F482131

General Info

Members Datasets Scaffolds Average Seq Length
818 296 790 319

Family's Representative Sequence

Representative Sequence 3300042008|Ga0439450_015579|Ga0439450_015579_14_1174
Length 386
Sequence MQHDERYRKSAQGVEAVDAGRSPRIDAVHADILLRKPRMMPWAGPARYNARILRTHSFGTRRMIPASQLHFKSVNYTGQGPGPKVIIMGATHGNEKCGTQAIQRIMAEIDAGTLPIVNGSVTFVPIVNPKAYAQNTRSGDRNLNRDLSPKAEPHDFEDHVANWLCPLLAQHDVLLDLHSFNAAHGEPFLMVGPLDNDGPLEPFKHMRAERALARRLGVRRFVTGWMAAYGGGVQRRSRGNAQELQTVLRYGMGTTEYMRSTGGYALTLECGQHLDPRAPDVAYTAIMNTLAFLKIIDAPEPEPIAFEEMEALQMVVVHDKLDAGDQFTRQWASFDPVAEGEQIGVRADGTPVVAEFAGRILFPDVNAQPNHEWYYLTRPNPAFGRE

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221645 Massilia sp. Root351 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2842711865 Duganella sp. R-73148 Isolate Unclassified
19 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
20 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
21 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
22 2857553236 Duganella sp. R-74557 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2904424332 Duganella sp. 1411 Isolate Rhizosphere
25 2919476304 Duganella sp. 3397 Isolate Unclassified
26 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
258 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
282 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
283 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
284 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
285 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
286 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
287 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
291 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
294 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
295 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
296 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.58
Metatranscriptomes 0
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0.49
Rhizoplane 3.3
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000716 3300002738 Bacteria 15035
2 JGI25158J39367_1006807 3300002739 Unclassified 1631
3 JGI25152J39213_1000005 3300002773 Bacteria 160019
4 JGI25150J39212_1000571 3300002774 Bacteria 14701
5 JGI25150J39212_1001739 3300002774 Bacteria 5827
6 JGI25150J39212_1005726 3300002774 Unclassified 2629
7 JGI25159J45721_1003493 3300002987 Bacteria 5539
8 JGI25159J45721_1004574 3300002987 Unclassified 4551
9 JGI25153J46596_10005856 3300003215 Bacteria 6369
10 rootL2_10030442 3300003322 Bacteria 3708
11 rootL2_10030453 3300003322 Bacteria 3049
12 rootL2_10035258 3300003322 Bacteria 5432
13 rootL2_10117580 3300003322 Bacteria 2190
14 rootH1_10094760 3300003323 Bacteria 3192
15 JGI25161J50226_1000182 3300003374 Bacteria 42010
16 Ga0055529_1000068 3300003763 Bacteria 163911
17 Ga0055526_1000013 3300003771 Bacteria 233580
18 Ga0055526_1000048 3300003771 Bacteria 120076
19 Ga0055526_1000934 3300003771 Bacteria 21684
20 Ga0055526_1005682 3300003771 Bacteria 7080
21 Ga0055526_1009881 3300003771 Unclassified 4524
22 Ga0055537_1000039 3300003773 Bacteria 92151
23 Ga0055537_1002487 3300003773 Bacteria 6146
24 Ga0055537_1013747 3300003773 Unclassified 1504
25 Ga0055537_1018641 3300003773 Unclassified 1102
26 Ga0055524_1000008 3300003775 Bacteria 297761
27 Ga0055524_1000187 3300003775 Bacteria 68927
28 Ga0055524_1004427 3300003775 Bacteria 6483
29 Ga0055524_1007806 3300003775 Unclassified 4512
30 Ga0055524_1014954 3300003775 Unclassified 2852
31 Ga0055534_1000174 3300003784 Bacteria 47983
32 Ga0055534_1001797 3300003784 Bacteria 8068
33 Ga0055534_1011384 3300003784 Unclassified 1812
34 Ga0055528_1000066 3300003790 Bacteria 84724
35 Ga0055530_10010604 3300003791 Unclassified 3386
36 Ga0055531_10005354 3300003794 Bacteria 7522
37 Ga0055543_1000112 3300004625 Bacteria 69589
38 Ga0055543_1004521 3300004625 Bacteria 3762
39 Ga0065165_1000005 3300005262 Bacteria 370361
40 Ga0065165_1001216 3300005262 Bacteria 29672
41 Ga0065165_1013430 3300005262 Bacteria 3255
42 Ga0065715_10226472 3300005293 Bacteria 1250
43 Ga0070658_10298854 3300005327 Bacteria 1372
44 Ga0070670_100179593 3300005331 Bacteria 1837
45 Ga0070677_10023916 3300005333 Bacteria 2266
46 Ga0070666_10019569 3300005335 Bacteria 4371
47 Ga0070666_10187186 3300005335 Bacteria 1454
48 Ga0068868_100005354 3300005338 Bacteria 9010
49 Ga0070661_100028344 3300005344 Bacteria 4039
50 Ga0070669_100034198 3300005353 Bacteria 3680
51 Ga0070671_100023446 3300005355 Bacteria 5050
52 Ga0070674_100182477 3300005356 Bacteria 1609
53 Ga0070673_100000606 3300005364 Bacteria 19571
54 Ga0070673_100123979 3300005364 Bacteria 2159
55 Ga0070659_100216032 3300005366 Bacteria 1581
56 Ga0070667_100033198 3300005367 Bacteria 4311
57 Ga0070678_100001713 3300005456 Bacteria 11776
58 Ga0070678_100329196 3300005456 Bacteria 1307
59 Ga0068867_100014626 3300005459 Bacteria 5561
60 Ga0070672_100096403 3300005543 Bacteria 2393
61 Ga0068855_100002919 3300005563 Bacteria 20926
62 Ga0070664_100125975 3300005564 Bacteria 2247
63 Ga0070664_100162879 3300005564 Bacteria 1974
64 Ga0068852_100121583 3300005616 Bacteria 2392
65 Ga0068859_100001422 3300005617 Bacteria 24299
66 Ga0068864_100401147 3300005618 Bacteria 1303
67 Ga0068861_100035186 3300005719 Bacteria 3708
68 Ga0068861_100134371 3300005719 Bacteria 2011
69 Ga0068861_100514437 3300005719 Bacteria 1084
70 Ga0068863_100017744 3300005841 Bacteria 6812
71 Ga0068858_100003140 3300005842 Bacteria 16536
72 Ga0068862_100044143 3300005844 Bacteria 3802
73 Ga0097621_100085920 3300006237 Bacteria 2625
74 Ga0068871_100002105 3300006358 Bacteria 13467
75 Ga0097620_100001422 3300006931 Bacteria 24299
76 Ga0099826_10000001 3300006948 Bacteria 1155201
77 Ga0105244_10002659 3300009036 Bacteria 13391
78 Ga0105243_10076171 3300009148 Bacteria 2725
79 Ga0105242_10091014 3300009176 Unclassified 2567
80 Ga0105248_10065661 3300009177 Bacteria 4074
81 Ga0105238_10460173 3300009551 Bacteria 1270
82 Ga0157371_10000026 3300013102 Bacteria 274703
83 Ga0157374_10439844 3300013296 Bacteria 1304
84 Ga0163162_10017462 3300013306 Bacteria 7020
85 Ga0163162_10147621 3300013306 Bacteria 2468
86 Ga0157375_10231092 3300013308 Bacteria 2009
87 Ga0163163_10015841 3300014325 Bacteria 6983
88 Ga0157380_10049131 3300014326 Bacteria 3326
89 Ga0182008_10004711 3300014497 Bacteria 7910
90 Ga0182008_10027096 3300014497 Bacteria 2905
91 Ga0157376_10126687 3300014969 Bacteria 2272
92 Ga0182006_1000029 3300015261 Bacteria 247579
93 Ga0182006_1026492 3300015261 Bacteria 2372
94 Ga0182007_10000997 3300015262 Bacteria 15535
95 Ga0182005_1000002 3300015265 Bacteria 908499
96 Ga0182005_1000012 3300015265 Bacteria 396944
97 Ga0163161_10060543 3300017792 Bacteria 2756
98 Ga0163161_10110159 3300017792 Bacteria 2058
99 Ga0213872_10000032 3300021361 Bacteria 138939
100 Ga0209436_100484 3300025208 Bacteria 17563
101 Ga0209436_111393 3300025208 Bacteria 1564
102 Ga0209563_100003 3300025230 Bacteria 1932942
103 Ga0207425_1000001 3300025245 Bacteria 2525432
104 Ga0207425_1000130 3300025245 Bacteria 70791
105 Ga0207425_1000132 3300025245 Bacteria 68018
106 Ga0209646_1000007 3300025246 Bacteria 670994
107 Ga0209677_108796 3300025253 Bacteria 1898
108 Ga0209148_1005446 3300025254 Bacteria 2918
109 Ga0209129_1000003 3300025258 Bacteria 903689
110 Ga0209129_1009156 3300025258 Bacteria 2649
111 Ga0209565_1000003 3300025263 Bacteria 1099648
112 Ga0209565_1003147 3300025263 Bacteria 5511
113 Ga0209565_1003288 3300025263 Bacteria 5312
114 Ga0209565_1004100 3300025263 Bacteria 4538
115 Ga0209565_1006959 3300025263 Bacteria 3106
116 Ga0209565_1017245 3300025263 Bacteria 1587
117 Ga0209455_1000026 3300025272 Bacteria 653778
118 Ga0209673_1000003 3300025273 Bacteria 980859
119 Ga0209673_1014177 3300025273 Bacteria 3096
120 Ga0209673_1033525 3300025273 Bacteria 1564
121 Ga0209130_1000084 3300025284 Bacteria 160070
122 Ga0209130_1000237 3300025284 Bacteria 70739
123 Ga0209130_1004662 3300025284 Bacteria 5089
124 Ga0209675_1000003 3300025291 Bacteria 1003982
125 Ga0209675_1006952 3300025291 Bacteria 4438
126 Ga0209675_1013840 3300025291 Bacteria 2493
127 Ga0209025_1006230 3300025294 Bacteria 9350
128 Ga0209564_1000002 3300025295 Bacteria 1636803
129 Ga0209564_1000007 3300025295 Bacteria 1028582
130 Ga0209564_1000012 3300025295 Bacteria 792078
131 Ga0209564_1000311 3300025295 Bacteria 95587
132 Ga0209564_1005699 3300025295 Bacteria 6983
133 Ga0209564_1007930 3300025295 Bacteria 5355
134 Ga0209758_1000041 3300025297 Bacteria 410328
135 Ga0209758_1000757 3300025297 Bacteria 46825
136 Ga0209050_1000011 3300025298 Bacteria 914037
137 Ga0209050_1000164 3300025298 Bacteria 154628
138 Ga0209050_1000664 3300025298 Bacteria 52795
139 Ga0209256_1000005 3300025299 Bacteria 1315082
140 Ga0209256_1000068 3300025299 Bacteria 246064
141 Ga0209256_1000395 3300025299 Bacteria 69343
142 Ga0209256_1000952 3300025299 Bacteria 35118
143 Ga0209256_1003000 3300025299 Bacteria 12538
144 Ga0207426_1003864 3300025302 Bacteria 7725
145 Ga0207426_1058678 3300025302 Bacteria 1116
146 Ga0209257_1000003 3300025304 Bacteria 1702593
147 Ga0209257_1016232 3300025304 Bacteria 3027
148 Ga0207697_10040931 3300025315 Bacteria 1902
149 Ga0207655_1004019 3300025728 Bacteria 10620
150 Ga0207682_10005733 3300025893 Bacteria 5037
151 Ga0207682_10006232 3300025893 Bacteria 4818
152 Ga0207680_10002181 3300025903 Bacteria 9174
153 Ga0207645_10119665 3300025907 Bacteria 1709
154 Ga0207705_10001990 3300025909 Bacteria 15883
155 Ga0207705_10072000 3300025909 Bacteria 2506
156 Ga0207705_10183385 3300025909 Bacteria 1580
157 Ga0207654_10023184 3300025911 Bacteria 3321
158 Ga0207662_10012947 3300025918 Bacteria 4657
159 Ga0207681_10015030 3300025923 Bacteria 4824
160 Ga0207644_10014885 3300025931 Bacteria 5214
161 Ga0207706_10080716 3300025933 Bacteria 2859
162 Ga0207709_10054405 3300025935 Bacteria 2468
163 Ga0207669_10123980 3300025937 Bacteria 1760
164 Ga0207691_10088615 3300025940 Bacteria 2775
165 Ga0207691_10111128 3300025940 Bacteria 2437
166 Ga0207711_10027897 3300025941 Bacteria 4746
167 Ga0207679_10040362 3300025945 Bacteria 3340
168 Ga0207679_10077164 3300025945 Bacteria 2533
169 Ga0207679_10199365 3300025945 Bacteria 1671
170 Ga0207667_10001048 3300025949 Bacteria 35209
171 Ga0207651_10031915 3300025960 Bacteria 3374
172 Ga0207677_10002910 3300026023 Bacteria 9042
173 Ga0207703_10007134 3300026035 Bacteria 8892
174 Ga0207641_10004402 3300026088 Bacteria 12205
175 Ga0207641_10218363 3300026088 Bacteria 1767
176 Ga0207648_10119713 3300026089 Bacteria 2314
177 Ga0207648_10170142 3300026089 Bacteria 1926
178 Ga0207676_10003508 3300026095 Bacteria 11098
179 Ga0207675_100010028 3300026118 Bacteria 8878
180 Ga0207675_100175568 3300026118 Bacteria 2050
181 Ga0207683_10006519 3300026121 Bacteria 9994
182 Ga0207683_10355145 3300026121 Bacteria 1346
183 Ga0207698_10081845 3300026142 Bacteria 2608
184 Ga0209281_1003014 3300027111 Bacteria 5967
185 Ga0209281_1005961 3300027111 Bacteria 3257
186 Ga0209282_1000001 3300027666 Bacteria 2450367
187 Ga0268266_10187480 3300028379 Bacteria 1887
188 Ga0268265_10081584 3300028380 Bacteria 2554
189 Ga0307515_10241205 3300028794 Bacteria 1578
190 Ga0316180_1112319 3300030736 Bacteria 1632
191 Ga0316181_1216539 3300030744 Bacteria 1218
192 Ga0307408_100001129 3300031548 Bacteria 20315
193 Ga0307408_100001185 3300031548 Bacteria 19736
194 Ga0307408_100003316 3300031548 Bacteria 11066
195 Ga0307416_100084493 3300032002 Bacteria 2697
196 Ga0307414_10003286 3300032004 Bacteria 8617
197 Ga0373952_0002402 3300035092 Bacteria 3375
198 Ga0373935_0161480 3300035692 Bacteria 1528
199 Ga0395899_0004735 3300037312 Bacteria 10613
200 Ga0395899_0005686 3300037312 Bacteria 9680
201 Ga0395899_0010310 3300037312 Bacteria 7165
202 Ga0395899_0091327 3300037312 Bacteria 2206
203 Ga0395900_0002091 3300037418 Bacteria 22383
204 Ga0395900_0003097 3300037418 Bacteria 18057
205 Ga0395900_0003147 3300037418 Bacteria 17898
206 Ga0395900_0080938 3300037418 Bacteria 3337
207 Ga0395898_0011645 3300037466 Bacteria 9124
208 Ga0395898_0017086 3300037466 Bacteria 7410
209 Ga0395898_0031587 3300037466 Bacteria 5290
210 Ga0395898_0091283 3300037466 Bacteria 2930
211 Ga0395905_0013949 3300037471 Bacteria 7685
212 Ga0395905_0015250 3300037471 Bacteria 7306
213 Ga0395905_0055941 3300037471 Bacteria 3692
214 Ga0395905_0059785 3300037471 Bacteria 3563
215 Ga0395905_0149117 3300037471 Bacteria 2200
216 Ga0395905_0436863 3300037471 Bacteria 1206
217 Ga0395901_0000212 3300038443 Bacteria 73375
218 Ga0395901_0000522 3300038443 Bacteria 44365
219 Ga0395901_0229464 3300038443 Bacteria 1938
220 Ga0436360_1203167 3300039438 Bacteria 839
221 Ga0436361_0168778 3300039447 Bacteria 51987
222 Ga0436361_0993359 3300039447 Bacteria 43823
223 Ga0439448_0016603 3300042005 Bacteria 2241
224 Ga0439449_0024840 3300042007 Bacteria 2240
225 Ga0439450_011670 3300042008 Bacteria 1726
226 Ga0439450_015579 3300042008 Bacteria 1559
227 Ga0439450_043299 3300042008 Bacteria 1051
228 Ga0439455_0006438 3300042012 Bacteria 2437
229 Ga0450897_001616 3300042128 Bacteria 1561
230 Ga0466972_0023087 3300044658 Bacteria 3095
231 Ga0466965_0009082 3300044683 Bacteria 4611
232 Ga0466965_0016185 3300044683 Bacteria 3545
233 Ga0466965_0024959 3300044683 Bacteria 2892
234 Ga0466966_0000457 3300044684 Bacteria 26267
235 Ga0466966_0019594 3300044684 Bacteria 4451
236 Ga0466966_0065376 3300044684 Bacteria 2287
237 Ga0466966_0132664 3300044684 Bacteria 1524
238 Ga0466966_0145256 3300044684 Bacteria 1448
239 Ga0466961_0009150 3300044693 Bacteria 6307
240 Ga0466961_0027393 3300044693 Bacteria 3665
241 Ga0466963_0207435 3300044694 Bacteria 1371
242 Ga0466964_0000435 3300044706 Bacteria 12697
243 Ga0466964_0002446 3300044706 Bacteria 6605
244 Ga0466964_0014920 3300044706 Bacteria 2959
245 Ga0466968_0001497 3300044735 Bacteria 8367
246 Ga0466968_0043937 3300044735 Bacteria 1893
247 Ga0466970_0024531 3300044765 Bacteria 3154
248 Ga0466970_0095349 3300044765 Bacteria 1617
249 Ga0466957_0000114 3300044842 Bacteria 33158
250 Ga0466957_0012400 3300044842 Bacteria 4933
251 Ga0466957_0027382 3300044842 Bacteria 3387
252 Ga0466960_0067601 3300044901 Bacteria 1770
253 Ga0466959_0005057 3300045049 Bacteria 8964
254 Ga0466959_0025010 3300045049 Bacteria 4423
255 Ga0466959_0030580 3300045049 Bacteria 3988
256 Ga0451576_0017483 3300045051 Bacteria 7883
257 Ga0466967_0030085 3300045976 Bacteria 4553
258 Ga0495617_000042 3300046452 Bacteria 122225
259 Ga0495617_000063 3300046452 Bacteria 95793
260 Ga0495617_037565 3300046452 Bacteria 1621
261 Ga0495627_000057 3300046453 Bacteria 144773
262 Ga0495627_000323 3300046453 Bacteria 46699
263 Ga0495627_003505 3300046453 Bacteria 6881
264 Ga0495590_0000010 3300046457 Bacteria 317890
265 Ga0495590_0000837 3300046457 Bacteria 13900
266 Ga0495590_0002387 3300046457 Bacteria 7779
267 Ga0495590_0062336 3300046457 Bacteria 1305
268 Ga0495629_0017851 3300046459 Bacteria 5085
269 Ga0495629_0035318 3300046459 Bacteria 3532
270 Ga0495638_0000027 3300046460 Bacteria 337569
271 Ga0495638_0020283 3300046460 Bacteria 4392
272 Ga0495638_0020825 3300046460 Bacteria 4331
273 Ga0495638_0024603 3300046460 Bacteria 3924
274 Ga0495638_0048379 3300046460 Bacteria 2662
275 Ga0495638_0056006 3300046460 Bacteria 2447
276 Ga0495653_0004474 3300046463 Bacteria 11286
277 Ga0495653_0035700 3300046463 Bacteria 3921
278 Ga0495653_0066832 3300046463 Bacteria 2702
279 Ga0495653_0112559 3300046463 Bacteria 1953
280 Ga0495650_0000044 3300046471 Bacteria 355139
281 Ga0495650_0000066 3300046471 Bacteria 272883
282 Ga0495650_0000229 3300046471 Bacteria 114086
283 Ga0495650_0001129 3300046471 Bacteria 29018
284 Ga0495650_0003132 3300046471 Bacteria 12383
285 Ga0495650_0017307 3300046471 Bacteria 3617
286 Ga0495650_0030602 3300046471 Bacteria 2435
287 Ga0495582_0020516 3300046473 Bacteria 3618
288 Ga0495605_0000027 3300046474 Bacteria 220680
289 Ga0495605_0000049 3300046474 Bacteria 166669
290 Ga0495605_0000130 3300046474 Bacteria 98652
291 Ga0495605_0009901 3300046474 Bacteria 5345
292 Ga0495605_0012517 3300046474 Bacteria 4703
293 Ga0495605_0030705 3300046474 Bacteria 2752
294 Ga0495605_0037262 3300046474 Bacteria 2447
295 Ga0495605_0050378 3300046474 Bacteria 2031
296 Ga0495605_0062472 3300046474 Bacteria 1779
297 Ga0495605_0091000 3300046474 Bacteria 1414
298 Ga0495639_0013547 3300046475 Bacteria 3524
299 Ga0495584_0000001 3300046491 Bacteria 649329
300 Ga0495584_0000137 3300046491 Bacteria 50397
301 Ga0495584_0000164 3300046491 Bacteria 46886
302 Ga0495584_0001830 3300046491 Bacteria 12360
303 Ga0495584_0007483 3300046491 Bacteria 5693
304 Ga0495584_0008092 3300046491 Bacteria 5463
305 Ga0495584_0010845 3300046491 Bacteria 4676
306 Ga0495584_0122624 3300046491 Bacteria 1316
307 Ga0495584_0138294 3300046491 Bacteria 1236
308 Ga0495585_0000003 3300046492 Bacteria 406344
309 Ga0495585_0000011 3300046492 Bacteria 210440
310 Ga0495585_0000040 3300046492 Bacteria 130615
311 Ga0495585_0000233 3300046492 Bacteria 57350
312 Ga0495585_0000365 3300046492 Bacteria 43900
313 Ga0495585_0000385 3300046492 Bacteria 42521
314 Ga0495585_0000486 3300046492 Bacteria 37724
315 Ga0495585_0002878 3300046492 Bacteria 11968
316 Ga0495585_0004384 3300046492 Bacteria 9162
317 Ga0495585_0046779 3300046492 Bacteria 2411
318 Ga0495585_0048301 3300046492 Bacteria 2366
319 Ga0495585_0106325 3300046492 Bacteria 1496
320 Ga0495594_0001143 3300046499 Bacteria 13853
321 Ga0495594_0024171 3300046499 Bacteria 3261
322 Ga0495594_0062918 3300046499 Bacteria 2055
323 Ga0495594_0076177 3300046499 Bacteria 1870
324 Ga0495594_0148906 3300046499 Bacteria 1328
325 Ga0495596_0000106 3300046500 Bacteria 59325
326 Ga0495596_0000424 3300046500 Bacteria 27006
327 Ga0495596_0001138 3300046500 Bacteria 15633
328 Ga0495596_0001319 3300046500 Bacteria 14292
329 Ga0495596_0006923 3300046500 Bacteria 5163
330 Ga0495596_0014663 3300046500 Bacteria 3299
331 Ga0495596_0018568 3300046500 Bacteria 2864
332 Ga0495596_0020523 3300046500 Bacteria 2704
333 Ga0495596_0075812 3300046500 Bacteria 1306
334 Ga0495607_0001405 3300046501 Bacteria 21429
335 Ga0495607_0001669 3300046501 Bacteria 19202
336 Ga0495607_0002038 3300046501 Bacteria 16919
337 Ga0495607_0005509 3300046501 Bacteria 9041
338 Ga0495607_0006690 3300046501 Bacteria 8074
339 Ga0495607_0006835 3300046501 Bacteria 7961
340 Ga0495607_0058664 3300046501 Bacteria 2199
341 Ga0495583_0000006 3300046506 Bacteria 436893
342 Ga0495583_0000095 3300046506 Bacteria 152114
343 Ga0495583_0000117 3300046506 Bacteria 135061
344 Ga0495583_0000381 3300046506 Bacteria 68754
345 Ga0495583_0000551 3300046506 Bacteria 52385
346 Ga0495583_0004237 3300046506 Bacteria 10405
347 Ga0495583_0008753 3300046506 Bacteria 6141
348 Ga0495583_0011133 3300046506 Bacteria 5183
349 Ga0495583_0015640 3300046506 Bacteria 4116
350 Ga0495583_0029846 3300046506 Bacteria 2663
351 Ga0495583_0046412 3300046506 Bacteria 2003
352 Ga0495583_0113016 3300046506 Bacteria 1149
353 Ga0495606_0000125 3300046507 Bacteria 130102
354 Ga0495606_0000128 3300046507 Bacteria 128179
355 Ga0495606_0000557 3300046507 Bacteria 59505
356 Ga0495606_0001131 3300046507 Bacteria 38024
357 Ga0495606_0001352 3300046507 Bacteria 33283
358 Ga0495606_0005861 3300046507 Bacteria 11582
359 Ga0495606_0007239 3300046507 Bacteria 9999
360 Ga0495606_0022454 3300046507 Bacteria 4597
361 Ga0495606_0042627 3300046507 Bacteria 3033
362 Ga0495606_0050520 3300046507 Bacteria 2720
363 Ga0495606_0164429 3300046507 Bacteria 1292
364 Ga0495608_0253561 3300046511 Bacteria 1097
365 Ga0495610_0000008 3300046512 Bacteria 622732
366 Ga0495610_0002638 3300046512 Bacteria 14832
367 Ga0495610_0005058 3300046512 Bacteria 9508
368 Ga0495610_0009097 3300046512 Bacteria 6328
369 Ga0495610_0009298 3300046512 Bacteria 6230
370 Ga0495610_0107015 3300046512 Bacteria 1244
371 Ga0495616_0000075 3300046513 Bacteria 84686
372 Ga0495616_0000170 3300046513 Bacteria 56058
373 Ga0495616_0000902 3300046513 Bacteria 21420
374 Ga0495616_0001358 3300046513 Bacteria 17066
375 Ga0495616_0003193 3300046513 Bacteria 10572
376 Ga0495616_0005436 3300046513 Bacteria 7841
377 Ga0495616_0008471 3300046513 Bacteria 6090
378 Ga0495616_0011720 3300046513 Bacteria 5010
379 Ga0495620_0098836 3300046515 Bacteria 1165
380 Ga0495628_0096240 3300046516 Bacteria 2287
381 Ga0495630_0093605 3300046517 Bacteria 2271
382 Ga0495630_0099341 3300046517 Bacteria 2202
383 Ga0495631_0000417 3300046518 Bacteria 29338
384 Ga0495631_0002592 3300046518 Bacteria 10111
385 Ga0495631_0005682 3300046518 Bacteria 6506
386 Ga0495631_0007774 3300046518 Bacteria 5440
387 Ga0495631_0013672 3300046518 Bacteria 3933
388 Ga0495631_0014256 3300046518 Bacteria 3840
389 Ga0495631_0017463 3300046518 Bacteria 3394
390 Ga0495631_0024430 3300046518 Bacteria 2790
391 Ga0495631_0059670 3300046518 Bacteria 1656
392 Ga0495632_0000057 3300046519 Bacteria 123635
393 Ga0495632_0000091 3300046519 Bacteria 93600
394 Ga0495632_0000201 3300046519 Bacteria 60697
395 Ga0495632_0000358 3300046519 Bacteria 43419
396 Ga0495632_0025745 3300046519 Bacteria 3108
397 Ga0495637_0000067 3300046520 Bacteria 86002
398 Ga0495643_0000022 3300046522 Bacteria 289691
399 Ga0495643_0000065 3300046522 Bacteria 179031
400 Ga0495643_0000094 3300046522 Bacteria 150795
401 Ga0495643_0000326 3300046522 Bacteria 65454
402 Ga0495643_0001487 3300046522 Bacteria 21325
403 Ga0495643_0007451 3300046522 Bacteria 7049
404 Ga0495643_0014799 3300046522 Bacteria 4632
405 Ga0495643_0041640 3300046522 Bacteria 2504
406 Ga0495643_0073832 3300046522 Bacteria 1787
407 Ga0495643_0132751 3300046522 Bacteria 1248
408 Ga0495644_0007237 3300046523 Bacteria 4290
409 Ga0495644_0036002 3300046523 Bacteria 1867
410 Ga0495644_0056542 3300046523 Bacteria 1474
411 Ga0495644_0088409 3300046523 Bacteria 1168
412 Ga0495648_0000011 3300046524 Bacteria 299518
413 Ga0495648_0000078 3300046524 Bacteria 127397
414 Ga0495648_0000883 3300046524 Bacteria 31505
415 Ga0495648_0000928 3300046524 Bacteria 30479
416 Ga0495648_0002119 3300046524 Bacteria 18687
417 Ga0495648_0012722 3300046524 Bacteria 6254
418 Ga0495648_0016036 3300046524 Bacteria 5410
419 Ga0495648_0021870 3300046524 Bacteria 4417
420 Ga0495648_0043528 3300046524 Bacteria 2813
421 Ga0495648_0057531 3300046524 Bacteria 2331
422 Ga0495663_0001726 3300046525 Bacteria 6785
423 Ga0495663_0043871 3300046525 Bacteria 1367
424 Ga0495663_0057552 3300046525 Bacteria 1216
425 Ga0495666_0000160 3300046526 Bacteria 28558
426 Ga0495666_0000267 3300046526 Bacteria 22575
427 Ga0495666_0008547 3300046526 Bacteria 5132
428 Ga0495666_0017645 3300046526 Bacteria 3553
429 Ga0495666_0064778 3300046526 Bacteria 1744
430 Ga0495642_0000012 3300046528 Bacteria 127229
431 Ga0495642_0000128 3300046528 Bacteria 43466
432 Ga0495642_0000439 3300046528 Bacteria 21933
433 Ga0495642_0000919 3300046528 Bacteria 13828
434 Ga0495642_0003382 3300046528 Bacteria 6297
435 Ga0495642_0006493 3300046528 Bacteria 4487
436 Ga0495642_0009466 3300046528 Bacteria 3728
437 Ga0495642_0012229 3300046528 Bacteria 3307
438 Ga0495642_0018438 3300046528 Bacteria 2732
439 Ga0495642_0023585 3300046528 Bacteria 2429
440 Ga0495642_0026918 3300046528 Bacteria 2286
441 Ga0495642_0030434 3300046528 Bacteria 2159
442 Ga0495642_0096280 3300046528 Bacteria 1256
443 Ga0495652_0058522 3300046529 Bacteria 3262
444 Ga0495654_0000002 3300046530 Bacteria 1021205
445 Ga0495654_0010283 3300046530 Bacteria 5094
446 Ga0495654_0023750 3300046530 Bacteria 3173
447 Ga0495654_0028268 3300046530 Bacteria 2868
448 Ga0495654_0032205 3300046530 Bacteria 2658
449 Ga0495654_0072958 3300046530 Bacteria 1624
450 Ga0495654_0078306 3300046530 Bacteria 1554
451 Ga0495665_0003469 3300046531 Bacteria 8556
452 Ga0495665_0018914 3300046531 Bacteria 3702
453 Ga0495665_0039773 3300046531 Bacteria 2504
454 Ga0495640_0148636 3300046533 Bacteria 1506
455 Ga0495586_0016175 3300046535 Bacteria 3968
456 Ga0495586_0021113 3300046535 Bacteria 3469
457 Ga0495586_0108193 3300046535 Bacteria 1546
458 Ga0495586_0128037 3300046535 Bacteria 1421
459 Ga0495587_0014738 3300046536 Bacteria 4896
460 Ga0495609_0000001 3300046538 Bacteria 1060094
461 Ga0495609_0001621 3300046538 Bacteria 14679
462 Ga0495609_0002680 3300046538 Bacteria 10766
463 Ga0495609_0004160 3300046538 Bacteria 8036
464 Ga0495609_0005651 3300046538 Bacteria 6517
465 Ga0495609_0007380 3300046538 Bacteria 5497
466 Ga0495609_0013816 3300046538 Bacteria 3806
467 Ga0495609_0019974 3300046538 Bacteria 3097
468 Ga0495609_0034566 3300046538 Bacteria 2291
469 Ga0495609_0039085 3300046538 Bacteria 2137
470 Ga0495609_0055489 3300046538 Bacteria 1757
471 Ga0495609_0072809 3300046538 Bacteria 1508
472 Ga0495609_0078055 3300046538 Bacteria 1449
473 Ga0495609_0101599 3300046538 Bacteria 1245
474 Ga0495597_0000009 3300046542 Bacteria 227319
475 Ga0495597_0000029 3300046542 Bacteria 136312
476 Ga0495597_0000107 3300046542 Bacteria 73749
477 Ga0495597_0000335 3300046542 Bacteria 42105
478 Ga0495597_0000466 3300046542 Bacteria 34350
479 Ga0495597_0003120 3300046542 Bacteria 9945
480 Ga0495597_0008860 3300046542 Bacteria 5018
481 Ga0495597_0011431 3300046542 Bacteria 4303
482 Ga0495597_0029264 3300046542 Bacteria 2515
483 Ga0495597_0067704 3300046542 Bacteria 1544
484 Ga0495645_0101123 3300046543 Bacteria 2050
485 Ga0495622_0000043 3300046557 Bacteria 115796
486 Ga0495622_0001191 3300046557 Bacteria 13432
487 Ga0495622_0011143 3300046557 Bacteria 4150
488 Ga0495622_0019628 3300046557 Bacteria 3147
489 Ga0495633_0000381 3300046558 Bacteria 47007
490 Ga0495633_0000577 3300046558 Bacteria 35551
491 Ga0495633_0001135 3300046558 Bacteria 21402
492 Ga0495633_0001381 3300046558 Bacteria 18966
493 Ga0495633_0003447 3300046558 Bacteria 10518
494 Ga0495633_0006010 3300046558 Bacteria 7293
495 Ga0495633_0006135 3300046558 Bacteria 7194
496 Ga0495633_0007174 3300046558 Bacteria 6460
497 Ga0495633_0012130 3300046558 Bacteria 4601
498 Ga0495633_0014246 3300046558 Bacteria 4164
499 Ga0495633_0016160 3300046558 Bacteria 3856
500 Ga0495633_0038540 3300046558 Bacteria 2282
501 Ga0495633_0041795 3300046558 Bacteria 2179
502 Ga0495656_0033049 3300046615 Bacteria 2109
503 Ga0495656_0062651 3300046615 Bacteria 1627
504 Ga0495668_0000006 3300046616 Bacteria 553404
505 Ga0495668_0000027 3300046616 Bacteria 297194
506 Ga0495668_0000096 3300046616 Bacteria 139693
507 Ga0495668_0000180 3300046616 Bacteria 94157
508 Ga0495668_0000429 3300046616 Bacteria 54505
509 Ga0495668_0001010 3300046616 Bacteria 30202
510 Ga0495668_0001031 3300046616 Bacteria 29510
511 Ga0495668_0001648 3300046616 Bacteria 20817
512 Ga0495668_0003280 3300046616 Bacteria 12289
513 Ga0495668_0006316 3300046616 Bacteria 7797
514 Ga0495668_0007037 3300046616 Bacteria 7257
515 Ga0495668_0016242 3300046616 Bacteria 4327
516 Ga0495668_0032675 3300046616 Bacteria 2926
517 Ga0495668_0035888 3300046616 Bacteria 2779
518 Ga0495668_0037133 3300046616 Bacteria 2727
519 Ga0495668_0042122 3300046616 Bacteria 2542
520 Ga0495668_0066935 3300046616 Bacteria 1976
521 Ga0495668_0084778 3300046616 Bacteria 1737
522 Ga0495668_0095069 3300046616 Bacteria 1631
523 Ga0495668_0121559 3300046616 Bacteria 1428
524 Ga0495634_0022518 3300046642 Bacteria 4439
525 Ga0495611_0000437 3300046648 Bacteria 25695
526 Ga0495611_0008801 3300046648 Bacteria 4270
527 Ga0495611_0012180 3300046648 Bacteria 3655
528 Ga0495611_0013380 3300046648 Bacteria 3493
529 Ga0495611_0014600 3300046648 Bacteria 3358
530 Ga0495611_0044894 3300046648 Bacteria 1977
531 Ga0495611_0060529 3300046648 Bacteria 1720
532 Ga0495611_0120645 3300046648 Bacteria 1222
533 Ga0495625_0000053 3300046660 Bacteria 190575
534 Ga0495625_0002139 3300046660 Bacteria 21993
535 Ga0495625_0008684 3300046660 Bacteria 8631
536 Ga0495625_0009670 3300046660 Bacteria 8036
537 Ga0495625_0009909 3300046660 Bacteria 7924
538 Ga0495625_0018522 3300046660 Bacteria 5433
539 Ga0495625_0025290 3300046660 Bacteria 4504
540 Ga0495625_0047439 3300046660 Bacteria 3097
541 Ga0495625_0050151 3300046660 Bacteria 2996
542 Ga0495625_0054292 3300046660 Bacteria 2862
543 Ga0495625_0088900 3300046660 Bacteria 2139
544 Ga0495625_0098309 3300046660 Bacteria 2013
545 Ga0495625_0206796 3300046660 Bacteria 1292
546 Ga0495659_0000001 3300046664 Bacteria 325846
547 Ga0495659_0017668 3300046664 Bacteria 2367
548 Ga0495661_0000023 3300046665 Bacteria 189053
549 Ga0495661_0000148 3300046665 Bacteria 81610
550 Ga0495661_0000287 3300046665 Bacteria 57151
551 Ga0495661_0003345 3300046665 Bacteria 11883
552 Ga0495661_0004688 3300046665 Bacteria 9819
553 Ga0495661_0025832 3300046665 Bacteria 3788
554 Ga0495661_0033305 3300046665 Bacteria 3251
555 Ga0495661_0049687 3300046665 Bacteria 2542
556 Ga0495661_0051076 3300046665 Bacteria 2498
557 Ga0495661_0057062 3300046665 Bacteria 2333
558 Ga0495661_0061447 3300046665 Bacteria 2230
559 Ga0495661_0102466 3300046665 Bacteria 1609
560 Ga0495661_0174753 3300046665 Bacteria 1142
561 Ga0495588_0000041 3300046674 Bacteria 377896
562 Ga0495588_0003113 3300046674 Bacteria 7178
563 Ga0495588_0020102 3300046674 Bacteria 3276
564 Ga0495588_0094174 3300046674 Bacteria 1570
565 Ga0495588_0136839 3300046674 Bacteria 1293
566 Ga0495588_0161383 3300046674 Bacteria 1185
567 Ga0495623_0010749 3300046679 Bacteria 5926
568 Ga0495623_0051175 3300046679 Bacteria 2614
569 Ga0495623_0070655 3300046679 Bacteria 2174
570 Ga0495646_0081670 3300046680 Bacteria 1883
571 Ga0495646_0108020 3300046680 Bacteria 1587
572 Ga0495658_0002916 3300046683 Bacteria 8587
573 Ga0495669_0000017 3300046684 Bacteria 131447
574 Ga0495669_0000429 3300046684 Bacteria 19950
575 Ga0495669_0000484 3300046684 Bacteria 18421
576 Ga0495669_0009083 3300046684 Bacteria 4189
577 Ga0495613_0016878 3300046689 Bacteria 5436
578 Ga0495624_0006051 3300046690 Bacteria 8629
579 Ga0495670_0000122 3300046691 Bacteria 33678
580 Ga0495670_0001433 3300046691 Bacteria 11688
581 Ga0495670_0001786 3300046691 Bacteria 10557
582 Ga0495670_0010563 3300046691 Bacteria 4538
583 Ga0495670_0019050 3300046691 Bacteria 3382
584 Ga0495670_0036181 3300046691 Bacteria 2460
585 Ga0495670_0036802 3300046691 Bacteria 2439
586 Ga0495670_0086930 3300046691 Bacteria 1597
587 Ga0495670_0117606 3300046691 Bacteria 1379
588 Ga0495671_0000002 3300046692 Bacteria 1136189
589 Ga0495671_0000035 3300046692 Bacteria 188543
590 Ga0495671_0000140 3300046692 Bacteria 63602
591 Ga0495671_0002321 3300046692 Bacteria 12087
592 Ga0495671_0009573 3300046692 Bacteria 5408
593 Ga0495671_0016243 3300046692 Bacteria 3978
594 Ga0495671_0047593 3300046692 Bacteria 2142
595 Ga0495671_0048524 3300046692 Bacteria 2118
596 Ga0495649_0002789 3300046694 Bacteria 12166
597 Ga0495649_0028441 3300046694 Bacteria 3098
598 Ga0495589_0000027 3300046794 Bacteria 181084
599 Ga0495589_0000102 3300046794 Bacteria 82380
600 Ga0495589_0000600 3300046794 Bacteria 24459
601 Ga0495589_0003377 3300046794 Bacteria 8654
602 Ga0495589_0005590 3300046794 Bacteria 6629
603 Ga0495589_0016821 3300046794 Bacteria 3755
604 Ga0495589_0040644 3300046794 Bacteria 2321
605 Ga0495589_0114346 3300046794 Bacteria 1301
606 Ga0495600_0047066 3300046809 Bacteria 2813
607 Ga0495660_0000069 3300046810 Bacteria 115654
608 Ga0495660_0000132 3300046810 Bacteria 81849
609 Ga0495660_0001231 3300046810 Bacteria 17853
610 Ga0495660_0003475 3300046810 Bacteria 9727
611 Ga0495660_0018729 3300046810 Bacteria 3976
612 Ga0495660_0022256 3300046810 Bacteria 3619
613 Ga0495660_0025019 3300046810 Bacteria 3393
614 Ga0495660_0031928 3300046810 Bacteria 2958
615 Ga0495660_0036753 3300046810 Bacteria 2730
616 Ga0495660_0056861 3300046810 Bacteria 2112
617 Ga0495660_0080464 3300046810 Bacteria 1709
618 Ga0495660_0182145 3300046810 Bacteria 1015
619 Ga0495581_0004532 3300047315 Bacteria 8026
620 Ga0495581_0043781 3300047315 Bacteria 2589
621 Ga0495604_0019344 3300047317 Bacteria 5451
622 Ga0495604_0050325 3300047317 Bacteria 3235
623 Ga0495636_0003615 3300047318 Bacteria 5997
624 Ga0495636_0004270 3300047318 Bacteria 5605
625 Ga0495636_0011926 3300047318 Bacteria 3444
626 Ga0495674_0002798 3300047319 Bacteria 16935
627 Ga0495672_0000022 3300047320 Bacteria 420632
628 Ga0495672_0000066 3300047320 Bacteria 193318
629 Ga0495672_0000095 3300047320 Bacteria 143883
630 Ga0495672_0000231 3300047320 Bacteria 79748
631 Ga0495672_0003237 3300047320 Bacteria 14136
632 Ga0495672_0005035 3300047320 Bacteria 10569
633 Ga0495672_0022297 3300047320 Bacteria 4119
634 Ga0495676_0000017 3300047321 Bacteria 181815
635 Ga0495676_0033969 3300047321 Bacteria 4285
636 Ga0495676_0074145 3300047321 Bacteria 2607
637 Ga0495680_0006458 3300047322 Bacteria 10889
638 Ga0495680_0134329 3300047322 Bacteria 1815
639 Ga0495683_0000005 3300047323 Bacteria 287871
640 Ga0495683_0105998 3300047323 Bacteria 1347
641 Ga0495683_0130721 3300047323 Bacteria 1184
642 Ga0495687_000023 3300047443 Bacteria 317750
643 Ga0495687_000027 3300047443 Bacteria 299689
644 Ga0495687_000034 3300047443 Bacteria 257321
645 Ga0495687_000048 3300047443 Bacteria 205967
646 Ga0495687_000524 3300047443 Bacteria 45771
647 Ga0495687_001158 3300047443 Bacteria 25533
648 Ga0495687_002491 3300047443 Bacteria 14686
649 Ga0495687_035282 3300047443 Bacteria 2250
650 Ga0495675_0009439 3300047444 Bacteria 6070
651 Ga0495675_0026728 3300047444 Bacteria 3680
652 Ga0495677_0000001 3300047445 Bacteria 715000
653 Ga0495677_0000067 3300047445 Bacteria 55897
654 Ga0495677_0000677 3300047445 Bacteria 13782
655 Ga0495677_0005267 3300047445 Bacteria 4916
656 Ga0495677_0005773 3300047445 Bacteria 4686
657 Ga0495677_0005839 3300047445 Bacteria 4659
658 Ga0495677_0005940 3300047445 Bacteria 4624
659 Ga0495677_0011590 3300047445 Bacteria 3223
660 Ga0495677_0014975 3300047445 Bacteria 2820
661 Ga0495677_0039007 3300047445 Bacteria 1736
662 Ga0495679_004242 3300047446 Bacteria 6661
663 Ga0495679_005144 3300047446 Bacteria 5860
664 Ga0495679_006136 3300047446 Bacteria 5231
665 Ga0495679_006944 3300047446 Bacteria 4797
666 Ga0495679_021023 3300047446 Bacteria 2263
667 Ga0495685_009304 3300047447 Bacteria 3278
668 Ga0495685_014627 3300047447 Bacteria 2668
669 Ga0495685_051605 3300047447 Bacteria 1394
670 Ga0495673_0000059 3300047469 Bacteria 233234
671 Ga0495673_0000064 3300047469 Bacteria 225793
672 Ga0495673_0049798 3300047469 Bacteria 1842
673 Ga0495681_0000018 3300047470 Bacteria 177306
674 Ga0495681_0001220 3300047470 Bacteria 19572
675 Ga0495681_0003868 3300047470 Bacteria 10347
676 Ga0495681_0004757 3300047470 Bacteria 9199
677 Ga0495681_0008989 3300047470 Bacteria 6199
678 Ga0495681_0009121 3300047470 Bacteria 6143
679 Ga0495681_0009347 3300047470 Bacteria 6047
680 Ga0495681_0010500 3300047470 Bacteria 5603
681 Ga0495681_0020670 3300047470 Bacteria 3566
682 Ga0495681_0047735 3300047470 Bacteria 2035
683 Ga0495686_0000135 3300047472 Bacteria 148920
684 Ga0495686_0000462 3300047472 Bacteria 61070
685 Ga0495686_0000640 3300047472 Bacteria 48223
686 Ga0495686_0001427 3300047472 Bacteria 26117
687 Ga0495686_0009909 3300047472 Bacteria 6824
688 Ga0495686_0036829 3300047472 Bacteria 3138
689 Ga0495686_0147790 3300047472 Bacteria 1382
690 Ga0495593_0002837 3300047673 Bacteria 10436
691 Ga0495593_0039247 3300047673 Bacteria 2553
692 Ga0495602_0123721 3300048088 Bacteria 2076
693 Ga0495614_0060962 3300048089 Bacteria 1620
694 Ga0495615_0000944 3300048090 Bacteria 4132
695 Ga0495615_0028137 3300048090 Bacteria 1325
696 Ga0495626_0000037 3300048091 Bacteria 178573
697 Ga0495626_0000535 3300048091 Bacteria 37780
698 Ga0495626_0000754 3300048091 Bacteria 29854
699 Ga0495626_0003874 3300048091 Bacteria 9383
700 Ga0495626_0004907 3300048091 Bacteria 8039
701 Ga0495626_0007550 3300048091 Bacteria 6039
702 Ga0495626_0009094 3300048091 Bacteria 5389
703 Ga0495626_0010374 3300048091 Bacteria 4973
704 Ga0495626_0015581 3300048091 Bacteria 3886
705 Ga0495626_0017666 3300048091 Bacteria 3596
706 Ga0495626_0024208 3300048091 Bacteria 2979
707 Ga0495626_0031604 3300048091 Bacteria 2547
708 Ga0495626_0043744 3300048091 Bacteria 2099
709 Ga0495626_0046493 3300048091 Bacteria 2021
710 Ga0495626_0098322 3300048091 Bacteria 1278
711 Ga0496101_0123396 3300048904 Bacteria 1960
712 Ga0496102_0000151 3300048905 Bacteria 94403
713 Ga0496102_0000182 3300048905 Bacteria 84891
714 Ga0496102_0010154 3300048905 Bacteria 8095
715 Ga0496102_0105874 3300048905 Bacteria 2617
716 Ga0496102_0232126 3300048905 Bacteria 1739
717 Ga0496103_0005130 3300048906 Bacteria 7885
718 Ga0496103_0027157 3300048906 Bacteria 3466
719 Ga0496103_0043530 3300048906 Bacteria 2765
720 Ga0496103_0100972 3300048906 Bacteria 1826
721 Ga0496104_0016139 3300048907 Bacteria 6779
722 Ga0496104_0269407 3300048907 Bacteria 1615
723 Ga0496105_0046695 3300048908 Bacteria 3574
724 Ga0496106_0009494 3300048909 Bacteria 7190
725 Ga0496106_0173532 3300048909 Bacteria 1710
726 Ga0496109_0202926 3300048912 Bacteria 1864
727 Ga0496109_0434692 3300048912 Bacteria 1240
728 Ga0496110_0074408 3300048913 Bacteria 3017
729 Ga0496112_0315152 3300048915 Bacteria 1509
730 Ga0496113_0002561 3300048916 Bacteria 10618
731 Ga0496113_0006144 3300048916 Bacteria 7581
732 Ga0496113_0212904 3300048916 Bacteria 1539
733 Ga0496114_0065321 3300048917 Bacteria 3049
734 Ga0496115_0017832 3300048918 Bacteria 5437
735 Ga0496115_0021525 3300048918 Bacteria 4983
736 Ga0496115_0097860 3300048918 Bacteria 2403
737 Ga0496115_0123143 3300048918 Bacteria 2134
738 Ga0496116_0015645 3300048919 Bacteria 5989
739 Ga0496116_0074770 3300048919 Bacteria 2129
740 Ga0496117_0000001 3300048920 Bacteria 2526244
741 Ga0496118_0000002 3300048921 Bacteria 1690764
742 Ga0496121_0007795 3300048924 Bacteria 12820
743 Ga0496121_0011077 3300048924 Bacteria 10062
744 Ga0496121_0305301 3300048924 Bacteria 1078
745 Ga0496122_0000712 3300048925 Bacteria 65645
746 Ga0496122_0003090 3300048925 Bacteria 22393
747 Ga0496122_0013372 3300048925 Bacteria 8035
748 Ga0496122_0014805 3300048925 Bacteria 7515
749 Ga0496122_0075194 3300048925 Bacteria 2385
750 Ga0496123_0000502 3300048926 Bacteria 67921
751 Ga0496123_0005830 3300048926 Bacteria 12218
752 Ga0496123_0020981 3300048926 Bacteria 5091
753 Ga0496123_0065455 3300048926 Bacteria 2310
754 Ga0496124_0003831 3300048927 Bacteria 18028
755 Ga0496124_0012443 3300048927 Bacteria 8400
756 Ga0496124_0029879 3300048927 Bacteria 4848
757 Ga0496124_0065386 3300048927 Bacteria 3033
758 Ga0496124_0132635 3300048927 Bacteria 1977
759 Ga0496124_0180620 3300048927 Bacteria 1624
760 Ga0496124_0220205 3300048927 Bacteria 1428
761 Ga0496125_0017614 3300048928 Bacteria 6805
762 Ga0496125_0034021 3300048928 Bacteria 4498
763 Ga0496125_0213634 3300048928 Bacteria 1250
764 Ga0496126_0030419 3300048929 Bacteria 5115
765 Ga0495678_000100 3300049459 Bacteria 106118
766 Ga0495678_000286 3300049459 Bacteria 55456
767 Ga0495678_000588 3300049459 Bacteria 34196
768 Ga0495678_000705 3300049459 Bacteria 30390
769 Ga0495678_002236 3300049459 Bacteria 13490
770 Ga0495678_003925 3300049459 Bacteria 8916
771 Ga0495682_0000066 3300049460 Bacteria 97829
772 Ga0495682_0001017 3300049460 Bacteria 16630
773 Ga0501222_009165 3300049662 Bacteria 1310
774 Ga0501227_002037 3300049665 Bacteria 4484
775 Ga0501238_002661 3300049671 Bacteria 2151
776 Ga0501249_001440 3300049679 Bacteria 4903
777 Ga0501249_013450 3300049679 Bacteria 1739
778 Ga0501241_012372 3300049758 Bacteria 1551
779 Ga0501269_000423 3300049766 Bacteria 9533
780 Ga0501035_0000866 3300049822 Bacteria 32272
781 Ga0501044_0031874 3300049823 Bacteria 5544
782 Ga0501044_0429043 3300049823 Bacteria 1231
783 Ga0500594_0002295 3300053118 Bacteria 4147
784 Ga0500594_0004222 3300053118 Bacteria 3168
785 Ga0500618_000137 3300053125 Bacteria 61561
786 Ga0500618_009677 3300053125 Bacteria 2622
787 Ga0500559_0000249 3300053136 Bacteria 42713
788 Ga0500586_000227 3300053145 Bacteria 11155
789 Ga0500586_001150 3300053145 Bacteria 5489
790 Ga0500587_001548 3300053739 Bacteria 3270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_1203167 Ga0436360_1203167_20_823 232
2 3300046512 Ga0495610_0000008 Ga0495610_0000008_170659_171435 233
3 3300002739 JGI25158J39367_1006807 JGI25158J39367_10068071 245
4 3300048929 Ga0496126_0030419 Ga0496126_0030419_3597_4427 251
5 3300053118 Ga0500594_0004222 Ga0500594_0004222_461_1291 251
6 3300046471 Ga0495650_0030602 Ga0495650_0030602_71_919 257
7 3300046660 Ga0495625_0206796 Ga0495625_0206796_48_923 266
8 3300046457 Ga0495590_0000837 Ga0495590_0000837_1761_2744 272
9 3300046463 Ga0495653_0035700 Ga0495653_0035700_2443_3510 272
10 3300046680 Ga0495646_0108020 Ga0495646_0108020_178_1245 272
11 3300047322 Ga0495680_0134329 Ga0495680_0134329_218_1339 272
12 3300047445 Ga0495677_0000067 Ga0495677_0000067_41569_42552 272
13 3300048091 Ga0495626_0004907 Ga0495626_0004907_4372_5355 272
14 3300048091 Ga0495626_0009094 Ga0495626_0009094_567_1550 272
15 3300047469 Ga0495673_0000059 Ga0495673_0000059_20112_21071 273
16 3300046538 Ga0495609_0078055 Ga0495609_0078055_32_931 274
17 3300046538 Ga0495609_0101599 Ga0495609_0101599_32_931 274
18 iso_pu_bacteria 2547132103 2547373026 275
19 3300021361 Ga0213872_10000032 Ga0213872_1000003292 278
20 3300039447 Ga0436361_0168778 Ga0436361_0168778_17064_18014 278
21 iso_pu_bacteria 2843690924 2843693368 278
22 iso_pu_bacteria 2919476304 2919480201 280
23 3300046558 Ga0495633_0041795 Ga0495633_0041795_450_1370 281
24 3300005331 Ga0070670_100179593 Ga0070670_1001795932 285
25 3300005333 Ga0070677_10023916 Ga0070677_100239163 285
26 3300005335 Ga0070666_10019569 Ga0070666_100195694 285
27 3300005335 Ga0070666_10187186 Ga0070666_101871862 285
28 3300005338 Ga0068868_100005354 Ga0068868_1000053543 285
29 3300005353 Ga0070669_100034198 Ga0070669_1000341982 285
30 3300005355 Ga0070671_100023446 Ga0070671_1000234463 285
31 3300005356 Ga0070674_100182477 Ga0070674_1001824771 285
32 3300005364 Ga0070673_100000606 Ga0070673_10000060616 285
33 3300005364 Ga0070673_100123979 Ga0070673_1001239792 285
34 3300005367 Ga0070667_100033198 Ga0070667_1000331982 285
35 3300005456 Ga0070678_100001713 Ga0070678_10000171310 285
36 3300005456 Ga0070678_100329196 Ga0070678_1003291962 285
37 3300005459 Ga0068867_100014626 Ga0068867_1000146262 285
38 3300005543 Ga0070672_100096403 Ga0070672_1000964032 285
39 3300005564 Ga0070664_100162879 Ga0070664_1001628794 285
40 3300005617 Ga0068859_100001422 Ga0068859_10000142221 285
41 3300005719 Ga0068861_100035186 Ga0068861_1000351865 285
42 3300005719 Ga0068861_100134371 Ga0068861_1001343712 285
43 3300005841 Ga0068863_100017744 Ga0068863_1000177446 285
44 3300005842 Ga0068858_100003140 Ga0068858_10000314010 285
45 3300005844 Ga0068862_100044143 Ga0068862_1000441435 285
46 3300006237 Ga0097621_100085920 Ga0097621_1000859203 285
47 3300006358 Ga0068871_100002105 Ga0068871_1000021058 285
48 3300006931 Ga0097620_100001422 Ga0097620_1000014222 285
49 3300009148 Ga0105243_10076171 Ga0105243_100761713 285
50 3300009177 Ga0105248_10065661 Ga0105248_100656613 285
51 3300013296 Ga0157374_10439844 Ga0157374_104398442 285
52 3300013306 Ga0163162_10017462 Ga0163162_100174628 285
53 3300013306 Ga0163162_10147621 Ga0163162_101476212 285
54 3300013308 Ga0157375_10231092 Ga0157375_102310922 285
55 3300014325 Ga0163163_10015841 Ga0163163_100158416 285
56 3300014326 Ga0157380_10049131 Ga0157380_100491315 285
57 3300014969 Ga0157376_10126687 Ga0157376_101266873 285
58 3300017792 Ga0163161_10060543 Ga0163161_100605432 285
59 3300025315 Ga0207697_10040931 Ga0207697_100409311 285
60 3300025893 Ga0207682_10005733 Ga0207682_100057334 285
61 3300025893 Ga0207682_10006232 Ga0207682_100062326 285
62 3300025903 Ga0207680_10002181 Ga0207680_100021816 285
63 3300025907 Ga0207645_10119665 Ga0207645_101196652 285
64 3300025909 Ga0207705_10183385 Ga0207705_101833852 285
65 3300025923 Ga0207681_10015030 Ga0207681_100150304 285
66 3300025931 Ga0207644_10014885 Ga0207644_100148853 285
67 3300025935 Ga0207709_10054405 Ga0207709_100544052 285
68 3300025937 Ga0207669_10123980 Ga0207669_101239802 285
69 3300025940 Ga0207691_10088615 Ga0207691_100886152 285
70 3300025940 Ga0207691_10111128 Ga0207691_101111281 285
71 3300025941 Ga0207711_10027897 Ga0207711_100278974 285
72 3300025960 Ga0207651_10031915 Ga0207651_100319152 285
73 3300026023 Ga0207677_10002910 Ga0207677_100029107 285
74 3300026035 Ga0207703_10007134 Ga0207703_100071346 285
75 3300026088 Ga0207641_10004402 Ga0207641_1000440210 285
76 3300026088 Ga0207641_10218363 Ga0207641_102183633 285
77 3300026089 Ga0207648_10119713 Ga0207648_101197133 285
78 3300026089 Ga0207648_10170142 Ga0207648_101701422 285
79 3300026095 Ga0207676_10003508 Ga0207676_100035088 285
80 3300026118 Ga0207675_100010028 Ga0207675_1000100282 285
81 3300026118 Ga0207675_100175568 Ga0207675_1001755682 285
82 3300026121 Ga0207683_10006519 Ga0207683_100065192 285
83 3300026121 Ga0207683_10355145 Ga0207683_103551452 285
84 3300028380 Ga0268265_10081584 Ga0268265_100815844 285
85 3300035092 Ga0373952_0002402 Ga0373952_0002402_1650_2606 285
86 3300037471 Ga0395905_0059785 Ga0395905_0059785_297_1247 285
87 3300037471 Ga0395905_0149117 Ga0395905_0149117_81_1043 285
88 3300046460 Ga0495638_0020283 Ga0495638_0020283_1617_2567 285
89 3300046515 Ga0495620_0098836 Ga0495620_0098836_121_1071 285
90 3300046538 Ga0495609_0004160 Ga0495609_0004160_6648_7589 285
91 3300046810 Ga0495660_0001231 Ga0495660_0001231_8686_9627 285
92 3300048907 Ga0496104_0016139 Ga0496104_0016139_4899_5852 285
93 3300048908 Ga0496105_0046695 Ga0496105_0046695_1902_2855 285
94 3300048912 Ga0496109_0202926 Ga0496109_0202926_310_1287 285
95 3300053136 Ga0500559_0000249 Ga0500559_0000249_30114_31064 285
96 3300053739 Ga0500587_001548 Ga0500587_001548_1404_2354 285
97 3300028379 Ga0268266_10187480 Ga0268266_101874802 286
98 3300035692 Ga0373935_0161480 Ga0373935_0161480_323_1288 286
99 3300046516 Ga0495628_0096240 Ga0495628_0096240_866_1831 286
100 3300046533 Ga0495640_0148636 Ga0495640_0148636_315_1280 286
101 3300046683 Ga0495658_0002916 Ga0495658_0002916_7220_8185 286
102 iso_pu_bacteria 2846033681 2846035068 286
103 iso_pu_bacteria 2857553236 2857558217 286
104 3300046492 Ga0495585_0002878 Ga0495585_0002878_5877_6815 287
105 3300046530 Ga0495654_0032205 Ga0495654_0032205_1091_2029 287
106 3300047443 Ga0495687_000034 Ga0495687_000034_256232_257188 287
107 3300002774 JGI25150J39212_1001739 JGI25150J39212_10017392 288
108 3300003323 rootH1_10094760 rootH1_100947604 288
109 3300003771 Ga0055526_1000048 Ga0055526_100004837 288
110 3300005618 Ga0068864_100401147 Ga0068864_1004011472 288
111 3300009176 Ga0105242_10091014 Ga0105242_100910143 288
112 3300025245 Ga0207425_1000132 Ga0207425_100013232 288
113 3300025294 Ga0209025_1006230 Ga0209025_10062306 288
114 3300025295 Ga0209564_1000007 Ga0209564_1000007316 288
115 3300025297 Ga0209758_1000757 Ga0209758_100075719 288
116 3300025918 Ga0207662_10012947 Ga0207662_100129474 288
117 3300037471 Ga0395905_0055941 Ga0395905_0055941_151_1119 288
118 3300039447 Ga0436361_0993359 Ga0436361_0993359_41071_42012 288
119 3300046460 Ga0495638_0056006 Ga0495638_0056006_395_1336 288
120 3300046507 Ga0495606_0000125 Ga0495606_0000125_83208_84149 288
121 3300046542 Ga0495597_0000107 Ga0495597_0000107_68052_68993 288
122 3300046558 Ga0495633_0038540 Ga0495633_0038540_338_1279 288
123 3300046616 Ga0495668_0000027 Ga0495668_0000027_45888_46829 288
124 3300047472 Ga0495686_0036829 Ga0495686_0036829_1338_2279 288
125 3300048927 Ga0496124_0180620 Ga0496124_0180620_303_1244 288
126 iso_pu_bacteria 2857547612 2857550097 288
127 iso_pu_bacteria 2932416698 2932418947 288
128 3300005293 Ga0065715_10226472 Ga0065715_102264721 289
129 3300005719 Ga0068861_100514437 Ga0068861_1005144372 289
130 3300046506 Ga0495583_0011133 Ga0495583_0011133_112_1080 289
131 3300048905 Ga0496102_0010154 Ga0496102_0010154_4808_5776 289
132 3300048905 Ga0496102_0105874 Ga0496102_0105874_291_1268 289
133 iso_pu_bacteria 2643221556 2643799142 289
134 iso_pu_bacteria 2643221684 2644473527 289
135 iso_pu_bacteria 2808606418 2809142964 289
136 iso_pu_bacteria 8047673197 8047679258 289
137 3300014497 Ga0182008_10004711 Ga0182008_100047116 290
138 3300015261 Ga0182006_1000029 Ga0182006_1000029127 290
139 3300015262 Ga0182007_10000997 Ga0182007_1000099717 290
140 3300015265 Ga0182005_1000012 Ga0182005_100001273 290
141 3300017792 Ga0163161_10110159 Ga0163161_101101592 290
142 3300027111 Ga0209281_1003014 Ga0209281_10030142 290
143 3300044684 Ga0466966_0019594 Ga0466966_0019594_2990_3970 290
144 3300044693 Ga0466961_0009150 Ga0466961_0009150_763_1743 290
145 3300046511 Ga0495608_0253561 Ga0495608_0253561_30_998 290
146 3300046810 Ga0495660_0000069 Ga0495660_0000069_64372_65334 290
147 3300048919 Ga0496116_0015645 Ga0496116_0015645_2096_3058 290
148 3300048925 Ga0496122_0013372 Ga0496122_0013372_2160_3122 290
149 3300048926 Ga0496123_0065455 Ga0496123_0065455_1207_2169 290
150 3300048927 Ga0496124_0065386 Ga0496124_0065386_192_1154 290
151 3300048928 Ga0496125_0034021 Ga0496125_0034021_1282_2244 290
152 3300049459 Ga0495678_002236 Ga0495678_002236_7115_8077 290
153 iso_pu_bacteria 2643221554 2643792135 290
154 iso_pu_bacteria 2643221638 2644212112 290
155 iso_pu_bacteria 2643221645 2644251528 290
156 iso_pu_bacteria 2643221664 2644357398 290
157 iso_pu_bacteria 2738541280 2738739989 290
158 iso_pu_bacteria 2738541297 2738828589 290
159 iso_pu_bacteria 2738541300 2738844256 290
160 iso_pu_bacteria 2738541357 2739152385 290
161 iso_pu_bacteria 2738543003 2739194305 290
162 iso_pu_bacteria 2738543018 2739274184 290
163 iso_pu_bacteria 2738543026 2739320781 290
164 iso_pu_bacteria 2738543029 2739339022 290
165 iso_pu_bacteria 2738543030 2739343228 290
166 iso_pu_bacteria 2842711865 2842717562 290
167 iso_pu_bacteria 2857558681 2857564517 290
168 iso_pu_bacteria 2904424332 2904427031 290
169 3300015265 Ga0182005_1000002 Ga0182005_1000002316 291
170 3300031548 Ga0307408_100003316 Ga0307408_1000033167 291
171 3300032004 Ga0307414_10003286 Ga0307414_100032862 291
172 3300037471 Ga0395905_0015250 Ga0395905_0015250_2756_3763 291
173 3300046453 Ga0495627_000057 Ga0495627_000057_26189_27181 291
174 3300046506 Ga0495583_0000117 Ga0495583_0000117_115475_116440 291
175 3300046507 Ga0495606_0000128 Ga0495606_0000128_42757_43707 291
176 3300046558 Ga0495633_0007174 Ga0495633_0007174_145_1107 291
177 3300048906 Ga0496103_0005130 Ga0496103_0005130_2259_3254 291
178 3300048919 Ga0496116_0074770 Ga0496116_0074770_236_1228 291
179 3300048920 Ga0496117_0000001 Ga0496117_0000001_1222657_1223619 291
180 3300048921 Ga0496118_0000002 Ga0496118_0000002_1222657_1223619 291
181 3300048924 Ga0496121_0007795 Ga0496121_0007795_1937_2899 291
182 3300048924 Ga0496121_0011077 Ga0496121_0011077_9081_10043 291
183 iso_pu_bacteria 8055225921 8055229116 291
184 3300042128 Ga0450897_001616 Ga0450897_001616_95_1060 292
185 3300044765 Ga0466970_0095349 Ga0466970_0095349_264_1217 292
186 3300045051 Ga0451576_0017483 Ga0451576_0017483_5442_6452 292
187 3300046459 Ga0495629_0035318 Ga0495629_0035318_1191_2162 292
188 3300046471 Ga0495650_0000044 Ga0495650_0000044_251518_252483 292
189 3300046474 Ga0495605_0062472 Ga0495605_0062472_81_1052 292
190 3300046500 Ga0495596_0001319 Ga0495596_0001319_7803_8774 292
191 3300046507 Ga0495606_0042627 Ga0495606_0042627_772_1734 292
192 3300046519 Ga0495632_0000057 Ga0495632_0000057_53960_54967 292
193 3300046522 Ga0495643_0041640 Ga0495643_0041640_75_1028 292
194 3300046524 Ga0495648_0021870 Ga0495648_0021870_2242_3198 292
195 3300046528 Ga0495642_0012229 Ga0495642_0012229_276_1247 292
196 3300046528 Ga0495642_0030434 Ga0495642_0030434_275_1240 292
197 3300046530 Ga0495654_0072958 Ga0495654_0072958_122_1093 292
198 3300046538 Ga0495609_0034566 Ga0495609_0034566_1116_2087 292
199 3300046557 Ga0495622_0011143 Ga0495622_0011143_116_1087 292
200 3300046558 Ga0495633_0014246 Ga0495633_0014246_574_1545 292
201 3300046616 Ga0495668_0121559 Ga0495668_0121559_162_1133 292
202 3300046660 Ga0495625_0098309 Ga0495625_0098309_876_1847 292
203 3300046674 Ga0495588_0003113 Ga0495588_0003113_1656_2627 292
204 3300046684 Ga0495669_0000017 Ga0495669_0000017_41877_42848 292
205 3300046794 Ga0495589_0003377 Ga0495589_0003377_894_1865 292
206 3300047320 Ga0495672_0000231 Ga0495672_0000231_52896_53870 292
207 3300047321 Ga0495676_0000017 Ga0495676_0000017_31875_32846 292
208 3300047445 Ga0495677_0005940 Ga0495677_0005940_2679_3650 292
209 3300047447 Ga0495685_051605 Ga0495685_051605_155_1126 292
210 3300047472 Ga0495686_0001427 Ga0495686_0001427_12791_13777 292
211 3300048088 Ga0495602_0123721 Ga0495602_0123721_1032_2006 292
212 3300048089 Ga0495614_0060962 Ga0495614_0060962_69_1040 292
213 3300049662 Ga0501222_009165 Ga0501222_009165_162_1124 292
214 3300049665 Ga0501227_002037 Ga0501227_002037_433_1395 292
215 3300049823 Ga0501044_0429043 Ga0501044_0429043_211_1191 292
216 3300002987 JGI25159J45721_1003493 JGI25159J45721_10034936 293
217 3300003322 rootL2_10030442 rootL2_100304422 293
218 3300003322 rootL2_10030453 rootL2_100304533 293
219 3300003771 Ga0055526_1000934 Ga0055526_100093419 293
220 3300003773 Ga0055537_1000039 Ga0055537_100003944 293
221 3300003775 Ga0055524_1004427 Ga0055524_10044274 293
222 3300003784 Ga0055534_1000174 Ga0055534_10001749 293
223 3300003790 Ga0055528_1000066 Ga0055528_100006646 293
224 3300004625 Ga0055543_1004521 Ga0055543_10045212 293
225 3300005262 Ga0065165_1000005 Ga0065165_1000005252 293
226 3300005327 Ga0070658_10298854 Ga0070658_102988542 293
227 3300005344 Ga0070661_100028344 Ga0070661_1000283444 293
228 3300005366 Ga0070659_100216032 Ga0070659_1002160322 293
229 3300005563 Ga0068855_100002919 Ga0068855_1000029198 293
230 3300005564 Ga0070664_100125975 Ga0070664_1001259752 293
231 3300005616 Ga0068852_100121583 Ga0068852_1001215833 293
232 3300009551 Ga0105238_10460173 Ga0105238_104601732 293
233 3300013102 Ga0157371_10000026 Ga0157371_10000026126 293
234 3300014497 Ga0182008_10027096 Ga0182008_100270962 293
235 3300015261 Ga0182006_1026492 Ga0182006_10264922 293
236 3300025230 Ga0209563_100003 Ga0209563_100003954 293
237 3300025253 Ga0209677_108796 Ga0209677_1087961 293
238 3300025254 Ga0209148_1005446 Ga0209148_10054463 293
239 3300025263 Ga0209565_1000003 Ga0209565_1000003320 293
240 3300025273 Ga0209673_1000003 Ga0209673_1000003206 293
241 3300025284 Ga0209130_1000084 Ga0209130_100008444 293
242 3300025291 Ga0209675_1000003 Ga0209675_1000003718 293
243 3300025295 Ga0209564_1000012 Ga0209564_1000012526 293
244 3300025299 Ga0209256_1000395 Ga0209256_100039535 293
245 3300025302 Ga0207426_1058678 Ga0207426_10586781 293
246 3300025909 Ga0207705_10001990 Ga0207705_100019908 293
247 3300025909 Ga0207705_10072000 Ga0207705_100720002 293
248 3300025911 Ga0207654_10023184 Ga0207654_100231842 293
249 3300025933 Ga0207706_10080716 Ga0207706_100807162 293
250 3300025945 Ga0207679_10040362 Ga0207679_100403623 293
251 3300025945 Ga0207679_10077164 Ga0207679_100771641 293
252 3300025945 Ga0207679_10199365 Ga0207679_101993652 293
253 3300025949 Ga0207667_10001048 Ga0207667_100010486 293
254 3300026142 Ga0207698_10081845 Ga0207698_100818453 293
255 3300027111 Ga0209281_1005961 Ga0209281_10059613 293
256 3300028794 Ga0307515_10241205 Ga0307515_102412053 293
257 3300037312 Ga0395899_0004735 Ga0395899_0004735_4107_5081 293
258 3300037312 Ga0395899_0005686 Ga0395899_0005686_4868_5842 293
259 3300037312 Ga0395899_0010310 Ga0395899_0010310_1974_2948 293
260 3300037312 Ga0395899_0091327 Ga0395899_0091327_510_1484 293
261 3300037418 Ga0395900_0002091 Ga0395900_0002091_17526_18500 293
262 3300037418 Ga0395900_0003097 Ga0395900_0003097_11547_12521 293
263 3300037418 Ga0395900_0003147 Ga0395900_0003147_6248_7222 293
264 3300037418 Ga0395900_0080938 Ga0395900_0080938_1100_2074 293
265 3300037466 Ga0395898_0011645 Ga0395898_0011645_825_1799 293
266 3300037466 Ga0395898_0017086 Ga0395898_0017086_5359_6333 293
267 3300037466 Ga0395898_0031587 Ga0395898_0031587_821_1795 293
268 3300037466 Ga0395898_0091283 Ga0395898_0091283_1439_2413 293
269 3300037471 Ga0395905_0013949 Ga0395905_0013949_5988_6962 293
270 3300038443 Ga0395901_0000212 Ga0395901_0000212_8604_9578 293
271 3300038443 Ga0395901_0000522 Ga0395901_0000522_25644_26618 293
272 3300038443 Ga0395901_0229464 Ga0395901_0229464_241_1215 293
273 3300042005 Ga0439448_0016603 Ga0439448_0016603_220_1194 293
274 3300042007 Ga0439449_0024840 Ga0439449_0024840_407_1381 293
275 3300042008 Ga0439450_011670 Ga0439450_011670_70_1044 293
276 3300042008 Ga0439450_015579 Ga0439450_015579_14_1174 293
277 3300042008 Ga0439450_043299 Ga0439450_043299_63_1037 293
278 3300042012 Ga0439455_0006438 Ga0439455_0006438_1254_2228 293
279 3300044658 Ga0466972_0023087 Ga0466972_0023087_1830_2804 293
280 3300044683 Ga0466965_0009082 Ga0466965_0009082_927_1901 293
281 3300044683 Ga0466965_0024959 Ga0466965_0024959_731_1705 293
282 3300044684 Ga0466966_0000457 Ga0466966_0000457_7843_8817 293
283 3300044684 Ga0466966_0065376 Ga0466966_0065376_180_1154 293
284 3300044684 Ga0466966_0132664 Ga0466966_0132664_186_1160 293
285 3300044684 Ga0466966_0145256 Ga0466966_0145256_243_1217 293
286 3300044693 Ga0466961_0027393 Ga0466961_0027393_2431_3405 293
287 3300044694 Ga0466963_0207435 Ga0466963_0207435_372_1346 293
288 3300044706 Ga0466964_0000435 Ga0466964_0000435_5928_7016 293
289 3300044706 Ga0466964_0002446 Ga0466964_0002446_3814_4788 293
290 3300044706 Ga0466964_0014920 Ga0466964_0014920_714_1688 293
291 3300044735 Ga0466968_0001497 Ga0466968_0001497_164_1138 293
292 3300044735 Ga0466968_0043937 Ga0466968_0043937_141_1115 293
293 3300044765 Ga0466970_0024531 Ga0466970_0024531_357_1331 293
294 3300044842 Ga0466957_0000114 Ga0466957_0000114_21679_22653 293
295 3300044842 Ga0466957_0012400 Ga0466957_0012400_755_1759 293
296 3300044842 Ga0466957_0027382 Ga0466957_0027382_1928_2902 293
297 3300044901 Ga0466960_0067601 Ga0466960_0067601_310_1284 293
298 3300045049 Ga0466959_0005057 Ga0466959_0005057_2034_3008 293
299 3300045049 Ga0466959_0025010 Ga0466959_0025010_203_1177 293
300 3300045049 Ga0466959_0030580 Ga0466959_0030580_1959_2933 293
301 3300045976 Ga0466967_0030085 Ga0466967_0030085_1475_2563 293
302 3300046452 Ga0495617_000063 Ga0495617_000063_49989_50966 293
303 3300046453 Ga0495627_000323 Ga0495627_000323_44837_45814 293
304 3300046453 Ga0495627_003505 Ga0495627_003505_5764_6738 293
305 3300046457 Ga0495590_0002387 Ga0495590_0002387_5000_5977 293
306 3300046457 Ga0495590_0062336 Ga0495590_0062336_249_1223 293
307 3300046459 Ga0495629_0017851 Ga0495629_0017851_446_1420 293
308 3300046460 Ga0495638_0024603 Ga0495638_0024603_296_1258 293
309 3300046460 Ga0495638_0048379 Ga0495638_0048379_706_1683 293
310 3300046463 Ga0495653_0004474 Ga0495653_0004474_2123_3097 293
311 3300046463 Ga0495653_0066832 Ga0495653_0066832_1335_2309 293
312 3300046463 Ga0495653_0112559 Ga0495653_0112559_228_1202 293
313 3300046471 Ga0495650_0017307 Ga0495650_0017307_1069_2046 293
314 3300046473 Ga0495582_0020516 Ga0495582_0020516_774_1748 293
315 3300046474 Ga0495605_0000049 Ga0495605_0000049_120865_121842 293
316 3300046474 Ga0495605_0000130 Ga0495605_0000130_49170_50144 293
317 3300046474 Ga0495605_0012517 Ga0495605_0012517_1149_2123 293
318 3300046474 Ga0495605_0030705 Ga0495605_0030705_713_1723 293
319 3300046474 Ga0495605_0037262 Ga0495605_0037262_1055_2065 293
320 3300046474 Ga0495605_0050378 Ga0495605_0050378_822_1796 293
321 3300046474 Ga0495605_0091000 Ga0495605_0091000_125_1099 293
322 3300046491 Ga0495584_0000001 Ga0495584_0000001_415185_416159 293
323 3300046491 Ga0495584_0000137 Ga0495584_0000137_9284_10258 293
324 3300046491 Ga0495584_0000164 Ga0495584_0000164_17494_18468 293
325 3300046491 Ga0495584_0001830 Ga0495584_0001830_8272_9246 293
326 3300046491 Ga0495584_0007483 Ga0495584_0007483_1305_2315 293
327 3300046491 Ga0495584_0008092 Ga0495584_0008092_762_1739 293
328 3300046491 Ga0495584_0010845 Ga0495584_0010845_3515_4501 293
329 3300046491 Ga0495584_0122624 Ga0495584_0122624_266_1240 293
330 3300046491 Ga0495584_0138294 Ga0495584_0138294_129_1115 293
331 3300046492 Ga0495585_0000003 Ga0495585_0000003_360466_361440 293
332 3300046492 Ga0495585_0000011 Ga0495585_0000011_164847_165821 293
333 3300046492 Ga0495585_0000040 Ga0495585_0000040_13527_14537 293
334 3300046492 Ga0495585_0000233 Ga0495585_0000233_28801_29787 293
335 3300046492 Ga0495585_0000365 Ga0495585_0000365_6347_7321 293
336 3300046492 Ga0495585_0000385 Ga0495585_0000385_25078_26055 293
337 3300046492 Ga0495585_0000486 Ga0495585_0000486_8102_9076 293
338 3300046492 Ga0495585_0004384 Ga0495585_0004384_5232_6209 293
339 3300046492 Ga0495585_0046779 Ga0495585_0046779_90_1064 293
340 3300046492 Ga0495585_0048301 Ga0495585_0048301_28_1002 293
341 3300046492 Ga0495585_0106325 Ga0495585_0106325_272_1249 293
342 3300046499 Ga0495594_0001143 Ga0495594_0001143_5531_6505 293
343 3300046499 Ga0495594_0024171 Ga0495594_0024171_1846_2823 293
344 3300046499 Ga0495594_0062918 Ga0495594_0062918_1020_1994 293
345 3300046499 Ga0495594_0076177 Ga0495594_0076177_775_1749 293
346 3300046499 Ga0495594_0148906 Ga0495594_0148906_35_1012 293
347 3300046500 Ga0495596_0000106 Ga0495596_0000106_7502_8476 293
348 3300046500 Ga0495596_0000424 Ga0495596_0000424_5884_6861 293
349 3300046500 Ga0495596_0001138 Ga0495596_0001138_666_1640 293
350 3300046500 Ga0495596_0006923 Ga0495596_0006923_1486_2460 293
351 3300046500 Ga0495596_0018568 Ga0495596_0018568_1441_2418 293
352 3300046500 Ga0495596_0020523 Ga0495596_0020523_42_1019 293
353 3300046500 Ga0495596_0075812 Ga0495596_0075812_188_1174 293
354 3300046501 Ga0495607_0001405 Ga0495607_0001405_3344_4318 293
355 3300046501 Ga0495607_0001669 Ga0495607_0001669_10277_11251 293
356 3300046501 Ga0495607_0002038 Ga0495607_0002038_9737_10714 293
357 3300046501 Ga0495607_0006690 Ga0495607_0006690_4389_5363 293
358 3300046501 Ga0495607_0006835 Ga0495607_0006835_5322_6284 293
359 3300046501 Ga0495607_0058664 Ga0495607_0058664_1135_2145 293
360 3300046506 Ga0495583_0000095 Ga0495583_0000095_38391_39365 293
361 3300046506 Ga0495583_0000381 Ga0495583_0000381_66558_67568 293
362 3300046506 Ga0495583_0000551 Ga0495583_0000551_44087_45061 293
363 3300046506 Ga0495583_0004237 Ga0495583_0004237_7948_8922 293
364 3300046506 Ga0495583_0008753 Ga0495583_0008753_1623_2600 293
365 3300046506 Ga0495583_0015640 Ga0495583_0015640_2975_3952 293
366 3300046506 Ga0495583_0029846 Ga0495583_0029846_1113_2075 293
367 3300046506 Ga0495583_0046412 Ga0495583_0046412_844_1830 293
368 3300046506 Ga0495583_0113016 Ga0495583_0113016_88_1065 293
369 3300046507 Ga0495606_0001131 Ga0495606_0001131_3890_4861 293
370 3300046507 Ga0495606_0007239 Ga0495606_0007239_6705_7670 293
371 3300046507 Ga0495606_0022454 Ga0495606_0022454_1894_2868 293
372 3300046507 Ga0495606_0050520 Ga0495606_0050520_472_1446 293
373 3300046507 Ga0495606_0164429 Ga0495606_0164429_144_1118 293
374 3300046512 Ga0495610_0002638 Ga0495610_0002638_5777_6736 293
375 3300046512 Ga0495610_0005058 Ga0495610_0005058_3620_4579 293
376 3300046512 Ga0495610_0009097 Ga0495610_0009097_4381_5340 293
377 3300046512 Ga0495610_0009298 Ga0495610_0009298_5190_6155 293
378 3300046513 Ga0495616_0000075 Ga0495616_0000075_31034_32011 293
379 3300046513 Ga0495616_0000170 Ga0495616_0000170_42914_43888 293
380 3300046513 Ga0495616_0000902 Ga0495616_0000902_5924_6901 293
381 3300046513 Ga0495616_0001358 Ga0495616_0001358_1790_2764 293
382 3300046513 Ga0495616_0003193 Ga0495616_0003193_5211_6185 293
383 3300046513 Ga0495616_0005436 Ga0495616_0005436_1061_2035 293
384 3300046513 Ga0495616_0008471 Ga0495616_0008471_3286_4248 293
385 3300046513 Ga0495616_0011720 Ga0495616_0011720_125_1102 293
386 3300046517 Ga0495630_0093605 Ga0495630_0093605_1144_2118 293
387 3300046517 Ga0495630_0099341 Ga0495630_0099341_25_999 293
388 3300046518 Ga0495631_0000417 Ga0495631_0000417_12119_13096 293
389 3300046518 Ga0495631_0002592 Ga0495631_0002592_3420_4406 293
390 3300046518 Ga0495631_0005682 Ga0495631_0005682_1760_2737 293
391 3300046518 Ga0495631_0007774 Ga0495631_0007774_2931_3908 293
392 3300046518 Ga0495631_0013672 Ga0495631_0013672_2812_3789 293
393 3300046518 Ga0495631_0014256 Ga0495631_0014256_1381_2391 293
394 3300046518 Ga0495631_0017463 Ga0495631_0017463_300_1274 293
395 3300046518 Ga0495631_0024430 Ga0495631_0024430_1083_2057 293
396 3300046518 Ga0495631_0059670 Ga0495631_0059670_660_1631 293
397 3300046519 Ga0495632_0000091 Ga0495632_0000091_42835_43812 293
398 3300046519 Ga0495632_0000201 Ga0495632_0000201_8084_9061 293
399 3300046519 Ga0495632_0000358 Ga0495632_0000358_2635_3609 293
400 3300046519 Ga0495632_0025745 Ga0495632_0025745_717_1727 293
401 3300046522 Ga0495643_0000022 Ga0495643_0000022_137213_138172 293
402 3300046522 Ga0495643_0000065 Ga0495643_0000065_14929_15888 293
403 3300046522 Ga0495643_0000094 Ga0495643_0000094_140174_141148 293
404 3300046522 Ga0495643_0000326 Ga0495643_0000326_57238_58212 293
405 3300046522 Ga0495643_0001487 Ga0495643_0001487_9427_10401 293
406 3300046522 Ga0495643_0007451 Ga0495643_0007451_3972_4946 293
407 3300046522 Ga0495643_0014799 Ga0495643_0014799_1460_2434 293
408 3300046522 Ga0495643_0073832 Ga0495643_0073832_82_1056 293
409 3300046522 Ga0495643_0132751 Ga0495643_0132751_141_1109 293
410 3300046523 Ga0495644_0007237 Ga0495644_0007237_3093_4067 293
411 3300046523 Ga0495644_0036002 Ga0495644_0036002_273_1283 293
412 3300046523 Ga0495644_0056542 Ga0495644_0056542_369_1343 293
413 3300046523 Ga0495644_0088409 Ga0495644_0088409_114_1091 293
414 3300046524 Ga0495648_0000011 Ga0495648_0000011_285557_286531 293
415 3300046524 Ga0495648_0000883 Ga0495648_0000883_7080_8057 293
416 3300046524 Ga0495648_0012722 Ga0495648_0012722_3813_4790 293
417 3300046524 Ga0495648_0016036 Ga0495648_0016036_1771_2739 293
418 3300046524 Ga0495648_0043528 Ga0495648_0043528_1064_2038 293
419 3300046524 Ga0495648_0057531 Ga0495648_0057531_104_1081 293
420 3300046525 Ga0495663_0001726 Ga0495663_0001726_332_1300 293
421 3300046525 Ga0495663_0043871 Ga0495663_0043871_53_1063 293
422 3300046525 Ga0495663_0057552 Ga0495663_0057552_137_1111 293
423 3300046526 Ga0495666_0000160 Ga0495666_0000160_3062_4036 293
424 3300046526 Ga0495666_0000267 Ga0495666_0000267_17326_18312 293
425 3300046526 Ga0495666_0008547 Ga0495666_0008547_2852_3826 293
426 3300046526 Ga0495666_0017645 Ga0495666_0017645_1624_2598 293
427 3300046526 Ga0495666_0064778 Ga0495666_0064778_567_1541 293
428 3300046528 Ga0495642_0000012 Ga0495642_0000012_81418_82395 293
429 3300046528 Ga0495642_0000128 Ga0495642_0000128_41523_42500 293
430 3300046528 Ga0495642_0000439 Ga0495642_0000439_14136_15110 293
431 3300046528 Ga0495642_0003382 Ga0495642_0003382_5034_6008 293
432 3300046528 Ga0495642_0006493 Ga0495642_0006493_2957_3931 293
433 3300046528 Ga0495642_0009466 Ga0495642_0009466_1792_2760 293
434 3300046528 Ga0495642_0018438 Ga0495642_0018438_1714_2685 293
435 3300046528 Ga0495642_0023585 Ga0495642_0023585_1135_2109 293
436 3300046528 Ga0495642_0026918 Ga0495642_0026918_844_1821 293
437 3300046528 Ga0495642_0096280 Ga0495642_0096280_262_1236 293
438 3300046529 Ga0495652_0058522 Ga0495652_0058522_1931_2905 293
439 3300046530 Ga0495654_0010283 Ga0495654_0010283_34_1011 293
440 3300046530 Ga0495654_0028268 Ga0495654_0028268_1568_2590 293
441 3300046530 Ga0495654_0078306 Ga0495654_0078306_538_1515 293
442 3300046531 Ga0495665_0003469 Ga0495665_0003469_1227_2201 293
443 3300046531 Ga0495665_0018914 Ga0495665_0018914_153_1139 293
444 3300046531 Ga0495665_0039773 Ga0495665_0039773_979_1953 293
445 3300046535 Ga0495586_0016175 Ga0495586_0016175_307_1281 293
446 3300046535 Ga0495586_0021113 Ga0495586_0021113_315_1289 293
447 3300046535 Ga0495586_0108193 Ga0495586_0108193_505_1479 293
448 3300046535 Ga0495586_0128037 Ga0495586_0128037_320_1294 293
449 3300046536 Ga0495587_0014738 Ga0495587_0014738_2612_3586 293
450 3300046538 Ga0495609_0000001 Ga0495609_0000001_381423_382397 293
451 3300046538 Ga0495609_0002680 Ga0495609_0002680_5914_6891 293
452 3300046538 Ga0495609_0007380 Ga0495609_0007380_140_1114 293
453 3300046538 Ga0495609_0013816 Ga0495609_0013816_2027_3004 293
454 3300046538 Ga0495609_0019974 Ga0495609_0019974_15_989 293
455 3300046538 Ga0495609_0039085 Ga0495609_0039085_273_1247 293
456 3300046538 Ga0495609_0055489 Ga0495609_0055489_636_1610 293
457 3300046538 Ga0495609_0072809 Ga0495609_0072809_426_1448 293
458 3300046542 Ga0495597_0000009 Ga0495597_0000009_180344_181321 293
459 3300046542 Ga0495597_0000029 Ga0495597_0000029_60308_61285 293
460 3300046542 Ga0495597_0000335 Ga0495597_0000335_14904_15881 293
461 3300046542 Ga0495597_0000466 Ga0495597_0000466_7894_8853 293
462 3300046542 Ga0495597_0003120 Ga0495597_0003120_818_1840 293
463 3300046542 Ga0495597_0008860 Ga0495597_0008860_1739_2710 293
464 3300046542 Ga0495597_0011431 Ga0495597_0011431_2910_3884 293
465 3300046542 Ga0495597_0029264 Ga0495597_0029264_187_1197 293
466 3300046542 Ga0495597_0067704 Ga0495597_0067704_282_1250 293
467 3300046543 Ga0495645_0101123 Ga0495645_0101123_653_1627 293
468 3300046557 Ga0495622_0001191 Ga0495622_0001191_2380_3354 293
469 3300046557 Ga0495622_0019628 Ga0495622_0019628_1781_2755 293
470 3300046558 Ga0495633_0000577 Ga0495633_0000577_7283_8257 293
471 3300046558 Ga0495633_0001135 Ga0495633_0001135_12872_13858 293
472 3300046558 Ga0495633_0003447 Ga0495633_0003447_5078_6052 293
473 3300046558 Ga0495633_0006010 Ga0495633_0006010_3362_4321 293
474 3300046558 Ga0495633_0006135 Ga0495633_0006135_6162_7172 293
475 3300046558 Ga0495633_0012130 Ga0495633_0012130_312_1286 293
476 3300046558 Ga0495633_0016160 Ga0495633_0016160_1497_2471 293
477 3300046615 Ga0495656_0033049 Ga0495656_0033049_808_1785 293
478 3300046615 Ga0495656_0062651 Ga0495656_0062651_236_1204 293
479 3300046616 Ga0495668_0000180 Ga0495668_0000180_23790_24767 293
480 3300046616 Ga0495668_0000429 Ga0495668_0000429_42584_43561 293
481 3300046616 Ga0495668_0001031 Ga0495668_0001031_5416_6393 293
482 3300046616 Ga0495668_0001648 Ga0495668_0001648_4313_5287 293
483 3300046616 Ga0495668_0003280 Ga0495668_0003280_93_1115 293
484 3300046616 Ga0495668_0007037 Ga0495668_0007037_6234_7208 293
485 3300046616 Ga0495668_0016242 Ga0495668_0016242_804_1778 293
486 3300046616 Ga0495668_0032675 Ga0495668_0032675_1627_2613 293
487 3300046616 Ga0495668_0035888 Ga0495668_0035888_1393_2367 293
488 3300046616 Ga0495668_0037133 Ga0495668_0037133_585_1562 293
489 3300046616 Ga0495668_0042122 Ga0495668_0042122_14_1024 293
490 3300046616 Ga0495668_0066935 Ga0495668_0066935_226_1203 293
491 3300046616 Ga0495668_0084778 Ga0495668_0084778_262_1224 293
492 3300046616 Ga0495668_0095069 Ga0495668_0095069_649_1620 293
493 3300046642 Ga0495634_0022518 Ga0495634_0022518_447_1421 293
494 3300046648 Ga0495611_0000437 Ga0495611_0000437_15874_16851 293
495 3300046648 Ga0495611_0008801 Ga0495611_0008801_1903_2889 293
496 3300046648 Ga0495611_0012180 Ga0495611_0012180_427_1401 293
497 3300046648 Ga0495611_0013380 Ga0495611_0013380_589_1566 293
498 3300046648 Ga0495611_0014600 Ga0495611_0014600_2353_3327 293
499 3300046648 Ga0495611_0044894 Ga0495611_0044894_699_1673 293
500 3300046648 Ga0495611_0060529 Ga0495611_0060529_437_1411 293
501 3300046648 Ga0495611_0120645 Ga0495611_0120645_36_1046 293
502 3300046660 Ga0495625_0008684 Ga0495625_0008684_4883_5845 293
503 3300046660 Ga0495625_0009670 Ga0495625_0009670_6553_7527 293
504 3300046660 Ga0495625_0018522 Ga0495625_0018522_2099_3073 293
505 3300046660 Ga0495625_0025290 Ga0495625_0025290_2853_3830 293
506 3300046660 Ga0495625_0047439 Ga0495625_0047439_917_1894 293
507 3300046660 Ga0495625_0088900 Ga0495625_0088900_38_1048 293
508 3300046664 Ga0495659_0017668 Ga0495659_0017668_857_1819 293
509 3300046665 Ga0495661_0000023 Ga0495661_0000023_103542_104516 293
510 3300046665 Ga0495661_0000148 Ga0495661_0000148_36046_37032 293
511 3300046665 Ga0495661_0000287 Ga0495661_0000287_31074_32051 293
512 3300046665 Ga0495661_0003345 Ga0495661_0003345_6779_7753 293
513 3300046665 Ga0495661_0004688 Ga0495661_0004688_2649_3623 293
514 3300046665 Ga0495661_0025832 Ga0495661_0025832_521_1498 293
515 3300046665 Ga0495661_0033305 Ga0495661_0033305_1833_2810 293
516 3300046665 Ga0495661_0049687 Ga0495661_0049687_143_1105 293
517 3300046665 Ga0495661_0051076 Ga0495661_0051076_721_1695 293
518 3300046665 Ga0495661_0057062 Ga0495661_0057062_1321_2295 293
519 3300046665 Ga0495661_0061447 Ga0495661_0061447_861_1832 293
520 3300046665 Ga0495661_0102466 Ga0495661_0102466_409_1380 293
521 3300046665 Ga0495661_0174753 Ga0495661_0174753_15_989 293
522 3300046674 Ga0495588_0000041 Ga0495588_0000041_320723_321697 293
523 3300046674 Ga0495588_0020102 Ga0495588_0020102_110_1084 293
524 3300046674 Ga0495588_0094174 Ga0495588_0094174_226_1203 293
525 3300046674 Ga0495588_0136839 Ga0495588_0136839_176_1150 293
526 3300046674 Ga0495588_0161383 Ga0495588_0161383_78_1052 293
527 3300046679 Ga0495623_0010749 Ga0495623_0010749_1320_2294 293
528 3300046679 Ga0495623_0051175 Ga0495623_0051175_1168_2139 293
529 3300046679 Ga0495623_0070655 Ga0495623_0070655_872_1846 293
530 3300046680 Ga0495646_0081670 Ga0495646_0081670_304_1326 293
531 3300046684 Ga0495669_0000429 Ga0495669_0000429_12383_13345 293
532 3300046684 Ga0495669_0000484 Ga0495669_0000484_13923_14900 293
533 3300046684 Ga0495669_0009083 Ga0495669_0009083_540_1517 293
534 3300046689 Ga0495613_0016878 Ga0495613_0016878_1369_2343 293
535 3300046690 Ga0495624_0006051 Ga0495624_0006051_605_1579 293
536 3300046691 Ga0495670_0000122 Ga0495670_0000122_14703_15689 293
537 3300046691 Ga0495670_0001433 Ga0495670_0001433_3387_4361 293
538 3300046691 Ga0495670_0001786 Ga0495670_0001786_2113_3087 293
539 3300046691 Ga0495670_0010563 Ga0495670_0010563_287_1261 293
540 3300046691 Ga0495670_0019050 Ga0495670_0019050_1355_2329 293
541 3300046691 Ga0495670_0036181 Ga0495670_0036181_207_1217 293
542 3300046691 Ga0495670_0086930 Ga0495670_0086930_219_1193 293
543 3300046691 Ga0495670_0117606 Ga0495670_0117606_23_997 293
544 3300046692 Ga0495671_0000140 Ga0495671_0000140_50372_51349 293
545 3300046692 Ga0495671_0009573 Ga0495671_0009573_1124_2101 293
546 3300046692 Ga0495671_0016243 Ga0495671_0016243_1047_2024 293
547 3300046692 Ga0495671_0047593 Ga0495671_0047593_145_1116 293
548 3300046694 Ga0495649_0028441 Ga0495649_0028441_1588_2565 293
549 3300046794 Ga0495589_0000027 Ga0495589_0000027_138694_139668 293
550 3300046794 Ga0495589_0000102 Ga0495589_0000102_75484_76461 293
551 3300046794 Ga0495589_0000600 Ga0495589_0000600_18268_19242 293
552 3300046794 Ga0495589_0005590 Ga0495589_0005590_4858_5835 293
553 3300046794 Ga0495589_0016821 Ga0495589_0016821_1827_2837 293
554 3300046794 Ga0495589_0040644 Ga0495589_0040644_342_1364 293
555 3300046794 Ga0495589_0114346 Ga0495589_0114346_307_1284 293
556 3300046809 Ga0495600_0047066 Ga0495600_0047066_421_1395 293
557 3300046810 Ga0495660_0000132 Ga0495660_0000132_34630_35604 293
558 3300046810 Ga0495660_0003475 Ga0495660_0003475_6430_7407 293
559 3300046810 Ga0495660_0022256 Ga0495660_0022256_1807_2817 293
560 3300046810 Ga0495660_0036753 Ga0495660_0036753_600_1577 293
561 3300046810 Ga0495660_0056861 Ga0495660_0056861_840_1814 293
562 3300046810 Ga0495660_0182145 Ga0495660_0182145_15_989 293
563 3300047315 Ga0495581_0004532 Ga0495581_0004532_4241_5215 293
564 3300047315 Ga0495581_0043781 Ga0495581_0043781_1060_2034 293
565 3300047317 Ga0495604_0019344 Ga0495604_0019344_1035_2009 293
566 3300047317 Ga0495604_0050325 Ga0495604_0050325_1217_2191 293
567 3300047318 Ga0495636_0003615 Ga0495636_0003615_4642_5610 293
568 3300047318 Ga0495636_0004270 Ga0495636_0004270_767_1729 293
569 3300047318 Ga0495636_0011926 Ga0495636_0011926_2135_3103 293
570 3300047319 Ga0495674_0002798 Ga0495674_0002798_6568_7542 293
571 3300047320 Ga0495672_0000095 Ga0495672_0000095_53373_54332 293
572 3300047320 Ga0495672_0005035 Ga0495672_0005035_3169_4143 293
573 3300047320 Ga0495672_0022297 Ga0495672_0022297_277_1299 293
574 3300047321 Ga0495676_0033969 Ga0495676_0033969_2014_2988 293
575 3300047321 Ga0495676_0074145 Ga0495676_0074145_1454_2428 293
576 3300047322 Ga0495680_0006458 Ga0495680_0006458_9641_10615 293
577 3300047323 Ga0495683_0000005 Ga0495683_0000005_64036_65010 293
578 3300047323 Ga0495683_0105998 Ga0495683_0105998_139_1113 293
579 3300047323 Ga0495683_0130721 Ga0495683_0130721_116_1126 293
580 3300047443 Ga0495687_000023 Ga0495687_000023_125837_126811 293
581 3300047443 Ga0495687_000027 Ga0495687_000027_39695_40669 293
582 3300047443 Ga0495687_000048 Ga0495687_000048_166490_167467 293
583 3300047443 Ga0495687_000524 Ga0495687_000524_6254_7228 293
584 3300047443 Ga0495687_002491 Ga0495687_002491_7035_8012 293
585 3300047443 Ga0495687_035282 Ga0495687_035282_705_1679 293
586 3300047444 Ga0495675_0009439 Ga0495675_0009439_4210_5184 293
587 3300047444 Ga0495675_0026728 Ga0495675_0026728_13_987 293
588 3300047445 Ga0495677_0000001 Ga0495677_0000001_39776_40750 293
589 3300047445 Ga0495677_0000677 Ga0495677_0000677_1949_2923 293
590 3300047445 Ga0495677_0005267 Ga0495677_0005267_170_1144 293
591 3300047445 Ga0495677_0005773 Ga0495677_0005773_796_1770 293
592 3300047445 Ga0495677_0005839 Ga0495677_0005839_248_1234 293
593 3300047445 Ga0495677_0011590 Ga0495677_0011590_635_1597 293
594 3300047445 Ga0495677_0014975 Ga0495677_0014975_249_1223 293
595 3300047445 Ga0495677_0039007 Ga0495677_0039007_150_1124 293
596 3300047446 Ga0495679_004242 Ga0495679_004242_1467_2444 293
597 3300047446 Ga0495679_005144 Ga0495679_005144_1794_2768 293
598 3300047446 Ga0495679_006136 Ga0495679_006136_125_1102 293
599 3300047446 Ga0495679_021023 Ga0495679_021023_217_1179 293
600 3300047447 Ga0495685_009304 Ga0495685_009304_1061_2071 293
601 3300047447 Ga0495685_014627 Ga0495685_014627_745_1755 293
602 3300047469 Ga0495673_0049798 Ga0495673_0049798_232_1206 293
603 3300047470 Ga0495681_0000018 Ga0495681_0000018_45201_46178 293
604 3300047470 Ga0495681_0001220 Ga0495681_0001220_11188_12165 293
605 3300047470 Ga0495681_0003868 Ga0495681_0003868_3848_4810 293
606 3300047470 Ga0495681_0004757 Ga0495681_0004757_4265_5251 293
607 3300047470 Ga0495681_0008989 Ga0495681_0008989_3241_4215 293
608 3300047470 Ga0495681_0009121 Ga0495681_0009121_188_1162 293
609 3300047470 Ga0495681_0009347 Ga0495681_0009347_1356_2330 293
610 3300047470 Ga0495681_0010500 Ga0495681_0010500_245_1219 293
611 3300047470 Ga0495681_0020670 Ga0495681_0020670_223_1197 293
612 3300047470 Ga0495681_0047735 Ga0495681_0047735_937_1908 293
613 3300047472 Ga0495686_0000135 Ga0495686_0000135_79573_80550 293
614 3300047472 Ga0495686_0000640 Ga0495686_0000640_11343_12317 293
615 3300047472 Ga0495686_0147790 Ga0495686_0147790_14_988 293
616 3300047673 Ga0495593_0002837 Ga0495593_0002837_7332_8306 293
617 3300047673 Ga0495593_0039247 Ga0495593_0039247_1226_2200 293
618 3300048090 Ga0495615_0000944 Ga0495615_0000944_1648_2616 293
619 3300048090 Ga0495615_0028137 Ga0495615_0028137_302_1276 293
620 3300048091 Ga0495626_0000037 Ga0495626_0000037_48627_49601 293
621 3300048091 Ga0495626_0000535 Ga0495626_0000535_30095_31069 293
622 3300048091 Ga0495626_0000754 Ga0495626_0000754_8248_9222 293
623 3300048091 Ga0495626_0003874 Ga0495626_0003874_706_1680 293
624 3300048091 Ga0495626_0007550 Ga0495626_0007550_2536_3510 293
625 3300048091 Ga0495626_0010374 Ga0495626_0010374_263_1237 293
626 3300048091 Ga0495626_0015581 Ga0495626_0015581_191_1165 293
627 3300048091 Ga0495626_0017666 Ga0495626_0017666_1630_2604 293
628 3300048091 Ga0495626_0024208 Ga0495626_0024208_1761_2735 293
629 3300048091 Ga0495626_0031604 Ga0495626_0031604_348_1322 293
630 3300048091 Ga0495626_0043744 Ga0495626_0043744_200_1171 293
631 3300048091 Ga0495626_0046493 Ga0495626_0046493_786_1760 293
632 3300048091 Ga0495626_0098322 Ga0495626_0098322_163_1140 293
633 3300048904 Ga0496101_0123396 Ga0496101_0123396_836_1813 293
634 3300048905 Ga0496102_0000151 Ga0496102_0000151_52606_53583 293
635 3300048905 Ga0496102_0000182 Ga0496102_0000182_32222_33190 293
636 3300048905 Ga0496102_0232126 Ga0496102_0232126_455_1429 293
637 3300048906 Ga0496103_0027157 Ga0496103_0027157_1499_2476 293
638 3300048906 Ga0496103_0043530 Ga0496103_0043530_733_1701 293
639 3300048906 Ga0496103_0100972 Ga0496103_0100972_226_1203 293
640 3300048907 Ga0496104_0269407 Ga0496104_0269407_151_1125 293
641 3300048909 Ga0496106_0009494 Ga0496106_0009494_5077_6051 293
642 3300048909 Ga0496106_0173532 Ga0496106_0173532_172_1182 293
643 3300048912 Ga0496109_0434692 Ga0496109_0434692_48_1139 293
644 3300048913 Ga0496110_0074408 Ga0496110_0074408_1771_2748 293
645 3300048915 Ga0496112_0315152 Ga0496112_0315152_507_1484 293
646 3300048916 Ga0496113_0002561 Ga0496113_0002561_9483_10460 293
647 3300048916 Ga0496113_0006144 Ga0496113_0006144_5927_6901 293
648 3300048916 Ga0496113_0212904 Ga0496113_0212904_352_1326 293
649 3300048918 Ga0496115_0017832 Ga0496115_0017832_78_1055 293
650 3300048918 Ga0496115_0021525 Ga0496115_0021525_2868_3839 293
651 3300048918 Ga0496115_0097860 Ga0496115_0097860_859_1833 293
652 3300048918 Ga0496115_0123143 Ga0496115_0123143_285_1259 293
653 3300048924 Ga0496121_0305301 Ga0496121_0305301_34_1011 293
654 3300048925 Ga0496122_0000712 Ga0496122_0000712_29522_30499 293
655 3300048925 Ga0496122_0003090 Ga0496122_0003090_4171_5145 293
656 3300048925 Ga0496122_0014805 Ga0496122_0014805_792_1766 293
657 3300048926 Ga0496123_0000502 Ga0496123_0000502_47380_48357 293
658 3300048926 Ga0496123_0005830 Ga0496123_0005830_8614_9588 293
659 3300048926 Ga0496123_0020981 Ga0496123_0020981_3872_4846 293
660 3300048927 Ga0496124_0003831 Ga0496124_0003831_2503_3477 293
661 3300048927 Ga0496124_0012443 Ga0496124_0012443_2789_3763 293
662 3300048927 Ga0496124_0132635 Ga0496124_0132635_428_1405 293
663 3300048927 Ga0496124_0220205 Ga0496124_0220205_379_1386 293
664 3300048928 Ga0496125_0017614 Ga0496125_0017614_2872_3849 293
665 3300048928 Ga0496125_0213634 Ga0496125_0213634_233_1207 293
666 3300049459 Ga0495678_000100 Ga0495678_000100_96960_98033 293
667 3300049459 Ga0495678_000286 Ga0495678_000286_48722_49699 293
668 3300049459 Ga0495678_000588 Ga0495678_000588_24704_25663 293
669 3300049459 Ga0495678_000705 Ga0495678_000705_24864_25841 293
670 3300049459 Ga0495678_003925 Ga0495678_003925_2977_3951 293
671 3300049460 Ga0495682_0000066 Ga0495682_0000066_18665_19642 293
672 3300049460 Ga0495682_0001017 Ga0495682_0001017_1569_2546 293
673 3300049822 Ga0501035_0000866 Ga0501035_0000866_21351_22325 293
674 3300049823 Ga0501044_0031874 Ga0501044_0031874_3518_4492 293
675 3300053145 Ga0500586_000227 Ga0500586_000227_7789_8748 293
676 3300002738 JGI25154J39366_1000716 JGI25154J39366_100071610 294
677 3300002773 JGI25152J39213_1000005 JGI25152J39213_1000005112 294
678 3300002774 JGI25150J39212_1000571 JGI25150J39212_10005715 294
679 3300002774 JGI25150J39212_1005726 JGI25150J39212_10057262 294
680 3300002987 JGI25159J45721_1004574 JGI25159J45721_10045745 294
681 3300003215 JGI25153J46596_10005856 JGI25153J46596_100058562 294
682 3300003322 rootL2_10035258 rootL2_100352584 294
683 3300003322 rootL2_10117580 rootL2_101175802 294
684 3300003374 JGI25161J50226_1000182 JGI25161J50226_100018252 294
685 3300003763 Ga0055529_1000068 Ga0055529_100006856 294
686 3300003771 Ga0055526_1000013 Ga0055526_100001341 294
687 3300003771 Ga0055526_1005682 Ga0055526_10056828 294
688 3300003771 Ga0055526_1009881 Ga0055526_10098814 294
689 3300003773 Ga0055537_1002487 Ga0055537_10024875 294
690 3300003773 Ga0055537_1013747 Ga0055537_10137471 294
691 3300003773 Ga0055537_1018641 Ga0055537_10186411 294
692 3300003775 Ga0055524_1000008 Ga0055524_1000008259 294
693 3300003775 Ga0055524_1000187 Ga0055524_10001873 294
694 3300003775 Ga0055524_1007806 Ga0055524_10078063 294
695 3300003775 Ga0055524_1014954 Ga0055524_10149541 294
696 3300003784 Ga0055534_1001797 Ga0055534_10017979 294
697 3300003784 Ga0055534_1011384 Ga0055534_10113842 294
698 3300003791 Ga0055530_10010604 Ga0055530_100106043 294
699 3300003794 Ga0055531_10005354 Ga0055531_100053545 294
700 3300004625 Ga0055543_1000112 Ga0055543_100011231 294
701 3300005262 Ga0065165_1001216 Ga0065165_100121631 294
702 3300005262 Ga0065165_1013430 Ga0065165_10134304 294
703 3300006948 Ga0099826_10000001 Ga0099826_10000001343 294
704 3300009036 Ga0105244_10002659 Ga0105244_100026595 294
705 3300025208 Ga0209436_100484 Ga0209436_1004844 294
706 3300025208 Ga0209436_111393 Ga0209436_1113932 294
707 3300025245 Ga0207425_1000001 Ga0207425_1000001204 294
708 3300025245 Ga0207425_1000130 Ga0207425_100013023 294
709 3300025246 Ga0209646_1000007 Ga0209646_1000007285 294
710 3300025258 Ga0209129_1000003 Ga0209129_1000003204 294
711 3300025258 Ga0209129_1009156 Ga0209129_10091563 294
712 3300025263 Ga0209565_1003147 Ga0209565_10031477 294
713 3300025263 Ga0209565_1003288 Ga0209565_10032885 294
714 3300025263 Ga0209565_1004100 Ga0209565_10041004 294
715 3300025263 Ga0209565_1006959 Ga0209565_10069592 294
716 3300025263 Ga0209565_1017245 Ga0209565_10172452 294
717 3300025272 Ga0209455_1000026 Ga0209455_1000026456 294
718 3300025273 Ga0209673_1014177 Ga0209673_10141773 294
719 3300025273 Ga0209673_1033525 Ga0209673_10335252 294
720 3300025284 Ga0209130_1000237 Ga0209130_100023752 294
721 3300025284 Ga0209130_1004662 Ga0209130_10046626 294
722 3300025291 Ga0209675_1006952 Ga0209675_10069523 294
723 3300025291 Ga0209675_1013840 Ga0209675_10138403 294
724 3300025295 Ga0209564_1000002 Ga0209564_1000002968 294
725 3300025295 Ga0209564_1000311 Ga0209564_100031149 294
726 3300025295 Ga0209564_1005699 Ga0209564_10056996 294
727 3300025295 Ga0209564_1007930 Ga0209564_10079303 294
728 3300025297 Ga0209758_1000041 Ga0209758_1000041152 294
729 3300025298 Ga0209050_1000011 Ga0209050_1000011224 294
730 3300025298 Ga0209050_1000164 Ga0209050_100016431 294
731 3300025298 Ga0209050_1000664 Ga0209050_100066424 294
732 3300025299 Ga0209256_1000005 Ga0209256_10000051205 294
733 3300025299 Ga0209256_1000068 Ga0209256_100006880 294
734 3300025299 Ga0209256_1000952 Ga0209256_100095231 294
735 3300025299 Ga0209256_1003000 Ga0209256_10030005 294
736 3300025302 Ga0207426_1003864 Ga0207426_10038649 294
737 3300025304 Ga0209257_1000003 Ga0209257_1000003996 294
738 3300025304 Ga0209257_1016232 Ga0209257_10162323 294
739 3300025728 Ga0207655_1004019 Ga0207655_10040199 294
740 3300027666 Ga0209282_1000001 Ga0209282_10000011481 294
741 3300030736 Ga0316180_1112319 Ga0316180_11123192 294
742 3300030744 Ga0316181_1216539 Ga0316181_12165391 294
743 3300031548 Ga0307408_100001129 Ga0307408_10000112911 294
744 3300031548 Ga0307408_100001185 Ga0307408_10000118511 294
745 3300032002 Ga0307416_100084493 Ga0307416_1000844932 294
746 3300037471 Ga0395905_0436863 Ga0395905_0436863_112_1074 294
747 3300044683 Ga0466965_0016185 Ga0466965_0016185_1561_2523 294
748 3300046452 Ga0495617_000042 Ga0495617_000042_14677_15636 294
749 3300046452 Ga0495617_037565 Ga0495617_037565_515_1474 294
750 3300046457 Ga0495590_0000010 Ga0495590_0000010_239994_240953 294
751 3300046460 Ga0495638_0000027 Ga0495638_0000027_279920_280879 294
752 3300046460 Ga0495638_0020825 Ga0495638_0020825_2265_3224 294
753 3300046471 Ga0495650_0000066 Ga0495650_0000066_219996_220955 294
754 3300046471 Ga0495650_0000229 Ga0495650_0000229_86071_87063 294
755 3300046471 Ga0495650_0001129 Ga0495650_0001129_13866_14825 294
756 3300046471 Ga0495650_0003132 Ga0495650_0003132_5056_6015 294
757 3300046474 Ga0495605_0000027 Ga0495605_0000027_79263_80222 294
758 3300046474 Ga0495605_0009901 Ga0495605_0009901_2297_3289 294
759 3300046475 Ga0495639_0013547 Ga0495639_0013547_975_1934 294
760 3300046500 Ga0495596_0014663 Ga0495596_0014663_2000_2992 294
761 3300046501 Ga0495607_0005509 Ga0495607_0005509_3274_4233 294
762 3300046506 Ga0495583_0000006 Ga0495583_0000006_270616_271575 294
763 3300046507 Ga0495606_0000557 Ga0495606_0000557_8301_9260 294
764 3300046507 Ga0495606_0001352 Ga0495606_0001352_21237_22196 294
765 3300046507 Ga0495606_0005861 Ga0495606_0005861_1769_2728 294
766 3300046512 Ga0495610_0107015 Ga0495610_0107015_123_1082 294
767 3300046520 Ga0495637_0000067 Ga0495637_0000067_57008_57994 294
768 3300046524 Ga0495648_0000078 Ga0495648_0000078_48262_49221 294
769 3300046524 Ga0495648_0000928 Ga0495648_0000928_28429_29421 294
770 3300046524 Ga0495648_0002119 Ga0495648_0002119_8126_9085 294
771 3300046528 Ga0495642_0000919 Ga0495642_0000919_9768_10727 294
772 3300046530 Ga0495654_0000002 Ga0495654_0000002_706465_707451 294
773 3300046530 Ga0495654_0023750 Ga0495654_0023750_38_1000 294
774 3300046538 Ga0495609_0001621 Ga0495609_0001621_2377_3369 294
775 3300046538 Ga0495609_0005651 Ga0495609_0005651_5082_6041 294
776 3300046557 Ga0495622_0000043 Ga0495622_0000043_102751_103710 294
777 3300046558 Ga0495633_0000381 Ga0495633_0000381_31295_32254 294
778 3300046558 Ga0495633_0001381 Ga0495633_0001381_3429_4388 294
779 3300046616 Ga0495668_0000006 Ga0495668_0000006_258343_259305 294
780 3300046616 Ga0495668_0000096 Ga0495668_0000096_14208_15167 294
781 3300046616 Ga0495668_0001010 Ga0495668_0001010_11805_12764 294
782 3300046616 Ga0495668_0006316 Ga0495668_0006316_4078_5037 294
783 3300046660 Ga0495625_0000053 Ga0495625_0000053_14474_15433 294
784 3300046660 Ga0495625_0002139 Ga0495625_0002139_13683_14642 294
785 3300046660 Ga0495625_0009909 Ga0495625_0009909_3178_4173 294
786 3300046660 Ga0495625_0050151 Ga0495625_0050151_1172_2134 294
787 3300046660 Ga0495625_0054292 Ga0495625_0054292_1458_2447 294
788 3300046664 Ga0495659_0000001 Ga0495659_0000001_273910_274872 294
789 3300046691 Ga0495670_0036802 Ga0495670_0036802_230_1189 294
790 3300046692 Ga0495671_0000002 Ga0495671_0000002_767834_768793 294
791 3300046692 Ga0495671_0000035 Ga0495671_0000035_130880_131842 294
792 3300046692 Ga0495671_0002321 Ga0495671_0002321_9517_10476 294
793 3300046692 Ga0495671_0048524 Ga0495671_0048524_495_1454 294
794 3300046694 Ga0495649_0002789 Ga0495649_0002789_4630_5589 294
795 3300046810 Ga0495660_0018729 Ga0495660_0018729_2647_3606 294
796 3300046810 Ga0495660_0025019 Ga0495660_0025019_921_1880 294
797 3300046810 Ga0495660_0031928 Ga0495660_0031928_969_1931 294
798 3300046810 Ga0495660_0080464 Ga0495660_0080464_732_1694 294
799 3300047320 Ga0495672_0000022 Ga0495672_0000022_63537_64547 294
800 3300047320 Ga0495672_0000066 Ga0495672_0000066_75224_76186 294
801 3300047320 Ga0495672_0003237 Ga0495672_0003237_11960_12952 294
802 3300047443 Ga0495687_001158 Ga0495687_001158_18966_19925 294
803 3300047446 Ga0495679_006944 Ga0495679_006944_3334_4293 294
804 3300047469 Ga0495673_0000064 Ga0495673_0000064_153885_154844 294
805 3300047472 Ga0495686_0000462 Ga0495686_0000462_49586_50548 294
806 3300047472 Ga0495686_0009909 Ga0495686_0009909_664_1626 294
807 3300048917 Ga0496114_0065321 Ga0496114_0065321_662_1621 294
808 3300048925 Ga0496122_0075194 Ga0496122_0075194_33_992 294
809 3300048927 Ga0496124_0029879 Ga0496124_0029879_421_1380 294
810 3300049671 Ga0501238_002661 Ga0501238_002661_40_999 294
811 3300049679 Ga0501249_001440 Ga0501249_001440_3243_4202 294
812 3300049679 Ga0501249_013450 Ga0501249_013450_651_1631 294
813 3300049758 Ga0501241_012372 Ga0501241_012372_187_1146 294
814 3300049766 Ga0501269_000423 Ga0501269_000423_7134_8093 294
815 3300053118 Ga0500594_0002295 Ga0500594_0002295_1848_2807 294
816 3300053125 Ga0500618_000137 Ga0500618_000137_3289_4248 294
817 3300053125 Ga0500618_009677 Ga0500618_009677_717_1679 294
818 3300053145 Ga0500586_001150 Ga0500586_001150_1858_2817 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

81

215

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7233 9 291
3cdx-assembly1.cif.gz_A crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7212 9 291
3cdx-assembly1.cif.gz_C crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7192 9 291
3cdx-assembly1.cif.gz_D crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7067 9 291
3cdx-assembly1.cif.gz_E crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7048 9 291
ID Description Score Start End Superfamily
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8397 226 285 2.40.50.630
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8043 226 285 2.40.50.630
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7067 9 291 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6808 9 291 3.40.630.10
af_P76215_1_322_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6784 17 291 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1M7R4T8-F1-model_v4 Succinylglutamate desuccinylase / Aspartoacylase family protein 0.9821 74 294
AF-A0A349KYS1-F1-model_v4 Succinylglutamate desuccinylase 0.9808 4 66 GO:0016788
GO:0046872
AF-A0A1M7R4T8-F1-model_v4 Succinylglutamate desuccinylase / Aspartoacylase family protein 0.9734 74 294
AF-A0A7Y9HLT1-F1-model_v4 Putative deacylase 0.9621 67 294 GO:0016788
GO:0046872
AF-A0A349KYS0-F1-model_v4 Succinylglutamate desuccinylase 0.9606 95 294

Feature Viewer

pLDDT pTM Quality
90.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map