466 | Bacteria | 7116 |
| 670 | Ga0395898_0018633 | 3300037466 | Bacteria | 7077 |
| 671 | Ga0395898_0026753 | 3300037466 | Bacteria | 5798 |
| 672 | Ga0395898_0052351 | 3300037466 | Bacteria | 3988 |
| 673 | Ga0395898_0057015 | 3300037466 | Bacteria | 3806 |
| 674 | Ga0395898_0070310 | 3300037466 | Bacteria | 3384 |
| 675 | Ga0395898_0082203 | 3300037466 | Bacteria | 3105 |
| 676 | Ga0395898_0098696 | 3300037466 | Bacteria | 2804 |
| 677 | Ga0395898_0103557 | 3300037466 | Bacteria | 2731 |
| 678 | Ga0395898_0110180 | 3300037466 | Bacteria | 2639 |
| 679 | Ga0395898_0119310 | 3300037466 | Bacteria | 2526 |
| 680 | Ga0395898_0128875 | 3300037466 | Bacteria | 2424 |
| 681 | Ga0395898_0182841 | 3300037466 | Bacteria | 2003 |
| 682 | Ga0395898_0204619 | 3300037466 | Bacteria | 1884 |
| 683 | Ga0395898_0530800 | 3300037466 | Bacteria | 1118 |
| 684 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 685 | Ga0395905_0002330 | 3300037471 | Bacteria | 21202 |
| 686 | Ga0395905_0006965 | 3300037471 | Bacteria | 11301 |
| 687 | Ga0395905_0007371 | 3300037471 | Bacteria | 10948 |
| 688 | Ga0395905_0008869 | 3300037471 | Bacteria | 9879 |
| 689 | Ga0395905_0009804 | 3300037471 | Bacteria | 9334 |
| 690 | Ga0395905_0012465 | 3300037471 | Bacteria | 8184 |
| 691 | Ga0395905_0014564 | 3300037471 | Bacteria | 7502 |
| 692 | Ga0395905_0015854 | 3300037471 | Bacteria | 7158 |
| 693 | Ga0395905_0024002 | 3300037471 | Bacteria | 5757 |
| 694 | Ga0395905_0028407 | 3300037471 | Bacteria | 5274 |
| 695 | Ga0395905_0028927 | 3300037471 | Bacteria | 5223 |
| 696 | Ga0395905_0030832 | 3300037471 | Bacteria | 5050 |
| 697 | Ga0395905_0039882 | 3300037471 | Bacteria | 4405 |
| 698 | Ga0395905_0040679 | 3300037471 | Bacteria | 4361 |
| 699 | Ga0395905_0041117 | 3300037471 | Bacteria | 4337 |
| 700 | Ga0395905_0041722 | 3300037471 | Bacteria | 4306 |
| 701 | Ga0395905_0043636 | 3300037471 | Bacteria | 4206 |
| 702 | Ga0395905_0043749 | 3300037471 | Bacteria | 4200 |
| 703 | Ga0395905_0066910 | 3300037471 | Bacteria | 3365 |
| 704 | Ga0395905_0079934 | 3300037471 | Bacteria | 3064 |
| 705 | Ga0395905_0100472 | 3300037471 | Bacteria | 2716 |
| 706 | Ga0395905_0123550 | 3300037471 | Unclassified | 2434 |
| 707 | Ga0395905_0146543 | 3300037471 | Bacteria | 2221 |
| 708 | Ga0395905_0158139 | 3300037471 | Bacteria | 2131 |
| 709 | Ga0395905_0217418 | 3300037471 | Bacteria | 1789 |
| 710 | Ga0395905_0217989 | 3300037471 | Bacteria | 1786 |
| 711 | Ga0395905_0222917 | 3300037471 | Bacteria | 1764 |
| 712 | Ga0395905_0241556 | 3300037471 | Bacteria | 1688 |
| 713 | Ga0395905_0282326 | 3300037471 | Bacteria | 1546 |
| 714 | Ga0395905_0292166 | 3300037471 | Bacteria | 1516 |
| 715 | Ga0395905_0380693 | 3300037471 | Unclassified | 1305 |
| 716 | Ga0395905_0547511 | 3300037471 | Bacteria | 1058 |
| 717 | Ga0395905_0592253 | 3300037471 | Bacteria | 1010 |
| 718 | Ga0395901_0001959 | 3300038443 | Bacteria | 21168 |
| 719 | Ga0395901_0009696 | 3300038443 | Bacteria | 9767 |
| 720 | Ga0395901_0019006 | 3300038443 | Bacteria | 7024 |
| 721 | Ga0395901_0026433 | 3300038443 | Bacteria | 5960 |
| 722 | Ga0395901_0027042 | 3300038443 | Bacteria | 5892 |
| 723 | Ga0395901_0032560 | 3300038443 | Bacteria | 5379 |
| 724 | Ga0395901_0040796 | 3300038443 | Bacteria | 4807 |
| 725 | Ga0395901_0055766 | 3300038443 | Bacteria | 4110 |
| 726 | Ga0395901_0067747 | 3300038443 | Bacteria | 3718 |
| 727 | Ga0395901_0070145 | 3300038443 | Bacteria | 3651 |
| 728 | Ga0395901_0070313 | 3300038443 | Bacteria | 3646 |
| 729 | Ga0395901_0070384 | 3300038443 | Bacteria | 3644 |
| 730 | Ga0395901_0091439 | 3300038443 | Bacteria | 3185 |
| 731 | Ga0395901_0092854 | 3300038443 | Bacteria | 3159 |
| 732 | Ga0395901_0093959 | 3300038443 | Bacteria | 3141 |
| 733 | Ga0395901_0105170 | 3300038443 | Bacteria | 2962 |
| 734 | Ga0395901_0155176 | 3300038443 | Bacteria | 2404 |
| 735 | Ga0395901_0158354 | 3300038443 | Bacteria | 2378 |
| 736 | Ga0395901_0544706 | 3300038443 | Bacteria | 1176 |
| 737 | Ga0436365_0088937 | 3300039437 | Bacteria | 9210 |
| 738 | Ga0436363_0494724 | 3300039450 | Unclassified | 3087 |
| 739 | Ga0439448_0084479 | 3300042005 | Bacteria | 1069 |
| 740 | Ga0439458_0000160 | 3300042157 | Bacteria | 14953 |
| 741 | Ga0439458_0000210 | 3300042157 | Bacteria | 13702 |
| 742 | Ga0439464_0001497 | 3300042439 | Bacteria | 5519 |
| 743 | Ga0466969_0084563 | 3300044656 | Bacteria | 1510 |
| 744 | Ga0466972_0059130 | 3300044658 | Unclassified | 1840 |
| 745 | Ga0466966_0065027 | 3300044684 | Bacteria | 2294 |
| 746 | Ga0466966_0090485 | 3300044684 | Unclassified | 1900 |
| 747 | Ga0466961_0062189 | 3300044693 | Bacteria | 2372 |
| 748 | Ga0466963_0002633 | 3300044694 | Bacteria | 10082 |
| 749 | Ga0466963_0018355 | 3300044694 | Bacteria | 4372 |
| 750 | Ga0466963_0036678 | 3300044694 | Bacteria | 3198 |
| 751 | Ga0466963_0044717 | 3300044694 | Bacteria | 2915 |
| 752 | Ga0466963_0048807 | 3300044694 | Bacteria | 2798 |
| 753 | Ga0466963_0086494 | 3300044694 | Bacteria | 2130 |
| 754 | Ga0466963_0128728 | 3300044694 | Bacteria | 1747 |
| 755 | Ga0466963_0149665 | 3300044694 | Bacteria | 1620 |
| 756 | Ga0466964_0038586 | 3300044706 | Unclassified | 1921 |
| 757 | Ga0466968_0007068 | 3300044735 | Bacteria | 4256 |
| 758 | Ga0466970_0017655 | 3300044765 | Bacteria | 3688 |
| 759 | Ga0466970_0206689 | 3300044765 | Unclassified | 1093 |
| 760 | Ga0466957_0010777 | 3300044842 | Bacteria | 5256 |
| 761 | Ga0466957_0044633 | 3300044842 | Bacteria | 2687 |
| 762 | Ga0466957_0052930 | 3300044842 | Bacteria | 2473 |
| 763 | Ga0466957_0143719 | 3300044842 | Bacteria | 1539 |
| 764 | Ga0466957_0171484 | 3300044842 | Bacteria | 1413 |
| 765 | Ga0466957_0191531 | 3300044842 | Bacteria | 1340 |
| 766 | Ga0466957_0323511 | 3300044842 | Unclassified | 1041 |
| 767 | Ga0466960_0096498 | 3300044901 | Bacteria | 1516 |
| 768 | Ga0466959_0102285 | 3300045049 | Bacteria | 2050 |
| 769 | Ga0466959_0166311 | 3300045049 | Bacteria | 1549 |
| 770 | Ga0466958_0025655 | 3300045836 | Unclassified | 3477 |
| 771 | Ga0466958_0084515 | 3300045836 | Bacteria | 1957 |
| 772 | Ga0466958_0145083 | 3300045836 | Bacteria | 1496 |
| 773 | Ga0466958_0366852 | 3300045836 | Bacteria | 928 |
| 774 | Ga0466967_0001266 | 3300045976 | Bacteria | 14316 |
| 775 | Ga0466967_0001564 | 3300045976 | Bacteria | 13420 |
| 776 | Ga0466967_0016471 | 3300045976 | Bacteria | 5831 |
| 777 | Ga0466967_0026824 | 3300045976 | Bacteria | 4780 |
| 778 | Ga0466967_0041175 | 3300045976 | Bacteria | 3981 |
| 779 | Ga0466967_0114265 | 3300045976 | Bacteria | 2485 |
| 780 | Ga0466967_0159908 | 3300045976 | Bacteria | 2113 |
| 781 | Ga0466967_0421432 | 3300045976 | Bacteria | 1301 |
| 782 | Ga0466967_0450821 | 3300045976 | Bacteria | 1257 |
| 783 | Ga0466967_0544825 | 3300045976 | Bacteria | 1142 |
| 784 | Ga0495598_0002323 | 3300046537 | Bacteria | 3914 |
| 785 | Ga0495621_0013285 | 3300046539 | Bacteria | 2583 |
| 786 | Ga0495669_0000565 | 3300046684 | Bacteria | 16363 |
| 787 | Ga0495669_0015372 | 3300046684 | Bacteria | 3277 |
| 788 | Ga0495669_0049680 | 3300046684 | Bacteria | 1879 |
| 789 | Ga0495669_0092589 | 3300046684 | Bacteria | 1397 |
| 790 | Ga0495670_0002417 | 3300046691 | Bacteria | 9216 |
| 791 | Ga0495680_0443954 | 3300047322 | Bacteria | 889 |
| 792 | Ga0495677_0098655 | 3300047445 | Bacteria | 1104 |
| 793 | Ga0496102_0118775 | 3300048905 | Bacteria | 2468 |
| 794 | Ga0496102_0770591 | 3300048905 | Bacteria | 885 |
| 795 | Ga0496103_0139436 | 3300048906 | Bacteria | 1550 |
| 796 | Ga0496103_0230677 | 3300048906 | Bacteria | 1191 |
| 797 | Ga0496105_0113231 | 3300048908 | Bacteria | 2239 |
| 798 | Ga0496105_0495936 | 3300048908 | Unclassified | 959 |
| 799 | Ga0496107_0038682 | 3300048910 | Bacteria | 3421 |
| 800 | Ga0496108_0000974 | 3300048911 | Bacteria | 22322 |
| 801 | Ga0496108_0019724 | 3300048911 | Bacteria | 5538 |
| 802 | Ga0496109_0072772 | 3300048912 | Bacteria | 3158 |
| 803 | Ga0496110_0016722 | 3300048913 | Bacteria | 6127 |
| 804 | Ga0496110_0127035 | 3300048913 | Bacteria | 2301 |
| 805 | Ga0496111_0038294 | 3300048914 | Bacteria | 3435 |
| 806 | Ga0496111_0118684 | 3300048914 | Bacteria | 1953 |
| 807 | Ga0496112_0001713 | 3300048915 | Bacteria | 17129 |
| 808 | Ga0496112_0067660 | 3300048915 | Bacteria | 3526 |
| 809 | Ga0496112_0098255 | 3300048915 | Bacteria | 2897 |
| 810 | Ga0496112_0111558 | 3300048915 | Bacteria | 2704 |
| 811 | Ga0496113_0014119 | 3300048916 | Bacteria | 5437 |
| 812 | Ga0496113_0040294 | 3300048916 | Unclassified | 3442 |
| 813 | Ga0501074_0363173 | 3300049590 | Bacteria | 1027 |
| 814 | Ga0501079_0271079 | 3300049741 | Bacteria | 1327 |
| 815 | Ga0501080_0019604 | 3300049742 | Bacteria | 6266 |
| 816 | Ga0501268_012010 | 3300049765 | Bacteria | 1378 |
| 817 | nmdc:mga0n895_311061_c1 | 3300050512 | Bacteria | 1596 |
| 818 | nmdc:mga0sz30_175949_c1 | 3300050516 | Bacteria | 949 |
| 819 | Ga0466962_0138593 | 3300061719 | Unclassified | 1178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10177023 | Ga0207650_101770232 | 202 |
| 2 | 3300025907 | Ga0207645_10084702 | Ga0207645_100847021 | 203 |
| 3 | 3300001990 | JGI24737J22298_10016233 | JGI24737J22298_100162333 | 206 |
| 4 | 3300005345 | Ga0070692_10005091 | Ga0070692_100050915 | 206 |
| 5 | 3300005353 | Ga0070669_100299215 | Ga0070669_1002992151 | 206 |
| 6 | 3300005444 | Ga0070694_100009204 | Ga0070694_1000092045 | 206 |
| 7 | 3300005457 | Ga0070662_100008398 | Ga0070662_1000083986 | 206 |
| 8 | 3300005543 | Ga0070672_100010512 | Ga0070672_1000105122 | 206 |
| 9 | 3300005563 | Ga0068855_100072569 | Ga0068855_1000725692 | 206 |
| 10 | 3300005564 | Ga0070664_100405614 | Ga0070664_1004056142 | 206 |
| 11 | 3300005577 | Ga0068857_100115040 | Ga0068857_1001150402 | 206 |
| 12 | 3300005841 | Ga0068863_100728430 | Ga0068863_1007284302 | 206 |
| 13 | 3300005843 | Ga0068860_100074629 | Ga0068860_1000746291 | 206 |
| 14 | 3300005844 | Ga0068862_100077464 | Ga0068862_1000774642 | 206 |
| 15 | 3300006881 | Ga0068865_100517064 | Ga0068865_1005170641 | 206 |
| 16 | 3300009093 | Ga0105240_10227895 | Ga0105240_102278952 | 206 |
| 17 | 3300009174 | Ga0105241_10603881 | Ga0105241_106038812 | 206 |
| 18 | 3300009553 | Ga0105249_10129924 | Ga0105249_101299241 | 206 |
| 19 | 3300010375 | Ga0105239_10235909 | Ga0105239_102359092 | 206 |
| 20 | 3300013102 | Ga0157371_10093477 | Ga0157371_100934772 | 206 |
| 21 | 3300013306 | Ga0163162_10120409 | Ga0163162_101204092 | 206 |
| 22 | 3300025904 | Ga0207647_10000073 | Ga0207647_1000007368 | 206 |
| 23 | 3300025919 | Ga0207657_10034062 | Ga0207657_100340623 | 206 |
| 24 | 3300025933 | Ga0207706_10001063 | Ga0207706_100010637 | 206 |
| 25 | 3300025940 | Ga0207691_10012981 | Ga0207691_100129812 | 206 |
| 26 | 3300025945 | Ga0207679_10388833 | Ga0207679_103888332 | 206 |
| 27 | 3300025949 | Ga0207667_10115121 | Ga0207667_101151214 | 206 |
| 28 | 3300025961 | Ga0207712_10011567 | Ga0207712_100115671 | 206 |
| 29 | 3300028380 | Ga0268265_10026471 | Ga0268265_100264712 | 206 |
| 30 | 3300028381 | Ga0268264_10001230 | Ga0268264_1000123019 | 206 |
| 31 | 3300005344 | Ga0070661_100375654 | Ga0070661_1003756542 | 209 |
| 32 | 3300005331 | Ga0070670_100040271 | Ga0070670_1000402712 | 219 |
| 33 | 3300005455 | Ga0070663_100051506 | Ga0070663_1000515062 | 219 |
| 34 | 3300005618 | Ga0068864_100045578 | Ga0068864_1000455782 | 219 |
| 35 | 3300025315 | Ga0207697_10034827 | Ga0207697_100348272 | 219 |
| 36 | 3300025925 | Ga0207650_10022685 | Ga0207650_100226852 | 219 |
| 37 | 3300025926 | Ga0207659_10125168 | Ga0207659_101251682 | 219 |
| 38 | 3300048915 | Ga0496112_0067660 | Ga0496112_0067660_690_1487 | 219 |
| 39 | 3300005564 | Ga0070664_100031007 | Ga0070664_1000310072 | 220 |
| 40 | 3300025942 | Ga0207689_10083687 | Ga0207689_100836872 | 220 |
| 41 | 3300005327 | Ga0070658_10192827 | Ga0070658_101928272 | 222 |
| 42 | 3300005455 | Ga0070663_100171438 | Ga0070663_1001714383 | 222 |
| 43 | 3300005530 | Ga0070679_100347296 | Ga0070679_1003472961 | 222 |
| 44 | 3300005614 | Ga0068856_100103381 | Ga0068856_1001033811 | 222 |
| 45 | 3300005614 | Ga0068856_100814131 | Ga0068856_1008141311 | 222 |
| 46 | 3300005616 | Ga0068852_100268971 | Ga0068852_1002689712 | 222 |
| 47 | 3300025909 | Ga0207705_10240702 | Ga0207705_102407023 | 222 |
| 48 | 3300025921 | Ga0207652_10249866 | Ga0207652_102498661 | 222 |
| 49 | 3300025941 | Ga0207711_10545103 | Ga0207711_105451031 | 222 |
| 50 | 3300026095 | Ga0207676_10462491 | Ga0207676_104624912 | 222 |
| 51 | 3300026142 | Ga0207698_10160349 | Ga0207698_101603493 | 222 |
| 52 | 3300037471 | Ga0395905_0014564 | Ga0395905_0014564_5184_5990 | 222 |
| 53 | 3300042005 | Ga0439448_0084479 | Ga0439448_0084479_112_918 | 223 |
| 54 | 3300042157 | Ga0439458_0000210 | Ga0439458_0000210_2764_3570 | 223 |
| 55 | 3300046537 | Ga0495598_0002323 | Ga0495598_0002323_1106_1906 | 223 |
| 56 | 3300046539 | Ga0495621_0013285 | Ga0495621_0013285_1150_1950 | 223 |
| 57 | 3300046684 | Ga0495669_0049680 | Ga0495669_0049680_551_1351 | 223 |
| 58 | 3300046691 | Ga0495670_0002417 | Ga0495670_0002417_1403_2203 | 223 |
| 59 | 3300047322 | Ga0495680_0443954 | Ga0495680_0443954_54_854 | 223 |
| 60 | 3300045836 | Ga0466958_0025655 | Ga0466958_0025655_869_1690 | 224 |
| 61 | 3300045976 | Ga0466967_0001564 | Ga0466967_0001564_12_833 | 224 |
| 62 | 3300005327 | Ga0070658_10204665 | Ga0070658_102046652 | 225 |
| 63 | 3300005338 | Ga0068868_100008379 | Ga0068868_1000083793 | 225 |
| 64 | 3300005364 | Ga0070673_100452846 | Ga0070673_1004528461 | 225 |
| 65 | 3300009098 | Ga0105245_10420056 | Ga0105245_104200562 | 225 |
| 66 | 3300025927 | Ga0207687_10268254 | Ga0207687_102682542 | 225 |
| 67 | 3300025960 | Ga0207651_10127485 | Ga0207651_101274852 | 225 |
| 68 | 3300026023 | Ga0207677_10003531 | Ga0207677_100035313 | 225 |
| 69 | 3300037418 | Ga0395900_0256408 | Ga0395900_0256408_230_1063 | 226 |
| 70 | 3300037466 | Ga0395898_0204619 | Ga0395898_0204619_650_1477 | 226 |
| 71 | 3300037471 | Ga0395905_0024002 | Ga0395905_0024002_3160_3993 | 226 |
| 72 | 3300037471 | Ga0395905_0123550 | Ga0395905_0123550_1498_2325 | 226 |
| 73 | 3300038443 | Ga0395901_0032560 | Ga0395901_0032560_2335_3162 | 226 |
| 74 | 3300046684 | Ga0495669_0000565 | Ga0495669_0000565_13322_14152 | 226 |
| 75 | 3300046684 | Ga0495669_0015372 | Ga0495669_0015372_642_1472 | 226 |
| 76 | 3300047445 | Ga0495677_0098655 | Ga0495677_0098655_219_1049 | 226 |
| 77 | 3300025929 | Ga0207664_10270215 | Ga0207664_102702152 | 227 |
| 78 | 3300037418 | Ga0395900_0030614 | Ga0395900_0030614_2118_2939 | 227 |
| 79 | 3300037466 | Ga0395898_0012715 | Ga0395898_0012715_5402_6223 | 227 |
| 80 | 3300037471 | Ga0395905_0028927 | Ga0395905_0028927_2326_3147 | 227 |
| 81 | 3300038443 | Ga0395901_0009696 | Ga0395901_0009696_4994_5815 | 227 |
| 82 | 3300005548 | Ga0070665_100010704 | Ga0070665_1000107049 | 228 |
| 83 | 3300025972 | Ga0207668_10119060 | Ga0207668_101190602 | 228 |
| 84 | 3300028379 | Ga0268266_10025415 | Ga0268266_100254153 | 228 |
| 85 | 3300005548 | Ga0070665_100022897 | Ga0070665_1000228976 | 229 |
| 86 | 3300013306 | Ga0163162_10063325 | Ga0163162_100633252 | 229 |
| 87 | 3300025315 | Ga0207697_10024732 | Ga0207697_100247323 | 229 |
| 88 | 3300037312 | Ga0395899_0004952 | Ga0395899_0004952_791_1609 | 229 |
| 89 | 3300037418 | Ga0395900_0055439 | Ga0395900_0055439_2731_3549 | 229 |
| 90 | 3300037466 | Ga0395898_0010300 | Ga0395898_0010300_1116_1934 | 229 |
| 91 | 3300037471 | Ga0395905_0041117 | Ga0395905_0041117_2859_3677 | 229 |
| 92 | 3300038443 | Ga0395901_0070384 | Ga0395901_0070384_791_1609 | 229 |
| 93 | 3300005344 | Ga0070661_100106266 | Ga0070661_1001062662 | 231 |
| 94 | 3300005543 | Ga0070672_100204553 | Ga0070672_1002045532 | 231 |
| 95 | 3300005842 | Ga0068858_100292225 | Ga0068858_1002922251 | 231 |
| 96 | 3300009551 | Ga0105238_10121785 | Ga0105238_101217852 | 231 |
| 97 | 3300025920 | Ga0207649_10095186 | Ga0207649_100951862 | 231 |
| 98 | 3300025940 | Ga0207691_10112349 | Ga0207691_101123492 | 231 |
| 99 | 3300025960 | Ga0207651_10087729 | Ga0207651_100877292 | 231 |
| 100 | 3300025986 | Ga0207658_10114190 | Ga0207658_101141902 | 231 |
| 101 | 3300026035 | Ga0207703_10274036 | Ga0207703_102740361 | 231 |
| 102 | 3300005842 | Ga0068858_100025462 | Ga0068858_1000254625 | 232 |
| 103 | 3300009174 | Ga0105241_10117019 | Ga0105241_101170192 | 232 |
| 104 | 3300013296 | Ga0157374_10012401 | Ga0157374_100124015 | 232 |
| 105 | 3300013297 | Ga0157378_10341621 | Ga0157378_103416212 | 232 |
| 106 | 3300025931 | Ga0207644_10123093 | Ga0207644_101230932 | 232 |
| 107 | 3300025945 | Ga0207679_10406272 | Ga0207679_104062722 | 232 |
| 108 | 3300026023 | Ga0207677_10304529 | Ga0207677_103045291 | 232 |
| 109 | 3300026035 | Ga0207703_10037572 | Ga0207703_100375723 | 232 |
| 110 | 3300039437 | Ga0436365_0088937 | Ga0436365_0088937_6273_7088 | 232 |
| 111 | 3300039450 | Ga0436363_0494724 | Ga0436363_0494724_1986_2801 | 232 |
| 112 | 3300005344 | Ga0070661_100345469 | Ga0070661_1003454691 | 233 |
| 113 | 3300005435 | Ga0070714_100389813 | Ga0070714_1003898131 | 233 |
| 114 | 3300013307 | Ga0157372_10691631 | Ga0157372_106916312 | 233 |
| 115 | 3300026041 | Ga0207639_10027181 | Ga0207639_100271812 | 233 |
| 116 | 3300005578 | Ga0068854_100312939 | Ga0068854_1003129392 | 234 |
| 117 | 3300046684 | Ga0495669_0092589 | Ga0495669_0092589_274_1101 | 234 |
| 118 | 3300048911 | Ga0496108_0000974 | Ga0496108_0000974_16295_17122 | 234 |
| 119 | 3300009148 | Ga0105243_10169600 | Ga0105243_101696002 | 235 |
| 120 | 3300025935 | Ga0207709_10167581 | Ga0207709_101675812 | 235 |
| 121 | 3300037471 | Ga0395905_0006965 | Ga0395905_0006965_9874_10692 | 235 |
| 122 | 3300044684 | Ga0466966_0065027 | Ga0466966_0065027_1387_2202 | 235 |
| 123 | 3300044693 | Ga0466961_0062189 | Ga0466961_0062189_1438_2253 | 235 |
| 124 | 3300044694 | Ga0466963_0086494 | Ga0466963_0086494_1009_1824 | 235 |
| 125 | 3300044765 | Ga0466970_0017655 | Ga0466970_0017655_62_877 | 235 |
| 126 | 3300044842 | Ga0466957_0171484 | Ga0466957_0171484_163_978 | 235 |
| 127 | 3300005338 | Ga0068868_100054984 | Ga0068868_1000549844 | 236 |
| 128 | 3300005344 | Ga0070661_100163737 | Ga0070661_1001637372 | 236 |
| 129 | 3300005366 | Ga0070659_100100516 | Ga0070659_1001005162 | 236 |
| 130 | 3300005366 | Ga0070659_100234005 | Ga0070659_1002340051 | 236 |
| 131 | 3300005367 | Ga0070667_100126572 | Ga0070667_1001265722 | 236 |
| 132 | 3300005457 | Ga0070662_100053388 | Ga0070662_1000533882 | 236 |
| 133 | 3300005578 | Ga0068854_100089019 | Ga0068854_1000890192 | 236 |
| 134 | 3300005718 | Ga0068866_10081721 | Ga0068866_100817213 | 236 |
| 135 | 3300005834 | Ga0068851_10104647 | Ga0068851_101046472 | 236 |
| 136 | 3300005842 | Ga0068858_100052236 | Ga0068858_1000522362 | 236 |
| 137 | 3300005844 | Ga0068862_100247475 | Ga0068862_1002474752 | 236 |
| 138 | 3300006358 | Ga0068871_100066197 | Ga0068871_1000661972 | 236 |
| 139 | 3300007076 | Ga0075435_100207109 | Ga0075435_1002071092 | 236 |
| 140 | 3300009098 | Ga0105245_10573464 | Ga0105245_105734641 | 236 |
| 141 | 3300009148 | Ga0105243_10244561 | Ga0105243_102445612 | 236 |
| 142 | 3300009176 | Ga0105242_10154828 | Ga0105242_101548282 | 236 |
| 143 | 3300011119 | Ga0105246_10064863 | Ga0105246_100648632 | 236 |
| 144 | 3300011119 | Ga0105246_10381103 | Ga0105246_103811031 | 236 |
| 145 | 3300013100 | Ga0157373_10076014 | Ga0157373_100760142 | 236 |
| 146 | 3300013100 | Ga0157373_10201820 | Ga0157373_102018202 | 236 |
| 147 | 3300013105 | Ga0157369_10011303 | Ga0157369_100113032 | 236 |
| 148 | 3300014745 | Ga0157377_10058397 | Ga0157377_100583972 | 236 |
| 149 | 3300025919 | Ga0207657_10066559 | Ga0207657_100665592 | 236 |
| 150 | 3300025920 | Ga0207649_10368720 | Ga0207649_103687201 | 236 |
| 151 | 3300025923 | Ga0207681_10652510 | Ga0207681_106525101 | 236 |
| 152 | 3300025927 | Ga0207687_10156335 | Ga0207687_101563352 | 236 |
| 153 | 3300025934 | Ga0207686_10063874 | Ga0207686_100638742 | 236 |
| 154 | 3300025935 | Ga0207709_10297572 | Ga0207709_102975722 | 236 |
| 155 | 3300025940 | Ga0207691_10051374 | Ga0207691_100513742 | 236 |
| 156 | 3300025942 | Ga0207689_10054262 | Ga0207689_100542622 | 236 |
| 157 | 3300025960 | Ga0207651_10103766 | Ga0207651_101037662 | 236 |
| 158 | 3300025972 | Ga0207668_10160699 | Ga0207668_101606992 | 236 |
| 159 | 3300026035 | Ga0207703_10004057 | Ga0207703_100040572 | 236 |
| 160 | 3300026088 | Ga0207641_10175380 | Ga0207641_101753802 | 236 |
| 161 | 3300026116 | Ga0207674_10119424 | Ga0207674_101194244 | 236 |
| 162 | 3300026118 | Ga0207675_100268810 | Ga0207675_1002688102 | 236 |
| 163 | 3300037471 | Ga0395905_0217418 | Ga0395905_0217418_822_1652 | 236 |
| 164 | 3300044694 | Ga0466963_0044717 | Ga0466963_0044717_511_1332 | 236 |
| 165 | 3300044842 | Ga0466957_0323511 | Ga0466957_0323511_51_872 | 236 |
| 166 | 3300048905 | Ga0496102_0770591 | Ga0496102_0770591_42_842 | 236 |
| 167 | 3300050512 | nmdc:mga0n895_311061_c1 | nmdc:mga0n895_311061_c1_207_1031 | 236 |
| 168 | 3300002077 | JGI24744J21845_10000329 | JGI24744J21845_100003293 | 237 |
| 169 | 3300005330 | Ga0070690_100015433 | Ga0070690_1000154333 | 237 |
| 170 | 3300005331 | Ga0070670_100228112 | Ga0070670_1002281122 | 237 |
| 171 | 3300005334 | Ga0068869_100092515 | Ga0068869_1000925152 | 237 |
| 172 | 3300005335 | Ga0070666_10000784 | Ga0070666_1000078420 | 237 |
| 173 | 3300005338 | Ga0068868_100037007 | Ga0068868_1000370073 | 237 |
| 174 | 3300005354 | Ga0070675_100111392 | Ga0070675_1001113922 | 237 |
| 175 | 3300005355 | Ga0070671_100016983 | Ga0070671_1000169834 | 237 |
| 176 | 3300005364 | Ga0070673_100021894 | Ga0070673_1000218942 | 237 |
| 177 | 3300005364 | Ga0070673_100057329 | Ga0070673_1000573294 | 237 |
| 178 | 3300005364 | Ga0070673_100075272 | Ga0070673_1000752722 | 237 |
| 179 | 3300005367 | Ga0070667_100000764 | Ga0070667_10000076431 | 237 |
| 180 | 3300005434 | Ga0070709_10049343 | Ga0070709_100493432 | 237 |
| 181 | 3300005435 | Ga0070714_100335091 | Ga0070714_1003350911 | 237 |
| 182 | 3300005436 | Ga0070713_100210184 | Ga0070713_1002101842 | 237 |
| 183 | 3300005543 | Ga0070672_100074735 | Ga0070672_1000747352 | 237 |
| 184 | 3300005718 | Ga0068866_10087687 | Ga0068866_100876872 | 237 |
| 185 | 3300005842 | Ga0068858_100006383 | Ga0068858_10000638311 | 237 |
| 186 | 3300006175 | Ga0070712_100565103 | Ga0070712_1005651032 | 237 |
| 187 | 3300006237 | Ga0097621_100406897 | Ga0097621_1004068972 | 237 |
| 188 | 3300009098 | Ga0105245_10189780 | Ga0105245_101897802 | 237 |
| 189 | 3300009176 | Ga0105242_10053531 | Ga0105242_100535312 | 237 |
| 190 | 3300009177 | Ga0105248_10048261 | Ga0105248_100482613 | 237 |
| 191 | 3300009177 | Ga0105248_10191344 | Ga0105248_101913442 | 237 |
| 192 | 3300013100 | Ga0157373_10039353 | Ga0157373_100393532 | 237 |
| 193 | 3300013297 | Ga0157378_10786420 | Ga0157378_107864201 | 237 |
| 194 | 3300013308 | Ga0157375_10180307 | Ga0157375_101803073 | 237 |
| 195 | 3300025899 | Ga0207642_10063885 | Ga0207642_100638852 | 237 |
| 196 | 3300025903 | Ga0207680_10001490 | Ga0207680_100014903 | 237 |
| 197 | 3300025904 | Ga0207647_10007124 | Ga0207647_100071243 | 237 |
| 198 | 3300025906 | Ga0207699_10046160 | Ga0207699_100461602 | 237 |
| 199 | 3300025915 | Ga0207693_10027018 | Ga0207693_100270184 | 237 |
| 200 | 3300025928 | Ga0207700_10140519 | Ga0207700_101405192 | 237 |
| 201 | 3300025929 | Ga0207664_10382513 | Ga0207664_103825131 | 237 |
| 202 | 3300025931 | Ga0207644_10116681 | Ga0207644_101166812 | 237 |
| 203 | 3300025941 | Ga0207711_10000174 | Ga0207711_1000017432 | 237 |
| 204 | 3300025941 | Ga0207711_10217053 | Ga0207711_102170532 | 237 |
| 205 | 3300025945 | Ga0207679_10274539 | Ga0207679_102745392 | 237 |
| 206 | 3300025960 | Ga0207651_10011170 | Ga0207651_100111703 | 237 |
| 207 | 3300025960 | Ga0207651_10043708 | Ga0207651_100437084 | 237 |
| 208 | 3300025986 | Ga0207658_10005682 | Ga0207658_100056822 | 237 |
| 209 | 3300026023 | Ga0207677_10146424 | Ga0207677_101464242 | 237 |
| 210 | 3300026023 | Ga0207677_10282027 | Ga0207677_102820272 | 237 |
| 211 | 3300026035 | Ga0207703_10023164 | Ga0207703_100231641 | 237 |
| 212 | 3300026089 | Ga0207648_10023887 | Ga0207648_100238872 | 237 |
| 213 | 3300026121 | Ga0207683_10026205 | Ga0207683_100262053 | 237 |
| 214 | 3300028381 | Ga0268264_10216856 | Ga0268264_102168562 | 237 |
| 215 | 3300031995 | Ga0307409_100489379 | Ga0307409_1004893792 | 237 |
| 216 | 3300035692 | Ga0373935_0033605 | Ga0373935_0033605_1683_2483 | 237 |
| 217 | 3300037418 | Ga0395900_0011750 | Ga0395900_0011750_1326_2132 | 237 |
| 218 | 3300037418 | Ga0395900_0211647 | Ga0395900_0211647_801_1601 | 237 |
| 219 | 3300037466 | Ga0395898_0057015 | Ga0395898_0057015_1130_1936 | 237 |
| 220 | 3300037466 | Ga0395898_0110180 | Ga0395898_0110180_627_1427 | 237 |
| 221 | 3300037471 | Ga0395905_0146543 | Ga0395905_0146543_92_898 | 237 |
| 222 | 3300038443 | Ga0395901_0019006 | Ga0395901_0019006_2769_3575 | 237 |
| 223 | 3300048912 | Ga0496109_0072772 | Ga0496109_0072772_2054_2878 | 237 |
| 224 | 3300005331 | Ga0070670_100068604 | Ga0070670_1000686042 | 238 |
| 225 | 3300006175 | Ga0070712_100009442 | Ga0070712_1000094425 | 238 |
| 226 | 3300011119 | Ga0105246_10229467 | Ga0105246_102294671 | 238 |
| 227 | 3300025915 | Ga0207693_10012012 | Ga0207693_100120128 | 238 |
| 228 | 3300025925 | Ga0207650_10069072 | Ga0207650_100690722 | 238 |
| 229 | 3300037312 | Ga0395899_0061498 | Ga0395899_0061498_1904_2707 | 238 |
| 230 | 3300037312 | Ga0395899_0158291 | Ga0395899_0158291_62_874 | 238 |
| 231 | 3300037418 | Ga0395900_0016938 | Ga0395900_0016938_4911_5714 | 238 |
| 232 | 3300037418 | Ga0395900_0089716 | Ga0395900_0089716_600_1412 | 238 |
| 233 | 3300037466 | Ga0395898_0082203 | Ga0395898_0082203_1649_2452 | 238 |
| 234 | 3300037466 | Ga0395898_0119310 | Ga0395898_0119310_62_874 | 238 |
| 235 | 3300037471 | Ga0395905_0015854 | Ga0395905_0015854_282_1085 | 238 |
| 236 | 3300037471 | Ga0395905_0043636 | Ga0395905_0043636_3333_4145 | 238 |
| 237 | 3300037471 | Ga0395905_0066910 | Ga0395905_0066910_2144_2956 | 238 |
| 238 | 3300038443 | Ga0395901_0027042 | Ga0395901_0027042_1748_2560 | 238 |
| 239 | 3300044694 | Ga0466963_0002633 | Ga0466963_0002633_3304_4113 | 238 |
| 240 | 3300045976 | Ga0466967_0001266 | Ga0466967_0001266_5377_6186 | 238 |
| 241 | 3300048908 | Ga0496105_0495936 | Ga0496105_0495936_136_948 | 238 |
| 242 | 3300037471 | Ga0395905_0039882 | Ga0395905_0039882_944_1816 | 239 |
| 243 | 3300038443 | Ga0395901_0105170 | Ga0395901_0105170_1151_1957 | 239 |
| 244 | 3300050516 | nmdc:mga0sz30_175949_c1 | nmdc:mga0sz30_175949_c1_11_817 | 239 |
| 245 | 3300005327 | Ga0070658_10054560 | Ga0070658_100545602 | 240 |
| 246 | 3300005327 | Ga0070658_10493271 | Ga0070658_104932712 | 240 |
| 247 | 3300005330 | Ga0070690_100370898 | Ga0070690_1003708982 | 240 |
| 248 | 3300005331 | Ga0070670_100076321 | Ga0070670_1000763214 | 240 |
| 249 | 3300005335 | Ga0070666_10098559 | Ga0070666_100985592 | 240 |
| 250 | 3300005336 | Ga0070680_100072566 | Ga0070680_1000725662 | 240 |
| 251 | 3300005337 | Ga0070682_100322990 | Ga0070682_1003229902 | 240 |
| 252 | 3300005339 | Ga0070660_100006501 | Ga0070660_1000065013 | 240 |
| 253 | 3300005339 | Ga0070660_100131426 | Ga0070660_1001314262 | 240 |
| 254 | 3300005339 | Ga0070660_100274541 | Ga0070660_1002745412 | 240 |
| 255 | 3300005355 | Ga0070671_100023561 | Ga0070671_1000235613 | 240 |
| 256 | 3300005364 | Ga0070673_100080104 | Ga0070673_1000801042 | 240 |
| 257 | 3300005366 | Ga0070659_100069938 | Ga0070659_1000699382 | 240 |
| 258 | 3300005367 | Ga0070667_100035741 | Ga0070667_1000357413 | 240 |
| 259 | 3300005367 | Ga0070667_100075138 | Ga0070667_1000751383 | 240 |
| 260 | 3300005367 | Ga0070667_100244306 | Ga0070667_1002443062 | 240 |
| 261 | 3300005455 | Ga0070663_100043165 | Ga0070663_1000431653 | 240 |
| 262 | 3300005457 | Ga0070662_100189452 | Ga0070662_1001894522 | 240 |
| 263 | 3300005530 | Ga0070679_100061012 | Ga0070679_1000610122 | 240 |
| 264 | 3300005530 | Ga0070679_100441914 | Ga0070679_1004419141 | 240 |
| 265 | 3300005539 | Ga0068853_100332233 | Ga0068853_1003322332 | 240 |
| 266 | 3300005546 | Ga0070696_100199908 | Ga0070696_1001999081 | 240 |
| 267 | 3300005547 | Ga0070693_100105467 | Ga0070693_1001054671 | 240 |
| 268 | 3300005563 | Ga0068855_100522439 | Ga0068855_1005224392 | 240 |
| 269 | 3300005564 | Ga0070664_100012124 | Ga0070664_1000121249 | 240 |
| 270 | 3300005564 | Ga0070664_100036798 | Ga0070664_1000367983 | 240 |
| 271 | 3300005577 | Ga0068857_100027971 | Ga0068857_1000279712 | 240 |
| 272 | 3300005614 | Ga0068856_100482665 | Ga0068856_1004826652 | 240 |
| 273 | 3300005616 | Ga0068852_100132342 | Ga0068852_1001323422 | 240 |
| 274 | 3300005841 | Ga0068863_100017811 | Ga0068863_1000178112 | 240 |
| 275 | 3300005842 | Ga0068858_100246148 | Ga0068858_1002461483 | 240 |
| 276 | 3300005843 | Ga0068860_100051533 | Ga0068860_1000515332 | 240 |
| 277 | 3300009177 | Ga0105248_10012199 | Ga0105248_100121993 | 240 |
| 278 | 3300009545 | Ga0105237_10078383 | Ga0105237_100783832 | 240 |
| 279 | 3300009551 | Ga0105238_10384755 | Ga0105238_103847552 | 240 |
| 280 | 3300013100 | Ga0157373_10004543 | Ga0157373_100045432 | 240 |
| 281 | 3300013102 | Ga0157371_10151371 | Ga0157371_101513712 | 240 |
| 282 | 3300013296 | Ga0157374_10320997 | Ga0157374_103209972 | 240 |
| 283 | 3300014325 | Ga0163163_10217594 | Ga0163163_102175942 | 240 |
| 284 | 3300014497 | Ga0182008_10064369 | Ga0182008_100643692 | 240 |
| 285 | 3300014968 | Ga0157379_10017407 | Ga0157379_100174077 | 240 |
| 286 | 3300025907 | Ga0207645_10090463 | Ga0207645_100904632 | 240 |
| 287 | 3300025912 | Ga0207707_10210340 | Ga0207707_102103402 | 240 |
| 288 | 3300025914 | Ga0207671_10163149 | Ga0207671_101631492 | 240 |
| 289 | 3300025917 | Ga0207660_10442184 | Ga0207660_104421842 | 240 |
| 290 | 3300025919 | Ga0207657_10005786 | Ga0207657_1000578612 | 240 |
| 291 | 3300025920 | Ga0207649_10009296 | Ga0207649_100092964 | 240 |
| 292 | 3300025920 | Ga0207649_10212739 | Ga0207649_102127392 | 240 |
| 293 | 3300025920 | Ga0207649_10245283 | Ga0207649_102452832 | 240 |
| 294 | 3300025921 | Ga0207652_10193911 | Ga0207652_101939112 | 240 |
| 295 | 3300025931 | Ga0207644_10078102 | Ga0207644_100781022 | 240 |
| 296 | 3300025932 | Ga0207690_10216174 | Ga0207690_102161742 | 240 |
| 297 | 3300025932 | Ga0207690_10410545 | Ga0207690_104105452 | 240 |
| 298 | 3300025933 | Ga0207706_10045866 | Ga0207706_100458662 | 240 |
| 299 | 3300025933 | Ga0207706_10057661 | Ga0207706_100576613 | 240 |
| 300 | 3300025941 | Ga0207711_10006114 | Ga0207711_100061145 | 240 |
| 301 | 3300025945 | Ga0207679_10030926 | Ga0207679_100309262 | 240 |
| 302 | 3300025949 | Ga0207667_10735103 | Ga0207667_107351031 | 240 |
| 303 | 3300025960 | Ga0207651_10168464 | Ga0207651_101684642 | 240 |
| 304 | 3300025981 | Ga0207640_10071530 | Ga0207640_100715302 | 240 |
| 305 | 3300025981 | Ga0207640_10616283 | Ga0207640_106162831 | 240 |
| 306 | 3300025986 | Ga0207658_10006022 | Ga0207658_100060225 | 240 |
| 307 | 3300025986 | Ga0207658_10423650 | Ga0207658_104236502 | 240 |
| 308 | 3300026035 | Ga0207703_10478409 | Ga0207703_104784092 | 240 |
| 309 | 3300026041 | Ga0207639_10118008 | Ga0207639_101180081 | 240 |
| 310 | 3300026067 | Ga0207678_10039002 | Ga0207678_100390023 | 240 |
| 311 | 3300026067 | Ga0207678_10041699 | Ga0207678_100416993 | 240 |
| 312 | 3300026067 | Ga0207678_10062108 | Ga0207678_100621082 | 240 |
| 313 | 3300026116 | Ga0207674_10005768 | Ga0207674_100057685 | 240 |
| 314 | 3300026116 | Ga0207674_10081185 | Ga0207674_100811853 | 240 |
| 315 | 3300026142 | Ga0207698_10378278 | Ga0207698_103782782 | 240 |
| 316 | 3300026142 | Ga0207698_10503527 | Ga0207698_105035272 | 240 |
| 317 | 3300028381 | Ga0268264_10074618 | Ga0268264_100746182 | 240 |
| 318 | 3300037312 | Ga0395899_0001070 | Ga0395899_0001070_2973_3800 | 240 |
| 319 | 3300037418 | Ga0395900_0001041 | Ga0395900_0001041_3133_3960 | 240 |
| 320 | 3300037418 | Ga0395900_0015887 | Ga0395900_0015887_2851_3663 | 240 |
| 321 | 3300037418 | Ga0395900_0051015 | Ga0395900_0051015_1904_2716 | 240 |
| 322 | 3300037466 | Ga0395898_0000274 | Ga0395898_0000274_468_1295 | 240 |
| 323 | 3300037466 | Ga0395898_0128875 | Ga0395898_0128875_1516_2328 | 240 |
| 324 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_51947_52774 | 240 |
| 325 | 3300037471 | Ga0395905_0012465 | Ga0395905_0012465_3005_3817 | 240 |
| 326 | 3300037471 | Ga0395905_0028407 | Ga0395905_0028407_205_1023 | 240 |
| 327 | 3300038443 | Ga0395901_0001959 | Ga0395901_0001959_10005_10832 | 240 |
| 328 | 3300038443 | Ga0395901_0093959 | Ga0395901_0093959_109_921 | 240 |
| 329 | 3300045976 | Ga0466967_0544825 | Ga0466967_0544825_77_898 | 240 |
| 330 | 3300048905 | Ga0496102_0118775 | Ga0496102_0118775_213_1079 | 240 |
| 331 | 3300048906 | Ga0496103_0230677 | Ga0496103_0230677_290_1156 | 240 |
| 332 | 3300048908 | Ga0496105_0113231 | Ga0496105_0113231_1152_2018 | 240 |
| 333 | 3300048911 | Ga0496108_0019724 | Ga0496108_0019724_2080_2946 | 240 |
| 334 | 3300048913 | Ga0496110_0016722 | Ga0496110_0016722_151_1017 | 240 |
| 335 | 3300048913 | Ga0496110_0127035 | Ga0496110_0127035_946_1773 | 240 |
| 336 | 3300048914 | Ga0496111_0038294 | Ga0496111_0038294_937_1803 | 240 |
| 337 | 3300048914 | Ga0496111_0118684 | Ga0496111_0118684_188_1015 | 240 |
| 338 | 3300048915 | Ga0496112_0111558 | Ga0496112_0111558_1409_2275 | 240 |
| 339 | 3300048916 | Ga0496113_0014119 | Ga0496113_0014119_4080_4946 | 240 |
| 340 | 3300003322 | rootL2_10016393 | rootL2_100163932 | 241 |
| 341 | 3300005329 | Ga0070683_100240111 | Ga0070683_1002401112 | 241 |
| 342 | 3300005335 | Ga0070666_10117760 | Ga0070666_101177602 | 241 |
| 343 | 3300005336 | Ga0070680_100016912 | Ga0070680_1000169123 | 241 |
| 344 | 3300005337 | Ga0070682_100354125 | Ga0070682_1003541251 | 241 |
| 345 | 3300005339 | Ga0070660_100017265 | Ga0070660_1000172652 | 241 |
| 346 | 3300005339 | Ga0070660_100024885 | Ga0070660_1000248854 | 241 |
| 347 | 3300005353 | Ga0070669_100047531 | Ga0070669_1000475312 | 241 |
| 348 | 3300005366 | Ga0070659_100032065 | Ga0070659_1000320652 | 241 |
| 349 | 3300005366 | Ga0070659_100248448 | Ga0070659_1002484482 | 241 |
| 350 | 3300005455 | Ga0070663_100011726 | Ga0070663_1000117261 | 241 |
| 351 | 3300005458 | Ga0070681_10192961 | Ga0070681_101929612 | 241 |
| 352 | 3300005530 | Ga0070679_100264835 | Ga0070679_1002648351 | 241 |
| 353 | 3300005535 | Ga0070684_100028521 | Ga0070684_1000285213 | 241 |
| 354 | 3300005539 | Ga0068853_100183860 | Ga0068853_1001838602 | 241 |
| 355 | 3300005563 | Ga0068855_100222500 | Ga0068855_1002225002 | 241 |
| 356 | 3300005563 | Ga0068855_100387993 | Ga0068855_1003879932 | 241 |
| 357 | 3300005564 | Ga0070664_100254465 | Ga0070664_1002544652 | 241 |
| 358 | 3300005577 | Ga0068857_100022914 | Ga0068857_1000229145 | 241 |
| 359 | 3300005577 | Ga0068857_100057007 | Ga0068857_1000570075 | 241 |
| 360 | 3300005578 | Ga0068854_100034029 | Ga0068854_1000340292 | 241 |
| 361 | 3300005616 | Ga0068852_100190166 | Ga0068852_1001901662 | 241 |
| 362 | 3300005616 | Ga0068852_100197790 | Ga0068852_1001977902 | 241 |
| 363 | 3300005616 | Ga0068852_100211182 | Ga0068852_1002111822 | 241 |
| 364 | 3300005617 | Ga0068859_100366815 | Ga0068859_1003668153 | 241 |
| 365 | 3300005841 | Ga0068863_100023090 | Ga0068863_1000230905 | 241 |
| 366 | 3300005842 | Ga0068858_100482509 | Ga0068858_1004825092 | 241 |
| 367 | 3300005844 | Ga0068862_100158906 | Ga0068862_1001589063 | 241 |
| 368 | 3300006931 | Ga0097620_100366790 | Ga0097620_1003667903 | 241 |
| 369 | 3300009093 | Ga0105240_10032102 | Ga0105240_100321023 | 241 |
| 370 | 3300009093 | Ga0105240_10043569 | Ga0105240_100435696 | 241 |
| 371 | 3300009551 | Ga0105238_10046723 | Ga0105238_100467233 | 241 |
| 372 | 3300009551 | Ga0105238_10096775 | Ga0105238_100967752 | 241 |
| 373 | 3300009551 | Ga0105238_10399044 | Ga0105238_103990441 | 241 |
| 374 | 3300009553 | Ga0105249_10290631 | Ga0105249_102906312 | 241 |
| 375 | 3300010375 | Ga0105239_10300502 | Ga0105239_103005022 | 241 |
| 376 | 3300013100 | Ga0157373_10088159 | Ga0157373_100881592 | 241 |
| 377 | 3300013104 | Ga0157370_10009228 | Ga0157370_1000922810 | 241 |
| 378 | 3300013105 | Ga0157369_10111223 | Ga0157369_101112232 | 241 |
| 379 | 3300013307 | Ga0157372_10065516 | Ga0157372_100655162 | 241 |
| 380 | 3300013307 | Ga0157372_10525572 | Ga0157372_105255722 | 241 |
| 381 | 3300014969 | Ga0157376_10003636 | Ga0157376_100036362 | 241 |
| 382 | 3300020069 | Ga0197907_10160736 | Ga0197907_101607362 | 241 |
| 383 | 3300025904 | Ga0207647_10027780 | Ga0207647_100277802 | 241 |
| 384 | 3300025909 | Ga0207705_10246754 | Ga0207705_102467542 | 241 |
| 385 | 3300025912 | Ga0207707_10084991 | Ga0207707_100849912 | 241 |
| 386 | 3300025913 | Ga0207695_10184346 | Ga0207695_101843462 | 241 |
| 387 | 3300025919 | Ga0207657_10009175 | Ga0207657_100091755 | 241 |
| 388 | 3300025919 | Ga0207657_10039012 | Ga0207657_100390122 | 241 |
| 389 | 3300025919 | Ga0207657_10040290 | Ga0207657_100402903 | 241 |
| 390 | 3300025920 | Ga0207649_10091128 | Ga0207649_100911281 | 241 |
| 391 | 3300025921 | Ga0207652_10202000 | Ga0207652_102020001 | 241 |
| 392 | 3300025921 | Ga0207652_10215420 | Ga0207652_102154202 | 241 |
| 393 | 3300025924 | Ga0207694_10003870 | Ga0207694_100038704 | 241 |
| 394 | 3300025932 | Ga0207690_10034134 | Ga0207690_100341342 | 241 |
| 395 | 3300025932 | Ga0207690_10064193 | Ga0207690_100641932 | 241 |
| 396 | 3300025941 | Ga0207711_10185701 | Ga0207711_101857012 | 241 |
| 397 | 3300025944 | Ga0207661_10033964 | Ga0207661_100339643 | 241 |
| 398 | 3300025949 | Ga0207667_10200743 | Ga0207667_102007432 | 241 |
| 399 | 3300025949 | Ga0207667_10825876 | Ga0207667_108258761 | 241 |
| 400 | 3300025981 | Ga0207640_10029943 | Ga0207640_100299432 | 241 |
| 401 | 3300026035 | Ga0207703_10020601 | Ga0207703_100206016 | 241 |
| 402 | 3300026041 | Ga0207639_10000144 | Ga0207639_1000014435 | 241 |
| 403 | 3300026067 | Ga0207678_10021716 | Ga0207678_100217165 | 241 |
| 404 | 3300026078 | Ga0207702_10037906 | Ga0207702_100379062 | 241 |
| 405 | 3300026088 | Ga0207641_10355789 | Ga0207641_103557892 | 241 |
| 406 | 3300026116 | Ga0207674_10016402 | Ga0207674_100164023 | 241 |
| 407 | 3300026116 | Ga0207674_10019921 | Ga0207674_100199213 | 241 |
| 408 | 3300026116 | Ga0207674_10107894 | Ga0207674_101078942 | 241 |
| 409 | 3300026116 | Ga0207674_10482367 | Ga0207674_104823671 | 241 |
| 410 | 3300026142 | Ga0207698_10041600 | Ga0207698_100416002 | 241 |
| 411 | 3300026142 | Ga0207698_10085736 | Ga0207698_100857362 | 241 |
| 412 | 3300028380 | Ga0268265_10060149 | Ga0268265_100601491 | 241 |
| 413 | 3300031852 | Ga0307410_10008595 | Ga0307410_100085954 | 241 |
| 414 | 3300031995 | Ga0307409_100104360 | Ga0307409_1001043601 | 241 |
| 415 | 3300032005 | Ga0307411_10650256 | Ga0307411_106502561 | 241 |
| 416 | 3300037312 | Ga0395899_0003599 | Ga0395899_0003599_6430_7254 | 241 |
| 417 | 3300037312 | Ga0395899_0051492 | Ga0395899_0051492_631_1446 | 241 |
| 418 | 3300037418 | Ga0395900_0011436 | Ga0395900_0011436_7339_8163 | 241 |
| 419 | 3300037466 | Ga0395898_0018438 | Ga0395898_0018438_2414_3238 | 241 |
| 420 | 3300037466 | Ga0395898_0052351 | Ga0395898_0052351_2422_3237 | 241 |
| 421 | 3300037466 | Ga0395898_0182841 | Ga0395898_0182841_752_1567 | 241 |
| 422 | 3300037471 | Ga0395905_0007371 | Ga0395905_0007371_5128_5952 | 241 |
| 423 | 3300037471 | Ga0395905_0282326 | Ga0395905_0282326_663_1478 | 241 |
| 424 | 3300038443 | Ga0395901_0040796 | Ga0395901_0040796_1091_1906 | 241 |
| 425 | 3300038443 | Ga0395901_0091439 | Ga0395901_0091439_770_1594 | 241 |
| 426 | 3300044658 | Ga0466972_0059130 | Ga0466972_0059130_810_1631 | 241 |
| 427 | 3300044694 | Ga0466963_0018355 | Ga0466963_0018355_2824_3717 | 241 |
| 428 | 3300044706 | Ga0466964_0038586 | Ga0466964_0038586_759_1580 | 241 |
| 429 | 3300044735 | Ga0466968_0007068 | Ga0466968_0007068_485_1306 | 241 |
| 430 | 3300044901 | Ga0466960_0096498 | Ga0466960_0096498_93_905 | 241 |
| 431 | 3300045976 | Ga0466967_0016471 | Ga0466967_0016471_4243_5073 | 241 |
| 432 | 3300045976 | Ga0466967_0159908 | Ga0466967_0159908_545_1366 | 241 |
| 433 | 3300048906 | Ga0496103_0139436 | Ga0496103_0139436_204_1016 | 241 |
| 434 | 3300048915 | Ga0496112_0098255 | Ga0496112_0098255_1769_2581 | 241 |
| 435 | 3300005329 | Ga0070683_100074027 | Ga0070683_1000740272 | 242 |
| 436 | 3300005336 | Ga0070680_100000971 | Ga0070680_1000009714 | 242 |
| 437 | 3300005339 | Ga0070660_100027054 | Ga0070660_1000270543 | 242 |
| 438 | 3300005339 | Ga0070660_100062645 | Ga0070660_1000626452 | 242 |
| 439 | 3300005340 | Ga0070689_100277602 | Ga0070689_1002776022 | 242 |
| 440 | 3300005344 | Ga0070661_100168430 | Ga0070661_1001684302 | 242 |
| 441 | 3300005366 | Ga0070659_100082828 | Ga0070659_1000828282 | 242 |
| 442 | 3300005366 | Ga0070659_100462408 | Ga0070659_1004624082 | 242 |
| 443 | 3300005457 | Ga0070662_100099087 | Ga0070662_1000990872 | 242 |
| 444 | 3300005459 | Ga0068867_100068213 | Ga0068867_1000682133 | 242 |
| 445 | 3300005530 | Ga0070679_100131140 | Ga0070679_1001311402 | 242 |
| 446 | 3300005539 | Ga0068853_100125191 | Ga0068853_1001251911 | 242 |
| 447 | 3300005563 | Ga0068855_100052849 | Ga0068855_1000528493 | 242 |
| 448 | 3300005563 | Ga0068855_100110052 | Ga0068855_1001100522 | 242 |
| 449 | 3300005563 | Ga0068855_100248015 | Ga0068855_1002480152 | 242 |
| 450 | 3300005614 | Ga0068856_100085927 | Ga0068856_1000859272 | 242 |
| 451 | 3300005616 | Ga0068852_100010396 | Ga0068852_1000103962 | 242 |
| 452 | 3300005617 | Ga0068859_100742325 | Ga0068859_1007423252 | 242 |
| 453 | 3300005843 | Ga0068860_100615309 | Ga0068860_1006153092 | 242 |
| 454 | 3300006028 | Ga0070717_10010474 | Ga0070717_100104745 | 242 |
| 455 | 3300006931 | Ga0097620_100742406 | Ga0097620_1007424062 | 242 |
| 456 | 3300013102 | Ga0157371_10039467 | Ga0157371_100394672 | 242 |
| 457 | 3300013102 | Ga0157371_10106406 | Ga0157371_101064061 | 242 |
| 458 | 3300013105 | Ga0157369_10026642 | Ga0157369_100266423 | 242 |
| 459 | 3300013105 | Ga0157369_10154089 | Ga0157369_101540893 | 242 |
| 460 | 3300013105 | Ga0157369_10190590 | Ga0157369_101905902 | 242 |
| 461 | 3300025904 | Ga0207647_10163935 | Ga0207647_101639352 | 242 |
| 462 | 3300025917 | Ga0207660_10001465 | Ga0207660_100014657 | 242 |
| 463 | 3300025917 | Ga0207660_10161929 | Ga0207660_101619292 | 242 |
| 464 | 3300025919 | Ga0207657_10075768 | Ga0207657_100757682 | 242 |
| 465 | 3300025919 | Ga0207657_10263064 | Ga0207657_102630642 | 242 |
| 466 | 3300025923 | Ga0207681_10487061 | Ga0207681_104870611 | 242 |
| 467 | 3300025925 | Ga0207650_10100108 | Ga0207650_101001082 | 242 |
| 468 | 3300025932 | Ga0207690_10012424 | Ga0207690_100124242 | 242 |
| 469 | 3300025932 | Ga0207690_10066305 | Ga0207690_100663052 | 242 |
| 470 | 3300025932 | Ga0207690_10093466 | Ga0207690_100934661 | 242 |
| 471 | 3300025942 | Ga0207689_10136316 | Ga0207689_101363162 | 242 |
| 472 | 3300025944 | Ga0207661_10145331 | Ga0207661_101453312 | 242 |
| 473 | 3300025945 | Ga0207679_10064246 | Ga0207679_100642462 | 242 |
| 474 | 3300025949 | Ga0207667_10084992 | Ga0207667_100849922 | 242 |
| 475 | 3300025949 | Ga0207667_10095828 | Ga0207667_100958282 | 242 |
| 476 | 3300025949 | Ga0207667_10647519 | Ga0207667_106475192 | 242 |
| 477 | 3300026035 | Ga0207703_10382311 | Ga0207703_103823112 | 242 |
| 478 | 3300026041 | Ga0207639_10031620 | Ga0207639_100316202 | 242 |
| 479 | 3300026041 | Ga0207639_10138524 | Ga0207639_101385242 | 242 |
| 480 | 3300026088 | Ga0207641_10394895 | Ga0207641_103948952 | 242 |
| 481 | 3300026089 | Ga0207648_10058078 | Ga0207648_100580781 | 242 |
| 482 | 3300026142 | Ga0207698_10006878 | Ga0207698_100068782 | 242 |
| 483 | 3300026142 | Ga0207698_10633887 | Ga0207698_106338872 | 242 |
| 484 | 3300035115 | Ga0373941_0044643 | Ga0373941_0044643_108_923 | 242 |
| 485 | 3300037312 | Ga0395899_0052893 | Ga0395899_0052893_1604_2431 | 242 |
| 486 | 3300037312 | Ga0395899_0079880 | Ga0395899_0079880_956_1777 | 242 |
| 487 | 3300037312 | Ga0395899_0247244 | Ga0395899_0247244_361_1188 | 242 |
| 488 | 3300037418 | Ga0395900_0018396 | Ga0395900_0018396_1799_2626 | 242 |
| 489 | 3300037418 | Ga0395900_0060798 | Ga0395900_0060798_2876_3736 | 242 |
| 490 | 3300037418 | Ga0395900_0135243 | Ga0395900_0135243_106_930 | 242 |
| 491 | 3300037418 | Ga0395900_0342415 | Ga0395900_0342415_306_1133 | 242 |
| 492 | 3300037466 | Ga0395898_0070310 | Ga0395898_0070310_1124_1954 | 242 |
| 493 | 3300037466 | Ga0395898_0098696 | Ga0395898_0098696_1834_2661 | 242 |
| 494 | 3300037471 | Ga0395905_0030832 | Ga0395905_0030832_4015_4833 | 242 |
| 495 | 3300037471 | Ga0395905_0079934 | Ga0395905_0079934_1761_2591 | 242 |
| 496 | 3300037471 | Ga0395905_0292166 | Ga0395905_0292166_28_852 | 242 |
| 497 | 3300037471 | Ga0395905_0547511 | Ga0395905_0547511_142_969 | 242 |
| 498 | 3300038443 | Ga0395901_0158354 | Ga0395901_0158354_769_1593 | 242 |
| 499 | 3300044684 | Ga0466966_0090485 | Ga0466966_0090485_1042_1860 | 242 |
| 500 | 3300044765 | Ga0466970_0206689 | Ga0466970_0206689_87_905 | 242 |
| 501 | 3300045049 | Ga0466959_0102285 | Ga0466959_0102285_223_1041 | 242 |
| 502 | 3300045976 | Ga0466967_0026824 | Ga0466967_0026824_1326_2153 | 242 |
| 503 | 3300048910 | Ga0496107_0038682 | Ga0496107_0038682_787_1605 | 242 |
| 504 | 3300001979 | JGI24740J21852_10030528 | JGI24740J21852_100305283 | 243 |
| 505 | 3300001989 | JGI24739J22299_10016585 | JGI24739J22299_100165853 | 243 |
| 506 | 3300001989 | JGI24739J22299_10031302 | JGI24739J22299_100313022 | 243 |
| 507 | 3300001990 | JGI24737J22298_10000542 | JGI24737J22298_1000054211 | 243 |
| 508 | 3300001990 | JGI24737J22298_10000692 | JGI24737J22298_100006922 | 243 |
| 509 | 3300002075 | JGI24738J21930_10015309 | JGI24738J21930_100153092 | 243 |
| 510 | 3300005327 | Ga0070658_10006175 | Ga0070658_100061757 | 243 |
| 511 | 3300005327 | Ga0070658_10031623 | Ga0070658_100316233 | 243 |
| 512 | 3300005328 | Ga0070676_10009217 | Ga0070676_100092176 | 243 |
| 513 | 3300005329 | Ga0070683_100000846 | Ga0070683_10000084613 | 243 |
| 514 | 3300005330 | Ga0070690_100034476 | Ga0070690_1000344764 | 243 |
| 515 | 3300005334 | Ga0068869_100000728 | Ga0068869_10000072826 | 243 |
| 516 | 3300005335 | Ga0070666_10003320 | Ga0070666_100033207 | 243 |
| 517 | 3300005335 | Ga0070666_10062089 | Ga0070666_100620892 | 243 |
| 518 | 3300005337 | Ga0070682_100125012 | Ga0070682_1001250122 | 243 |
| 519 | 3300005338 | Ga0068868_100010669 | Ga0068868_1000106696 | 243 |
| 520 | 3300005339 | Ga0070660_100004392 | Ga0070660_1000043923 | 243 |
| 521 | 3300005339 | Ga0070660_100011788 | Ga0070660_1000117885 | 243 |
| 522 | 3300005344 | Ga0070661_100003518 | Ga0070661_1000035188 | 243 |
| 523 | 3300005353 | Ga0070669_100000565 | Ga0070669_10000056530 | 243 |
| 524 | 3300005354 | Ga0070675_100047118 | Ga0070675_1000471182 | 243 |
| 525 | 3300005355 | Ga0070671_100002084 | Ga0070671_1000020842 | 243 |
| 526 | 3300005355 | Ga0070671_100009573 | Ga0070671_1000095732 | 243 |
| 527 | 3300005356 | Ga0070674_100240171 | Ga0070674_1002401712 | 243 |
| 528 | 3300005364 | Ga0070673_100003973 | Ga0070673_1000039732 | 243 |
| 529 | 3300005366 | Ga0070659_100000887 | Ga0070659_10000088720 | 243 |
| 530 | 3300005366 | Ga0070659_100001567 | Ga0070659_10000156713 | 243 |
| 531 | 3300005367 | Ga0070667_100010885 | Ga0070667_1000108853 | 243 |
| 532 | 3300005367 | Ga0070667_100050410 | Ga0070667_1000504102 | 243 |
| 533 | 3300005455 | Ga0070663_100001696 | Ga0070663_1000016963 | 243 |
| 534 | 3300005456 | Ga0070678_100348807 | Ga0070678_1003488072 | 243 |
| 535 | 3300005457 | Ga0070662_100000047 | Ga0070662_10000004769 | 243 |
| 536 | 3300005457 | Ga0070662_100026387 | Ga0070662_1000263872 | 243 |
| 537 | 3300005459 | Ga0068867_100012344 | Ga0068867_1000123446 | 243 |
| 538 | 3300005539 | Ga0068853_100000033 | Ga0068853_100000033120 | 243 |
| 539 | 3300005539 | Ga0068853_100005485 | Ga0068853_1000054853 | 243 |
| 540 | 3300005544 | Ga0070686_100157745 | Ga0070686_1001577452 | 243 |
| 541 | 3300005547 | Ga0070693_100001255 | Ga0070693_1000012559 | 243 |
| 542 | 3300005547 | Ga0070693_100212860 | Ga0070693_1002128602 | 243 |
| 543 | 3300005548 | Ga0070665_100009636 | Ga0070665_1000096364 | 243 |
| 544 | 3300005548 | Ga0070665_100067978 | Ga0070665_1000679782 | 243 |
| 545 | 3300005563 | Ga0068855_100005847 | Ga0068855_1000058478 | 243 |
| 546 | 3300005563 | Ga0068855_100250463 | Ga0068855_1002504632 | 243 |
| 547 | 3300005563 | Ga0068855_100314468 | Ga0068855_1003144682 | 243 |
| 548 | 3300005564 | Ga0070664_100000066 | Ga0070664_10000006637 | 243 |
| 549 | 3300005577 | Ga0068857_100010273 | Ga0068857_1000102732 | 243 |
| 550 | 3300005578 | Ga0068854_100009153 | Ga0068854_1000091533 | 243 |
| 551 | 3300005578 | Ga0068854_100010935 | Ga0068854_1000109353 | 243 |
| 552 | 3300005614 | Ga0068856_100000162 | Ga0068856_10000016268 | 243 |
| 553 | 3300005614 | Ga0068856_100125238 | Ga0068856_1001252383 | 243 |
| 554 | 3300005614 | Ga0068856_100229197 | Ga0068856_1002291972 | 243 |
| 555 | 3300005616 | Ga0068852_100002091 | Ga0068852_10000209112 | 243 |
| 556 | 3300005616 | Ga0068852_100045542 | Ga0068852_1000455425 | 243 |
| 557 | 3300005617 | Ga0068859_100021639 | Ga0068859_1000216393 | 243 |
| 558 | 3300005617 | Ga0068859_100275171 | Ga0068859_1002751712 | 243 |
| 559 | 3300005719 | Ga0068861_100039577 | Ga0068861_1000395773 | 243 |
| 560 | 3300005840 | Ga0068870_10408811 | Ga0068870_104088111 | 243 |
| 561 | 3300005841 | Ga0068863_100007091 | Ga0068863_1000070916 | 243 |
| 562 | 3300005842 | Ga0068858_100041297 | Ga0068858_1000412973 | 243 |
| 563 | 3300005843 | Ga0068860_100007040 | Ga0068860_1000070409 | 243 |
| 564 | 3300005844 | Ga0068862_100005282 | Ga0068862_1000052823 | 243 |
| 565 | 3300005844 | Ga0068862_100489479 | Ga0068862_1004894792 | 243 |
| 566 | 3300006237 | Ga0097621_100055907 | Ga0097621_1000559072 | 243 |
| 567 | 3300006931 | Ga0097620_100021638 | Ga0097620_1000216383 | 243 |
| 568 | 3300006931 | Ga0097620_100275164 | Ga0097620_1002751642 | 243 |
| 569 | 3300009098 | Ga0105245_10000782 | Ga0105245_100007825 | 243 |
| 570 | 3300009174 | Ga0105241_10030928 | Ga0105241_100309283 | 243 |
| 571 | 3300009174 | Ga0105241_10046203 | Ga0105241_100462034 | 243 |
| 572 | 3300009174 | Ga0105241_10131570 | Ga0105241_101315702 | 243 |
| 573 | 3300009177 | Ga0105248_10003721 | Ga0105248_100037213 | 243 |
| 574 | 3300009177 | Ga0105248_10081065 | Ga0105248_100810652 | 243 |
| 575 | 3300009551 | Ga0105238_10041123 | Ga0105238_100411233 | 243 |
| 576 | 3300013100 | Ga0157373_10032530 | Ga0157373_100325303 | 243 |
| 577 | 3300013100 | Ga0157373_10052668 | Ga0157373_100526682 | 243 |
| 578 | 3300013100 | Ga0157373_10130908 | Ga0157373_101309082 | 243 |
| 579 | 3300013102 | Ga0157371_10172066 | Ga0157371_101720662 | 243 |
| 580 | 3300013102 | Ga0157371_10183291 | Ga0157371_101832912 | 243 |
| 581 | 3300013104 | Ga0157370_10042285 | Ga0157370_100422853 | 243 |
| 582 | 3300013105 | Ga0157369_10029866 | Ga0157369_100298662 | 243 |
| 583 | 3300013105 | Ga0157369_10086612 | Ga0157369_100866123 | 243 |
| 584 | 3300013105 | Ga0157369_10213548 | Ga0157369_102135482 | 243 |
| 585 | 3300013105 | Ga0157369_10318242 | Ga0157369_103182422 | 243 |
| 586 | 3300013297 | Ga0157378_10511267 | Ga0157378_105112672 | 243 |
| 587 | 3300013306 | Ga0163162_10037065 | Ga0163162_100370653 | 243 |
| 588 | 3300013308 | Ga0157375_10319983 | Ga0157375_103199832 | 243 |
| 589 | 3300014745 | Ga0157377_10080839 | Ga0157377_100808392 | 243 |
| 590 | 3300025315 | Ga0207697_10000162 | Ga0207697_1000016226 | 243 |
| 591 | 3300025901 | Ga0207688_10000909 | Ga0207688_100009097 | 243 |
| 592 | 3300025903 | Ga0207680_10013511 | Ga0207680_100135114 | 243 |
| 593 | 3300025904 | Ga0207647_10001093 | Ga0207647_100010938 | 243 |
| 594 | 3300025904 | Ga0207647_10063967 | Ga0207647_100639672 | 243 |
| 595 | 3300025907 | Ga0207645_10025315 | Ga0207645_100253152 | 243 |
| 596 | 3300025909 | Ga0207705_10005195 | Ga0207705_100051954 | 243 |
| 597 | 3300025909 | Ga0207705_10043846 | Ga0207705_100438463 | 243 |
| 598 | 3300025911 | Ga0207654_10027047 | Ga0207654_100270474 | 243 |
| 599 | 3300025913 | Ga0207695_10116166 | Ga0207695_101161662 | 243 |
| 600 | 3300025919 | Ga0207657_10009587 | Ga0207657_100095873 | 243 |
| 601 | 3300025919 | Ga0207657_10030651 | Ga0207657_100306514 | 243 |
| 602 | 3300025920 | Ga0207649_10002318 | Ga0207649_100023184 | 243 |
| 603 | 3300025924 | Ga0207694_10028276 | Ga0207694_100282762 | 243 |
| 604 | 3300025925 | Ga0207650_10127311 | Ga0207650_101273113 | 243 |
| 605 | 3300025926 | Ga0207659_10062757 | Ga0207659_100627572 | 243 |
| 606 | 3300025927 | Ga0207687_10008779 | Ga0207687_100087792 | 243 |
| 607 | 3300025931 | Ga0207644_10030510 | Ga0207644_100305102 | 243 |
| 608 | 3300025932 | Ga0207690_10000777 | Ga0207690_100007772 | 243 |
| 609 | 3300025933 | Ga0207706_10006873 | Ga0207706_100068732 | 243 |
| 610 | 3300025933 | Ga0207706_10008071 | Ga0207706_100080713 | 243 |
| 611 | 3300025935 | Ga0207709_10209660 | Ga0207709_102096602 | 243 |
| 612 | 3300025940 | Ga0207691_10001499 | Ga0207691_1000149917 | 243 |
| 613 | 3300025941 | Ga0207711_10002763 | Ga0207711_1000276315 | 243 |
| 614 | 3300025941 | Ga0207711_10012069 | Ga0207711_100120692 | 243 |
| 615 | 3300025942 | Ga0207689_10000167 | Ga0207689_1000016723 | 243 |
| 616 | 3300025944 | Ga0207661_10023773 | Ga0207661_100237734 | 243 |
| 617 | 3300025945 | Ga0207679_10000150 | Ga0207679_1000015016 | 243 |
| 618 | 3300025949 | Ga0207667_10000443 | Ga0207667_1000044312 | 243 |
| 619 | 3300025949 | Ga0207667_10130830 | Ga0207667_101308302 | 243 |
| 620 | 3300025949 | Ga0207667_10870317 | Ga0207667_108703171 | 243 |
| 621 | 3300025960 | Ga0207651_10083644 | Ga0207651_100836443 | 243 |
| 622 | 3300025981 | Ga0207640_10122069 | Ga0207640_101220692 | 243 |
| 623 | 3300025981 | Ga0207640_10136322 | Ga0207640_101363222 | 243 |
| 624 | 3300025986 | Ga0207658_10004413 | Ga0207658_1000441311 | 243 |
| 625 | 3300026023 | Ga0207677_10141284 | Ga0207677_101412842 | 243 |
| 626 | 3300026035 | Ga0207703_10014553 | Ga0207703_100145537 | 243 |
| 627 | 3300026035 | Ga0207703_10720787 | Ga0207703_107207871 | 243 |
| 628 | 3300026041 | Ga0207639_10000851 | Ga0207639_1000085120 | 243 |
| 629 | 3300026041 | Ga0207639_10008734 | Ga0207639_100087342 | 243 |
| 630 | 3300026041 | Ga0207639_10163407 | Ga0207639_101634072 | 243 |
| 631 | 3300026067 | Ga0207678_10052954 | Ga0207678_100529543 | 243 |
| 632 | 3300026078 | Ga0207702_10005597 | Ga0207702_100055972 | 243 |
| 633 | 3300026078 | Ga0207702_10186975 | Ga0207702_101869752 | 243 |
| 634 | 3300026078 | Ga0207702_10195004 | Ga0207702_101950042 | 243 |
| 635 | 3300026088 | Ga0207641_10016621 | Ga0207641_100166217 | 243 |
| 636 | 3300026089 | Ga0207648_10046120 | Ga0207648_100461202 | 243 |
| 637 | 3300026095 | Ga0207676_10002947 | Ga0207676_100029472 | 243 |
| 638 | 3300026095 | Ga0207676_10374005 | Ga0207676_103740051 | 243 |
| 639 | 3300026116 | Ga0207674_10002073 | Ga0207674_100020737 | 243 |
| 640 | 3300026118 | Ga0207675_100046661 | Ga0207675_1000466614 | 243 |
| 641 | 3300026121 | Ga0207683_10296509 | Ga0207683_102965092 | 243 |
| 642 | 3300026142 | Ga0207698_10020567 | Ga0207698_100205672 | 243 |
| 643 | 3300026142 | Ga0207698_10030800 | Ga0207698_100308004 | 243 |
| 644 | 3300026142 | Ga0207698_10101990 | Ga0207698_101019902 | 243 |
| 645 | 3300026142 | Ga0207698_10152858 | Ga0207698_101528582 | 243 |
| 646 | 3300028379 | Ga0268266_10014546 | Ga0268266_100145469 | 243 |
| 647 | 3300028380 | Ga0268265_10008862 | Ga0268265_100088623 | 243 |
| 648 | 3300028381 | Ga0268264_10008487 | Ga0268264_100084879 | 243 |
| 649 | 3300031548 | Ga0307408_100051958 | Ga0307408_1000519582 | 243 |
| 650 | 3300031824 | Ga0307413_10193030 | Ga0307413_101930302 | 243 |
| 651 | 3300031852 | Ga0307410_10012752 | Ga0307410_100127524 | 243 |
| 652 | 3300031903 | Ga0307407_10051571 | Ga0307407_100515712 | 243 |
| 653 | 3300031903 | Ga0307407_10130099 | Ga0307407_101300992 | 243 |
| 654 | 3300031995 | Ga0307409_100008491 | Ga0307409_1000084917 | 243 |
| 655 | 3300031995 | Ga0307409_100380131 | Ga0307409_1003801312 | 243 |
| 656 | 3300032004 | Ga0307414_10131779 | Ga0307414_101317791 | 243 |
| 657 | 3300032005 | Ga0307411_10041808 | Ga0307411_100418082 | 243 |
| 658 | 3300032126 | Ga0307415_100019598 | Ga0307415_1000195982 | 243 |
| 659 | 3300035112 | Ga0373932_0093526 | Ga0373932_0093526_26_916 | 243 |
| 660 | 3300035170 | Ga0373943_0010052 | Ga0373943_0010052_2884_3711 | 243 |
| 661 | 3300035691 | Ga0373931_0007229 | Ga0373931_0007229_2459_3349 | 243 |
| 662 | 3300035695 | Ga0373927_0030225 | Ga0373927_0030225_942_1769 | 243 |
| 663 | 3300037312 | Ga0395899_0013798 | Ga0395899_0013798_639_1460 | 243 |
| 664 | 3300037312 | Ga0395899_0228285 | Ga0395899_0228285_365_1192 | 243 |
| 665 | 3300037418 | Ga0395900_0036432 | Ga0395900_0036432_1730_2551 | 243 |
| 666 | 3300037418 | Ga0395900_0051432 | Ga0395900_0051432_587_1408 | 243 |
| 667 | 3300037418 | Ga0395900_0073055 | Ga0395900_0073055_595_1422 | 243 |
| 668 | 3300037418 | Ga0395900_0442876 | Ga0395900_0442876_87_908 | 243 |
| 669 | 3300037466 | Ga0395898_0103557 | Ga0395898_0103557_873_1700 | 243 |
| 670 | 3300037471 | Ga0395905_0008869 | Ga0395905_0008869_7519_8340 | 243 |
| 671 | 3300037471 | Ga0395905_0040679 | Ga0395905_0040679_1357_2178 | 243 |
| 672 | 3300037471 | Ga0395905_0041722 | Ga0395905_0041722_1740_2567 | 243 |
| 673 | 3300037471 | Ga0395905_0043749 | Ga0395905_0043749_1157_1975 | 243 |
| 674 | 3300037471 | Ga0395905_0100472 | Ga0395905_0100472_737_1558 | 243 |
| 675 | 3300037471 | Ga0395905_0222917 | Ga0395905_0222917_17_838 | 243 |
| 676 | 3300037471 | Ga0395905_0241556 | Ga0395905_0241556_415_1242 | 243 |
| 677 | 3300037471 | Ga0395905_0380693 | Ga0395905_0380693_43_873 | 243 |
| 678 | 3300037471 | Ga0395905_0592253 | Ga0395905_0592253_95_922 | 243 |
| 679 | 3300038443 | Ga0395901_0055766 | Ga0395901_0055766_1675_2502 | 243 |
| 680 | 3300038443 | Ga0395901_0067747 | Ga0395901_0067747_293_1111 | 243 |
| 681 | 3300038443 | Ga0395901_0070145 | Ga0395901_0070145_175_996 | 243 |
| 682 | 3300038443 | Ga0395901_0070313 | Ga0395901_0070313_308_1129 | 243 |
| 683 | 3300038443 | Ga0395901_0092854 | Ga0395901_0092854_1871_2692 | 243 |
| 684 | 3300038443 | Ga0395901_0155176 | Ga0395901_0155176_89_916 | 243 |
| 685 | 3300042157 | Ga0439458_0000160 | Ga0439458_0000160_8456_9277 | 243 |
| 686 | 3300042439 | Ga0439464_0001497 | Ga0439464_0001497_2857_3675 | 243 |
| 687 | 3300044656 | Ga0466969_0084563 | Ga0466969_0084563_289_1116 | 243 |
| 688 | 3300044694 | Ga0466963_0036678 | Ga0466963_0036678_1477_2304 | 243 |
| 689 | 3300044694 | Ga0466963_0128728 | Ga0466963_0128728_879_1709 | 243 |
| 690 | 3300044694 | Ga0466963_0149665 | Ga0466963_0149665_15_842 | 243 |
| 691 | 3300044842 | Ga0466957_0010777 | Ga0466957_0010777_1830_2654 | 243 |
| 692 | 3300044842 | Ga0466957_0044633 | Ga0466957_0044633_1224_2045 | 243 |
| 693 | 3300044842 | Ga0466957_0052930 | Ga0466957_0052930_141_968 | 243 |
| 694 | 3300044842 | Ga0466957_0191531 | Ga0466957_0191531_223_1044 | 243 |
| 695 | 3300045049 | Ga0466959_0166311 | Ga0466959_0166311_205_1032 | 243 |
| 696 | 3300045836 | Ga0466958_0145083 | Ga0466958_0145083_134_955 | 243 |
| 697 | 3300045836 | Ga0466958_0366852 | Ga0466958_0366852_39_866 | 243 |
| 698 | 3300045976 | Ga0466967_0114265 | Ga0466967_0114265_369_1238 | 243 |
| 699 | 3300045976 | Ga0466967_0421432 | Ga0466967_0421432_412_1239 | 243 |
| 700 | 3300045976 | Ga0466967_0450821 | Ga0466967_0450821_363_1184 | 243 |
| 701 | 3300049590 | Ga0501074_0363173 | Ga0501074_0363173_41_868 | 243 |
| 702 | 3300049741 | Ga0501079_0271079 | Ga0501079_0271079_387_1214 | 243 |
| 703 | 3300049742 | Ga0501080_0019604 | Ga0501080_0019604_2388_3215 | 243 |
| 704 | 3300049765 | Ga0501268_012010 | Ga0501268_012010_212_1033 | 243 |
| 705 | 3300061719 | Ga0466962_0138593 | Ga0466962_0138593_315_1142 | 243 |
| 706 | 3300001989 | JGI24739J22299_10017154 | JGI24739J22299_100171542 | 244 |
| 707 | 3300001990 | JGI24737J22298_10001584 | JGI24737J22298_100015842 | 244 |
| 708 | 3300001991 | JGI24743J22301_10007926 | JGI24743J22301_100079262 | 244 |
| 709 | 3300001991 | JGI24743J22301_10027533 | JGI24743J22301_100275331 | 244 |
| 710 | 3300002075 | JGI24738J21930_10020728 | JGI24738J21930_100207281 | 244 |
| 711 | 3300005328 | Ga0070676_10025188 | Ga0070676_100251882 | 244 |
| 712 | 3300005329 | Ga0070683_100140707 | Ga0070683_1001407072 | 244 |
| 713 | 3300005331 | Ga0070670_100031775 | Ga0070670_1000317752 | 244 |
| 714 | 3300005331 | Ga0070670_100066321 | Ga0070670_1000663212 | 244 |
| 715 | 3300005335 | Ga0070666_10213220 | Ga0070666_102132202 | 244 |
| 716 | 3300005338 | Ga0068868_100312205 | Ga0068868_1003122052 | 244 |
| 717 | 3300005339 | Ga0070660_100180228 | Ga0070660_1001802282 | 244 |
| 718 | 3300005354 | Ga0070675_100464049 | Ga0070675_1004640492 | 244 |
| 719 | 3300005364 | Ga0070673_100028727 | Ga0070673_1000287272 | 244 |
| 720 | 3300005364 | Ga0070673_100126532 | Ga0070673_1001265322 | 244 |
| 721 | 3300005366 | Ga0070659_100065993 | Ga0070659_1000659932 | 244 |
| 722 | 3300005457 | Ga0070662_100070691 | Ga0070662_1000706912 | 244 |
| 723 | 3300005457 | Ga0070662_100089457 | Ga0070662_1000894572 | 244 |
| 724 | 3300005535 | Ga0070684_100187484 | Ga0070684_1001874842 | 244 |
| 725 | 3300005539 | Ga0068853_100230173 | Ga0068853_1002301732 | 244 |
| 726 | 3300005548 | Ga0070665_100045989 | Ga0070665_1000459893 | 244 |
| 727 | 3300005549 | Ga0070704_100317540 | Ga0070704_1003175402 | 244 |
| 728 | 3300005577 | Ga0068857_100003003 | Ga0068857_1000030039 | 244 |
| 729 | 3300005577 | Ga0068857_100020025 | Ga0068857_1000200255 | 244 |
| 730 | 3300005578 | Ga0068854_100004155 | Ga0068854_1000041552 | 244 |
| 731 | 3300005616 | Ga0068852_100116450 | Ga0068852_1001164502 | 244 |
| 732 | 3300005841 | Ga0068863_100005669 | Ga0068863_10000566912 | 244 |
| 733 | 3300005841 | Ga0068863_100055734 | Ga0068863_1000557342 | 244 |
| 734 | 3300009553 | Ga0105249_10749572 | Ga0105249_107495721 | 244 |
| 735 | 3300013100 | Ga0157373_10012009 | Ga0157373_100120097 | 244 |
| 736 | 3300013102 | Ga0157371_10081208 | Ga0157371_100812082 | 244 |
| 737 | 3300013307 | Ga0157372_10119882 | Ga0157372_101198822 | 244 |
| 738 | 3300025904 | Ga0207647_10114561 | Ga0207647_101145612 | 244 |
| 739 | 3300025907 | Ga0207645_10005215 | Ga0207645_100052155 | 244 |
| 740 | 3300025919 | Ga0207657_10033906 | Ga0207657_100339063 | 244 |
| 741 | 3300025920 | Ga0207649_10057339 | Ga0207649_100573392 | 244 |
| 742 | 3300025925 | Ga0207650_10051253 | Ga0207650_100512532 | 244 |
| 743 | 3300025925 | Ga0207650_10150517 | Ga0207650_101505172 | 244 |
| 744 | 3300025931 | Ga0207644_10472246 | Ga0207644_104722462 | 244 |
| 745 | 3300025932 | Ga0207690_10031983 | Ga0207690_100319832 | 244 |
| 746 | 3300025932 | Ga0207690_10572433 | Ga0207690_105724331 | 244 |
| 747 | 3300025933 | Ga0207706_10020060 | Ga0207706_100200605 | 244 |
| 748 | 3300025933 | Ga0207706_10060769 | Ga0207706_100607693 | 244 |
| 749 | 3300025937 | Ga0207669_10192884 | Ga0207669_101928841 | 244 |
| 750 | 3300025944 | Ga0207661_10209057 | Ga0207661_102090571 | 244 |
| 751 | 3300026041 | Ga0207639_10111985 | Ga0207639_101119852 | 244 |
| 752 | 3300026067 | Ga0207678_10005023 | Ga0207678_100050232 | 244 |
| 753 | 3300026088 | Ga0207641_10011660 | Ga0207641_100116608 | 244 |
| 754 | 3300026089 | Ga0207648_10138611 | Ga0207648_101386113 | 244 |
| 755 | 3300026116 | Ga0207674_10007637 | Ga0207674_100076373 | 244 |
| 756 | 3300026116 | Ga0207674_10033866 | Ga0207674_100338662 | 244 |
| 757 | 3300028379 | Ga0268266_10088056 | Ga0268266_100880562 | 244 |
| 758 | 3300031731 | Ga0307405_10341223 | Ga0307405_103412232 | 244 |
| 759 | 3300031824 | Ga0307413_10144753 | Ga0307413_101447532 | 244 |
| 760 | 3300032004 | Ga0307414_10217176 | Ga0307414_102171761 | 244 |
| 761 | 3300032005 | Ga0307411_10099180 | Ga0307411_100991802 | 244 |
| 762 | 3300032126 | Ga0307415_100216363 | Ga0307415_1002163632 | 244 |
| 763 | 3300037312 | Ga0395899_0064142 | Ga0395899_0064142_1231_2052 | 244 |
| 764 | 3300037418 | Ga0395900_0069555 | Ga0395900_0069555_2293_3114 | 244 |
| 765 | 3300037418 | Ga0395900_0317046 | Ga0395900_0317046_75_896 | 244 |
| 766 | 3300037466 | Ga0395898_0018633 | Ga0395898_0018633_459_1280 | 244 |
| 767 | 3300037466 | Ga0395898_0530800 | Ga0395898_0530800_156_977 | 244 |
| 768 | 3300037471 | Ga0395905_0002330 | Ga0395905_0002330_9793_10614 | 244 |
| 769 | 3300037471 | Ga0395905_0009804 | Ga0395905_0009804_7291_8112 | 244 |
| 770 | 3300037471 | Ga0395905_0158139 | Ga0395905_0158139_1126_1953 | 244 |
| 771 | 3300037471 | Ga0395905_0217989 | Ga0395905_0217989_191_1012 | 244 |
| 772 | 3300038443 | Ga0395901_0026433 | Ga0395901_0026433_3545_4366 | 244 |
| 773 | 3300001979 | JGI24740J21852_10003553 | JGI24740J21852_100035533 | 245 |
| 774 | 3300005327 | Ga0070658_10025606 | Ga0070658_100256063 | 245 |
| 775 | 3300005336 | Ga0070680_100032124 | Ga0070680_1000321243 | 245 |
| 776 | 3300005337 | Ga0070682_100008674 | Ga0070682_1000086743 | 245 |
| 777 | 3300005341 | Ga0070691_10000317 | Ga0070691_1000031713 | 245 |
| 778 | 3300005457 | Ga0070662_100113433 | Ga0070662_1001134332 | 245 |
| 779 | 3300005530 | Ga0070679_100101931 | Ga0070679_1001019312 | 245 |
| 780 | 3300005535 | Ga0070684_100015644 | Ga0070684_1000156443 | 245 |
| 781 | 3300005539 | Ga0068853_100032634 | Ga0068853_1000326343 | 245 |
| 782 | 3300005564 | Ga0070664_100008785 | Ga0070664_1000087854 | 245 |
| 783 | 3300005577 | Ga0068857_100007256 | Ga0068857_1000072566 | 245 |
| 784 | 3300005578 | Ga0068854_100036074 | Ga0068854_1000360742 | 245 |
| 785 | 3300005834 | Ga0068851_10055765 | Ga0068851_100557652 | 245 |
| 786 | 3300009093 | Ga0105240_10070138 | Ga0105240_100701381 | 245 |
| 787 | 3300009545 | Ga0105237_10010459 | Ga0105237_100104594 | 245 |
| 788 | 3300009551 | Ga0105238_10037975 | Ga0105238_100379753 | 245 |
| 789 | 3300013100 | Ga0157373_10026182 | Ga0157373_100261822 | 245 |
| 790 | 3300013104 | Ga0157370_10009365 | Ga0157370_100093653 | 245 |
| 791 | 3300013105 | Ga0157369_10546448 | Ga0157369_105464482 | 245 |
| 792 | 3300013307 | Ga0157372_10056188 | Ga0157372_100561881 | 245 |
| 793 | 3300020070 | Ga0206356_11518027 | Ga0206356_115180272 | 245 |
| 794 | 3300022467 | Ga0224712_10135891 | Ga0224712_101358912 | 245 |
| 795 | 3300025321 | Ga0207656_10201455 | Ga0207656_102014551 | 245 |
| 796 | 3300025904 | Ga0207647_10001424 | Ga0207647_100014244 | 245 |
| 797 | 3300025913 | Ga0207695_10012117 | Ga0207695_100121177 | 245 |
| 798 | 3300025917 | Ga0207660_10362985 | Ga0207660_103629851 | 245 |
| 799 | 3300025919 | Ga0207657_10007431 | Ga0207657_100074314 | 245 |
| 800 | 3300025920 | Ga0207649_10013315 | Ga0207649_100133153 | 245 |
| 801 | 3300025924 | Ga0207694_10045103 | Ga0207694_100451032 | 245 |
| 802 | 3300025932 | Ga0207690_10002539 | Ga0207690_100025392 | 245 |
| 803 | 3300025933 | Ga0207706_10388058 | Ga0207706_103880582 | 245 |
| 804 | 3300025944 | Ga0207661_10429043 | Ga0207661_104290432 | 245 |
| 805 | 3300025949 | Ga0207667_10012419 | Ga0207667_100124192 | 245 |
| 806 | 3300026041 | Ga0207639_10042855 | Ga0207639_100428552 | 245 |
| 807 | 3300026067 | Ga0207678_10024585 | Ga0207678_100245852 | 245 |
| 808 | 3300026078 | Ga0207702_10010053 | Ga0207702_100100533 | 245 |
| 809 | 3300026116 | Ga0207674_10009450 | Ga0207674_100094504 | 245 |
| 810 | 3300026142 | Ga0207698_10002267 | Ga0207698_100022673 | 245 |
| 811 | 3300037312 | Ga0395899_0043275 | Ga0395899_0043275_826_1650 | 245 |
| 812 | 3300037466 | Ga0395898_0026753 | Ga0395898_0026753_2609_3433 | 245 |
| 813 | 3300038443 | Ga0395901_0544706 | Ga0395901_0544706_133_960 | 245 |
| 814 | 3300044694 | Ga0466963_0048807 | Ga0466963_0048807_712_1536 | 245 |
| 815 | 3300044842 | Ga0466957_0143719 | Ga0466957_0143719_278_1102 | 245 |
| 816 | 3300045836 | Ga0466958_0084515 | Ga0466958_0084515_390_1214 | 245 |
| 817 | 3300045976 | Ga0466967_0041175 | Ga0466967_0041175_2923_3810 | 245 |
| 818 | 3300048915 | Ga0496112_0001713 | Ga0496112_0001713_2626_3453 | 245 |
| 819 | 3300048916 | Ga0496113_0040294 | Ga0496113_0040294_2297_3124 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wwb-assembly1.cif.gz_B | choline transporter-like protein 1 | 0.5352 | 40 | 230 |
| 3tx3-assembly1.cif.gz_B | cysz, a putative sulfate permease | 0.5122 | 21 | 240 |
| 3tx3-assembly1.cif.gz_B | cysz, a putative sulfate permease | 0.5 | 21 | 240 |
| 7wwb-assembly1.cif.gz_B | choline transporter-like protein 1 | 0.4413 | 40 | 230 |
| 6ffc-assembly1.cif.gz_A | structure of an inhibitor-bound abc transporter | 0.3175 | 27 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4278 | 14 | 233 | 1.20.1070.10 |
| af_I1KMF2_37_348_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3942 | 14 | 233 | 1.20.1070.10 |
| af_Q18000_173_429_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3414 | 1 | 234 | 1.20.1070.10 |
| af_Q18000_173_429_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.329 | 1 | 234 | 1.20.1070.10 |
| af_A0A0R4IDZ8_1844_1969_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.3143 | 26 | 185 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848U517-F1-model_v4 | DUF2189 domain-containing protein | 0.8111 | 12 | 244 |
GO:0016020
|
| AF-A0A7W6WV38-F1-model_v4 | Putative membrane protein | 0.8077 | 13 | 245 |
GO:0016020
|
| AF-A0A7Y5UKM6-F1-model_v4 | DUF2189 domain-containing protein | 0.8062 | 4 | 237 |
GO:0016020
|
| AF-X7EH69-F1-model_v4 | Cytochrome C oxidase subunit I | 0.8036 | 14 | 237 |
GO:0016020
|
| AF-A0A4V3CX01-F1-model_v4 | Putative membrane protein | 0.8025 | 13 | 237 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar