F481845

General Info

Members Datasets Scaffolds Average Seq Length
811 298 1622 327

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10287769|Ga0163162_102877691
Length 379
Sequence MGRTAGRPIQDNSGLPKGPADRWVVSSKRGKATPTISSVADGHALIGRKAMLCVRRREFITLLGGAAAWPLAARAQQSRRVPRIGVLLLGTPDSFAGRIEAFAEGLRDLGYVDGRTVAIEWKWGQDRADRLPDLAAELVRSQVDVIVTGGTPAAQALKNATRTIPIVMAIVGDPVAAGLVDSLARPGGNATGFSIVATDLSGRRLQLLKEMVPGLSSIAVMSNAANPQSQMELKETQSAARSLDLRLHSVPISADTSIENAFDKIKKEPVQALIVVTDAILYSQRSQILDLAARHRLPAMYPYREFPEAGGLASYAPNVRDLFRRAASYVDRILKGANPGDLPVEQPTKFELVISLKTAKSLGHDVPPGVLAIADEVIE

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 9.12
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10287769 3300013306 Bacteria 1775
2 MRS1b_contig_6784039 2162886011 Unclassified 1083
3 MBSR1b_contig_882870 2162886012 Unclassified 1088
4 JGI24032J14994_100295 3300001430 Bacteria 2641
5 JGI24739J22299_10031835 3300001989 Unclassified 1820
6 JGI24737J22298_10014591 3300001990 Bacteria 2549
7 JGI24737J22298_10047911 3300001990 Unclassified 1302
8 JGI24738J21930_10002922 3300002075 Bacteria 4372
9 JGI24034J26672_10011736 3300002239 Bacteria 1315
10 JGI24742J22300_10015015 3300002244 Bacteria 1302
11 Ga0065712_10144697 3300005290 Bacteria 1416
12 Ga0065715_10113088 3300005293 Bacteria 2503
13 Ga0070676_10001115 3300005328 Bacteria 13418
14 Ga0070676_10013710 3300005328 Bacteria 4443
15 Ga0070676_10029868 3300005328 Bacteria 3103
16 Ga0070676_10082049 3300005328 Bacteria 1958
17 Ga0070683_100061328 3300005329 Bacteria 3497
18 Ga0070683_100209036 3300005329 Bacteria 1854
19 Ga0070683_100397825 3300005329 Bacteria 1313
20 Ga0070690_100000733 3300005330 Bacteria 16783
21 Ga0070690_100001204 3300005330 Bacteria 13360
22 Ga0070690_100070373 3300005330 Bacteria 2272
23 Ga0070690_100158791 3300005330 Bacteria 1548
24 Ga0070670_100002717 3300005331 Bacteria 14609
25 Ga0070670_100006462 3300005331 Bacteria 9925
26 Ga0070670_100102618 3300005331 Bacteria 2463
27 Ga0070670_100110672 3300005331 Bacteria 2366
28 Ga0070670_100214119 3300005331 Bacteria 1675
29 Ga0070677_10025019 3300005333 Unclassified 2225
30 Ga0070677_10053499 3300005333 Bacteria 1641
31 Ga0070677_10080122 3300005333 Unclassified 1395
32 Ga0068869_100005375 3300005334 Bacteria 8047
33 Ga0068869_100012072 3300005334 Bacteria 5694
34 Ga0068869_100154619 3300005334 Bacteria 1781
35 Ga0070666_10004816 3300005335 Bacteria 8251
36 Ga0070666_10029470 3300005335 Bacteria 3608
37 Ga0070666_10181837 3300005335 Bacteria 1475
38 Ga0070680_100270198 3300005336 Bacteria 1439
39 Ga0070682_100083950 3300005337 Bacteria 2068
40 Ga0068868_100010228 3300005338 Bacteria 6782
41 Ga0068868_100041488 3300005338 Bacteria 3585
42 Ga0068868_100041715 3300005338 Bacteria 3576
43 Ga0068868_100047575 3300005338 Bacteria 3362
44 Ga0070660_100174536 3300005339 Bacteria 1737
45 Ga0070660_100179531 3300005339 Bacteria 1713
46 Ga0070660_100391315 3300005339 Unclassified 1148
47 Ga0070689_100082006 3300005340 Bacteria 2532
48 Ga0070687_100000465 3300005343 Bacteria 13618
49 Ga0070687_100022739 3300005343 Bacteria 2968
50 Ga0070687_100030154 3300005343 Bacteria 2649
51 Ga0070661_100046743 3300005344 Bacteria 3167
52 Ga0070661_100214522 3300005344 Bacteria 1474
53 Ga0070661_100248921 3300005344 Bacteria 1371
54 Ga0070692_10032790 3300005345 Bacteria 2614
55 Ga0070668_100004443 3300005347 Bacteria 10409
56 Ga0070668_100008982 3300005347 Bacteria 7422
57 Ga0070668_100024181 3300005347 Bacteria 4601
58 Ga0070669_100005480 3300005353 Bacteria 9160
59 Ga0070669_100009462 3300005353 Bacteria 6940
60 Ga0070669_100021046 3300005353 Bacteria 4660
61 Ga0070669_100213970 3300005353 Bacteria 1522
62 Ga0070675_100001596 3300005354 Bacteria 16732
63 Ga0070675_100004885 3300005354 Bacteria 10228
64 Ga0070675_100069815 3300005354 Bacteria 2911
65 Ga0070675_100099265 3300005354 Bacteria 2451
66 Ga0070675_100203341 3300005354 Bacteria 1719
67 Ga0070675_100371494 3300005354 Bacteria 1271
68 Ga0070671_100045459 3300005355 Bacteria 3650
69 Ga0070671_100067213 3300005355 Unclassified 2988
70 Ga0070671_100133028 3300005355 Bacteria 2095
71 Ga0070671_100148073 3300005355 Bacteria 1982
72 Ga0070671_100295644 3300005355 Bacteria 1378
73 Ga0070674_100003460 3300005356 Bacteria 8865
74 Ga0070674_100058198 3300005356 Bacteria 2686
75 Ga0070674_100112755 3300005356 Bacteria 1999
76 Ga0070674_100120838 3300005356 Unclassified 1939
77 Ga0070673_100047511 3300005364 Bacteria 3340
78 Ga0070673_100131683 3300005364 Bacteria 2099
79 Ga0070673_100241564 3300005364 Unclassified 1571
80 Ga0070673_100268794 3300005364 Bacteria 1492
81 Ga0070673_100293829 3300005364 Bacteria 1429
82 Ga0070688_100033917 3300005365 Bacteria 3087
83 Ga0070688_100036214 3300005365 Unclassified 3000
84 Ga0070688_100057094 3300005365 Bacteria 2452
85 Ga0070688_100088255 3300005365 Bacteria 2022
86 Ga0070659_100023095 3300005366 Bacteria 4755
87 Ga0070659_100041128 3300005366 Bacteria 3612
88 Ga0070659_100088830 3300005366 Bacteria 2475
89 Ga0070667_100001597 3300005367 Bacteria 20271
90 Ga0070667_100088517 3300005367 Bacteria 2659
91 Ga0070667_100092440 3300005367 Bacteria 2603
92 Ga0070667_100140459 3300005367 Bacteria 2115
93 Ga0070667_100334786 3300005367 Unclassified 1368
94 Ga0070709_10027792 3300005434 Bacteria 3367
95 Ga0070709_10029795 3300005434 Bacteria 3268
96 Ga0070709_10038516 3300005434 Bacteria 2928
97 Ga0070714_100010139 3300005435 Bacteria 7437
98 Ga0070714_100016417 3300005435 Bacteria 5977
99 Ga0070714_100031548 3300005435 Bacteria 4422
100 Ga0070713_100015296 3300005436 Bacteria 5728
101 Ga0070713_100061564 3300005436 Bacteria 3140
102 Ga0070713_100076862 3300005436 Unclassified 2837
103 Ga0070713_100144625 3300005436 Bacteria 2109
104 Ga0070710_10001879 3300005437 Bacteria 9920
105 Ga0070710_10053428 3300005437 Bacteria 2276
106 Ga0070710_10078254 3300005437 Unclassified 1924
107 Ga0070701_10000282 3300005438 Bacteria 16597
108 Ga0070711_100006902 3300005439 Bacteria 6883
109 Ga0070711_100009195 3300005439 Bacteria 6074
110 Ga0070711_100023613 3300005439 Bacteria 4002
111 Ga0070711_100252050 3300005439 Bacteria 1385
112 Ga0070705_100274994 3300005440 Unclassified 1194
113 Ga0070700_100018008 3300005441 Unclassified 4053
114 Ga0070700_100025736 3300005441 Bacteria 3467
115 Ga0070694_100210299 3300005444 Bacteria 1454
116 Ga0070708_100080885 3300005445 Bacteria 2940
117 Ga0070708_100205136 3300005445 Unclassified 1846
118 Ga0070663_100025241 3300005455 Bacteria 4011
119 Ga0070663_100027024 3300005455 Bacteria 3893
120 Ga0070663_100053332 3300005455 Bacteria 2886
121 Ga0070663_100122404 3300005455 Bacteria 1966
122 Ga0070678_100005950 3300005456 Bacteria 7100
123 Ga0070678_100010050 3300005456 Bacteria 5761
124 Ga0070678_100032812 3300005456 Bacteria 3598
125 Ga0070678_100077813 3300005456 Bacteria 2503
126 Ga0070678_100112973 3300005456 Bacteria 2128
127 Ga0070678_100128339 3300005456 Bacteria 2011
128 Ga0070678_100136064 3300005456 Bacteria 1959
129 Ga0070678_100186848 3300005456 Bacteria 1701
130 Ga0070662_100001112 3300005457 Bacteria 16400
131 Ga0070662_100001931 3300005457 Bacteria 12742
132 Ga0070662_100014907 3300005457 Bacteria 5198
133 Ga0070662_100202110 3300005457 Bacteria 1577
134 Ga0070662_100246805 3300005457 Bacteria 1434
135 Ga0070681_10161265 3300005458 Bacteria 2167
136 Ga0070681_10337953 3300005458 Bacteria 1415
137 Ga0070681_10351017 3300005458 Unclassified 1385
138 Ga0070681_10407252 3300005458 Bacteria 1272
139 Ga0068867_100046895 3300005459 Bacteria 3175
140 Ga0068867_100056783 3300005459 Unclassified 2897
141 Ga0068867_100059993 3300005459 Bacteria 2821
142 Ga0068867_100135679 3300005459 Bacteria 1918
143 Ga0068867_100290969 3300005459 Unclassified 1343
144 Ga0070706_100017695 3300005467 Bacteria 6577
145 Ga0070706_100190562 3300005467 Bacteria 1916
146 Ga0070706_100219154 3300005467 Bacteria 1776
147 Ga0070707_100076955 3300005468 Bacteria 3219
148 Ga0070707_100129903 3300005468 Bacteria 2449
149 Ga0070707_100223078 3300005468 Bacteria 1835
150 Ga0070707_100310448 3300005468 Bacteria 1533
151 Ga0070698_100025627 3300005471 Bacteria 6145
152 Ga0070698_100054325 3300005471 Bacteria 4066
153 Ga0070698_100062180 3300005471 Bacteria 3767
154 Ga0070699_100006150 3300005518 Bacteria 10490
155 Ga0070699_100080725 3300005518 Bacteria 2834
156 Ga0070679_100519633 3300005530 Bacteria 1134
157 Ga0070684_100030869 3300005535 Bacteria 4557
158 Ga0070684_100332893 3300005535 Bacteria 1395
159 Ga0070697_100082684 3300005536 Bacteria 2647
160 Ga0068853_100001828 3300005539 Bacteria 15647
161 Ga0068853_100145834 3300005539 Bacteria 2127
162 Ga0070672_100065752 3300005543 Unclassified 2869
163 Ga0070672_100097215 3300005543 Bacteria 2383
164 Ga0070672_100137974 3300005543 Bacteria 2009
165 Ga0070686_100017643 3300005544 Unclassified 4174
166 Ga0070686_100190731 3300005544 Bacteria 1463
167 Ga0070695_100067577 3300005545 Bacteria 2331
168 Ga0070695_100125644 3300005545 Bacteria 1761
169 Ga0070696_100319492 3300005546 Unclassified 1194
170 Ga0070693_100037127 3300005547 Bacteria 2714
171 Ga0070693_100143054 3300005547 Bacteria 1508
172 Ga0070665_100099009 3300005548 Bacteria 2920
173 Ga0070665_100230175 3300005548 Bacteria 1853
174 Ga0070665_100329006 3300005548 Bacteria 1532
175 Ga0070704_100061598 3300005549 Bacteria 2686
176 Ga0070704_100112370 3300005549 Bacteria 2075
177 Ga0070704_100134049 3300005549 Bacteria 1924
178 Ga0068855_100081398 3300005563 Bacteria 3753
179 Ga0068855_100095513 3300005563 Bacteria 3426
180 Ga0070664_100084724 3300005564 Bacteria 2736
181 Ga0070664_100098003 3300005564 Bacteria 2546
182 Ga0070664_100115896 3300005564 Bacteria 2342
183 Ga0068857_100155659 3300005577 Bacteria 2072
184 Ga0068857_100178235 3300005577 Bacteria 1934
185 Ga0068854_100020979 3300005578 Bacteria 4427
186 Ga0068854_100121479 3300005578 Bacteria 1984
187 Ga0068856_100002558 3300005614 Bacteria 18738
188 Ga0068856_100020454 3300005614 Bacteria 6428
189 Ga0068856_100022205 3300005614 Bacteria 6170
190 Ga0070702_100042084 3300005615 Bacteria 2566
191 Ga0070702_100073722 3300005615 Bacteria 2023
192 Ga0068852_100032557 3300005616 Bacteria 4317
193 Ga0068852_100052912 3300005616 Bacteria 3492
194 Ga0068859_100162372 3300005617 Bacteria 2313
195 Ga0068859_100297044 3300005617 Bacteria 1708
196 Ga0068864_100005666 3300005618 Bacteria 10233
197 Ga0068864_100021888 3300005618 Bacteria 5359
198 Ga0068864_100066986 3300005618 Bacteria 3118
199 Ga0068864_100079157 3300005618 Bacteria 2877
200 Ga0068864_100109804 3300005618 Unclassified 2455
201 Ga0068864_100152191 3300005618 Bacteria 2096
202 Ga0068864_100404572 3300005618 Bacteria 1298
203 Ga0068866_10001199 3300005718 Bacteria 11309
204 Ga0068866_10214296 3300005718 Unclassified 1158
205 Ga0068861_100007427 3300005719 Bacteria 7513
206 Ga0068861_100007735 3300005719 Bacteria 7382
207 Ga0068861_100043933 3300005719 Bacteria 3357
208 Ga0068861_100352498 3300005719 Bacteria 1291
209 Ga0068861_100415332 3300005719 Bacteria 1198
210 Ga0068851_10015987 3300005834 Bacteria 3584
211 Ga0068870_10032971 3300005840 Bacteria 2639
212 Ga0068870_10183553 3300005840 Unclassified 1257
213 Ga0068863_100003856 3300005841 Bacteria 14827
214 Ga0068863_100009671 3300005841 Bacteria 9408
215 Ga0068863_100088056 3300005841 Bacteria 2942
216 Ga0068863_100525950 3300005841 Unclassified 1166
217 Ga0068858_100001628 3300005842 Bacteria 22898
218 Ga0068858_100029195 3300005842 Bacteria 5120
219 Ga0068858_100056612 3300005842 Bacteria 3623
220 Ga0068858_100192775 3300005842 Bacteria 1925
221 Ga0068860_100005959 3300005843 Bacteria 12260
222 Ga0068860_100182508 3300005843 Bacteria 2028
223 Ga0068862_100017354 3300005844 Bacteria 5994
224 Ga0068862_100076834 3300005844 Unclassified 2890
225 Ga0068862_100124637 3300005844 Bacteria 2273
226 Ga0081455_10003973 3300005937 Bacteria 16771
227 Ga0081455_10072746 3300005937 Unclassified 2845
228 Ga0070717_10030609 3300006028 Bacteria 4323
229 Ga0070717_10031714 3300006028 Bacteria 4254
230 Ga0070717_10032244 3300006028 Bacteria 4221
231 Ga0070717_10206825 3300006028 Bacteria 1721
232 Ga0070717_10288862 3300006028 Bacteria 1456
233 Ga0070717_10404674 3300006028 Bacteria 1226
234 Ga0075365_10014278 3300006038 Bacteria 4775
235 Ga0075432_10010684 3300006058 Bacteria 3120
236 Ga0070715_10001323 3300006163 Bacteria 7141
237 Ga0070715_10006681 3300006163 Bacteria 3937
238 Ga0070716_100002434 3300006173 Bacteria 8575
239 Ga0070716_100083668 3300006173 Bacteria 1911
240 Ga0070716_100093447 3300006173 Bacteria 1826
241 Ga0070712_100019701 3300006175 Bacteria 4405
242 Ga0070712_100207453 3300006175 Bacteria 1543
243 Ga0075367_10006227 3300006178 Bacteria 6012
244 Ga0075367_10009190 3300006178 Bacteria 5155
245 Ga0075427_10002600 3300006194 Bacteria 2437
246 Ga0097621_100018205 3300006237 Bacteria 5358
247 Ga0097621_100045471 3300006237 Bacteria 3546
248 Ga0097621_100308440 3300006237 Bacteria 1399
249 Ga0068871_100012832 3300006358 Bacteria 6202
250 Ga0068871_100016881 3300006358 Bacteria 5511
251 Ga0068871_100049446 3300006358 Bacteria 3398
252 Ga0068871_100133617 3300006358 Unclassified 2105
253 Ga0068871_100336803 3300006358 Unclassified 1331
254 Ga0075428_100000444 3300006844 Bacteria 41278
255 Ga0075428_100026034 3300006844 Bacteria 6477
256 Ga0075428_100283637 3300006844 Bacteria 1782
257 Ga0075428_100484451 3300006844 Bacteria 1324
258 Ga0075430_100058970 3300006846 Bacteria 3226
259 Ga0075430_100106794 3300006846 Bacteria 2335
260 Ga0075431_100049404 3300006847 Bacteria 4337
261 Ga0075431_100084825 3300006847 Bacteria 3269
262 Ga0075431_100102192 3300006847 Bacteria 2958
263 Ga0075431_100190980 3300006847 Bacteria 2098
264 Ga0075433_10122194 3300006852 Bacteria 2313
265 Ga0075433_10152043 3300006852 Bacteria 2059
266 Ga0075433_10191100 3300006852 Unclassified 1821
267 Ga0075434_100000006 3300006871 Bacteria 96966
268 Ga0075434_100011911 3300006871 Bacteria 8224
269 Ga0075434_100038684 3300006871 Unclassified 4725
270 Ga0075434_100104628 3300006871 Bacteria 2840
271 Ga0075434_100123566 3300006871 Bacteria 2605
272 Ga0075434_100198571 3300006871 Bacteria 2025
273 Ga0075429_100015045 3300006880 Bacteria 6707
274 Ga0075429_100019934 3300006880 Bacteria 5815
275 Ga0075429_100036413 3300006880 Unclassified 4280
276 Ga0075429_100089486 3300006880 Bacteria 2683
277 Ga0068865_100000489 3300006881 Bacteria 22220
278 Ga0068865_100034004 3300006881 Bacteria 3417
279 Ga0068865_100068443 3300006881 Bacteria 2510
280 Ga0068865_100240053 3300006881 Bacteria 1425
281 Ga0075436_100037172 3300006914 Bacteria 3362
282 Ga0075436_100198146 3300006914 Bacteria 1422
283 Ga0097620_100162373 3300006931 Bacteria 2313
284 Ga0097620_100297080 3300006931 Bacteria 1708
285 Ga0075435_100001000 3300007076 Bacteria 17911
286 Ga0075435_100018614 3300007076 Bacteria 5288
287 Ga0075435_100052784 3300007076 Bacteria 3276
288 Ga0075435_100157818 3300007076 Bacteria 1909
289 Ga0075435_100222224 3300007076 Bacteria 1604
290 Ga0075435_100452341 3300007076 Unclassified 1107
291 Ga0099794_10045623 3300007265 Bacteria 2097
292 Ga0099794_10073726 3300007265 Bacteria 1675
293 Ga0105250_10102251 3300009092 Bacteria 1170
294 Ga0105240_10174648 3300009093 Bacteria 2541
295 Ga0105240_10181683 3300009093 Bacteria 2482
296 Ga0111539_10035538 3300009094 Bacteria 6031
297 Ga0111539_10067055 3300009094 Bacteria 4239
298 Ga0111539_10215320 3300009094 Bacteria 2238
299 Ga0105245_10003238 3300009098 Bacteria 14585
300 Ga0105245_10042386 3300009098 Bacteria 4061
301 Ga0105245_10144658 3300009098 Bacteria 2242
302 Ga0105245_10174288 3300009098 Unclassified 2050
303 Ga0105245_10259734 3300009098 Bacteria 1690
304 Ga0105247_10021218 3300009101 Unclassified 3908
305 Ga0105247_10023692 3300009101 Unclassified 3699
306 Ga0105247_10106130 3300009101 Bacteria 1801
307 Ga0105247_10195223 3300009101 Bacteria 1357
308 Ga0114129_10006726 3300009147 Bacteria 16322
309 Ga0114129_10018549 3300009147 Bacteria 9906
310 Ga0114129_10029075 3300009147 Bacteria 7829
311 Ga0114129_10047817 3300009147 Bacteria 6011
312 Ga0114129_10103731 3300009147 Bacteria 3931
313 Ga0114129_10150164 3300009147 Bacteria 3189
314 Ga0114129_10157563 3300009147 Bacteria 3104
315 Ga0114129_10232623 3300009147 Bacteria 2481
316 Ga0114129_10894651 3300009147 Bacteria 1125
317 Ga0105243_10004676 3300009148 Bacteria 10778
318 Ga0105243_10334624 3300009148 Unclassified 1384
319 Ga0105243_10344775 3300009148 Unclassified 1366
320 Ga0105243_10406658 3300009148 Unclassified 1266
321 Ga0105241_10111899 3300009174 Bacteria 2187
322 Ga0105241_10155660 3300009174 Bacteria 1874
323 Ga0105241_10168028 3300009174 Unclassified 1809
324 Ga0105242_10010539 3300009176 Bacteria 7097
325 Ga0105242_10051854 3300009176 Unclassified 3345
326 Ga0105242_10222323 3300009176 Bacteria 1688
327 Ga0105242_10296881 3300009176 Bacteria 1473
328 Ga0105248_10001658 3300009177 Bacteria 24784
329 Ga0105248_10004389 3300009177 Bacteria 15611
330 Ga0105248_10013419 3300009177 Bacteria 9018
331 Ga0105248_10066208 3300009177 Bacteria 4057
332 Ga0105248_10081789 3300009177 Bacteria 3631
333 Ga0105248_10318130 3300009177 Unclassified 1753
334 Ga0105237_10101222 3300009545 Bacteria 2873
335 Ga0105237_10128625 3300009545 Bacteria 2527
336 Ga0105237_10147150 3300009545 Bacteria 2351
337 Ga0105237_10366668 3300009545 Unclassified 1445
338 Ga0105238_10021494 3300009551 Bacteria 6573
339 Ga0105238_10124978 3300009551 Bacteria 2552
340 Ga0105238_10155539 3300009551 Bacteria 2262
341 Ga0105238_10520144 3300009551 Unclassified 1192
342 Ga0105249_10002449 3300009553 Bacteria 16104
343 Ga0105249_10091284 3300009553 Bacteria 2849
344 Ga0105249_10446595 3300009553 Bacteria 1331
345 Ga0105239_10053926 3300010375 Bacteria 4409
346 Ga0105239_10090744 3300010375 Bacteria 3371
347 Ga0105239_10106012 3300010375 Bacteria 3113
348 Ga0105239_10168581 3300010375 Bacteria 2448
349 Ga0105239_10511231 3300010375 Unclassified 1366
350 Ga0105246_10004552 3300011119 Bacteria 8437
351 Ga0105246_10018315 3300011119 Bacteria 4463
352 Ga0105246_10026071 3300011119 Bacteria 3814
353 Ga0105246_10028867 3300011119 Bacteria 3647
354 Ga0105246_10097515 3300011119 Bacteria 2133
355 Ga0105246_10364362 3300011119 Unclassified 1189
356 Ga0157373_10015572 3300013100 Bacteria 5558
357 Ga0157373_10094754 3300013100 Unclassified 2102
358 Ga0157371_10150595 3300013102 Bacteria 1659
359 Ga0157370_10061959 3300013104 Bacteria 3549
360 Ga0157369_10123245 3300013105 Bacteria 2749
361 Ga0157369_10415435 3300013105 Bacteria 1395
362 Ga0157374_10134215 3300013296 Unclassified 2398
363 Ga0157374_10162154 3300013296 Bacteria 2177
364 Ga0157374_10313007 3300013296 Bacteria 1555
365 Ga0157378_10026701 3300013297 Bacteria 5090
366 Ga0157378_10043417 3300013297 Bacteria 3992
367 Ga0157378_10191863 3300013297 Bacteria 1927
368 Ga0157378_10280724 3300013297 Bacteria 1605
369 Ga0157378_10315744 3300013297 Bacteria 1517
370 Ga0163162_10008439 3300013306 Bacteria 10047
371 Ga0163162_10012986 3300013306 Bacteria 8127
372 Ga0163162_10032019 3300013306 Bacteria 5219
373 Ga0163162_10040171 3300013306 Bacteria 4677
374 Ga0163162_10191338 3300013306 Bacteria 2174
375 Ga0163162_10211759 3300013306 Bacteria 2068
376 Ga0163162_10528918 3300013306 Bacteria 1308
377 Ga0163162_10542336 3300013306 Bacteria 1292
378 Ga0157372_10011197 3300013307 Bacteria 9541
379 Ga0157372_10720524 3300013307 Unclassified 1160
380 Ga0157375_10000947 3300013308 Bacteria 25144
381 Ga0157375_10019214 3300013308 Bacteria 6211
382 Ga0157375_10040715 3300013308 Unclassified 4481
383 Ga0157375_10103846 3300013308 Bacteria 2929
384 Ga0157375_10492350 3300013308 Bacteria 1391
385 Ga0163163_10075964 3300014325 Bacteria 3353
386 Ga0163163_10158606 3300014325 Bacteria 2307
387 Ga0163163_10364276 3300014325 Bacteria 1502
388 Ga0157380_10000934 3300014326 Bacteria 18442
389 Ga0157380_10026034 3300014326 Bacteria 4440
390 Ga0157380_10056036 3300014326 Bacteria 3133
391 Ga0157377_10018220 3300014745 Bacteria 3647
392 Ga0157377_10086061 3300014745 Bacteria 1847
393 Ga0157377_10154891 3300014745 Bacteria 1420
394 Ga0157379_10001638 3300014968 Bacteria 18483
395 Ga0157379_10040671 3300014968 Bacteria 4150
396 Ga0157379_10040890 3300014968 Unclassified 4138
397 Ga0157379_10079234 3300014968 Bacteria 2941
398 Ga0157379_10185662 3300014968 Bacteria 1879
399 Ga0157376_10000497 3300014969 Bacteria 25401
400 Ga0157376_10040770 3300014969 Unclassified 3797
401 Ga0157376_10072408 3300014969 Bacteria 2932
402 Ga0157376_10108064 3300014969 Bacteria 2443
403 Ga0157376_10111242 3300014969 Bacteria 2411
404 Ga0157376_10149872 3300014969 Unclassified 2102
405 Ga0157376_10150892 3300014969 Bacteria 2096
406 Ga0157376_10201476 3300014969 Bacteria 1832
407 Ga0157376_10245796 3300014969 Unclassified 1669
408 Ga0157376_10273870 3300014969 Bacteria 1587
409 Ga0163161_10001222 3300017792 Bacteria 19284
410 Ga0163161_10045089 3300017792 Bacteria 3178
411 Ga0163161_10058267 3300017792 Unclassified 2807
412 Ga0163161_10315797 3300017792 Unclassified 1234
413 Ga0213876_10025985 3300021384 Bacteria 3088
414 Ga0207666_1012854 3300025271 Unclassified 1171
415 Ga0207697_10008311 3300025315 Bacteria 4552
416 Ga0207697_10015479 3300025315 Unclassified 3151
417 Ga0207697_10090303 3300025315 Bacteria 1298
418 Ga0207692_10002319 3300025898 Bacteria 7311
419 Ga0207692_10015565 3300025898 Bacteria 3349
420 Ga0207692_10137885 3300025898 Bacteria 1384
421 Ga0207642_10044793 3300025899 Unclassified 1960
422 Ga0207710_10016911 3300025900 Bacteria 3089
423 Ga0207688_10022190 3300025901 Bacteria 3472
424 Ga0207688_10149694 3300025901 Unclassified 1378
425 Ga0207680_10074675 3300025903 Unclassified 2112
426 Ga0207680_10104322 3300025903 Bacteria 1827
427 Ga0207680_10126437 3300025903 Bacteria 1679
428 Ga0207647_10034247 3300025904 Bacteria 3244
429 Ga0207685_10002336 3300025905 Bacteria 4319
430 Ga0207685_10030812 3300025905 Bacteria 1914
431 Ga0207645_10001581 3300025907 Bacteria 18578
432 Ga0207645_10077239 3300025907 Bacteria 2133
433 Ga0207645_10263679 3300025907 Unclassified 1142
434 Ga0207643_10001702 3300025908 Bacteria 12341
435 Ga0207643_10094850 3300025908 Bacteria 1743
436 Ga0207705_10210251 3300025909 Bacteria 1476
437 Ga0207684_10005715 3300025910 Bacteria 11425
438 Ga0207684_10027002 3300025910 Bacteria 4895
439 Ga0207684_10157375 3300025910 Bacteria 1956
440 Ga0207684_10236506 3300025910 Bacteria 1576
441 Ga0207654_10111691 3300025911 Unclassified 1702
442 Ga0207707_10222666 3300025912 Bacteria 1642
443 Ga0207707_10246375 3300025912 Unclassified 1553
444 Ga0207695_10302729 3300025913 Unclassified 1490
445 Ga0207671_10066000 3300025914 Unclassified 2693
446 Ga0207693_10111071 3300025915 Bacteria 2150
447 Ga0207663_10019153 3300025916 Bacteria 3849
448 Ga0207663_10045880 3300025916 Bacteria 2690
449 Ga0207663_10055274 3300025916 Bacteria 2490
450 Ga0207663_10150270 3300025916 Bacteria 1633
451 Ga0207662_10080990 3300025918 Bacteria 1982
452 Ga0207662_10202943 3300025918 Bacteria 1284
453 Ga0207657_10016580 3300025919 Bacteria 7097
454 Ga0207657_10018338 3300025919 Bacteria 6684
455 Ga0207657_10324105 3300025919 Unclassified 1218
456 Ga0207649_10065432 3300025920 Bacteria 2301
457 Ga0207649_10229291 3300025920 Bacteria 1327
458 Ga0207652_10107107 3300025921 Bacteria 2475
459 Ga0207646_10360728 3300025922 Bacteria 1313
460 Ga0207681_10022757 3300025923 Bacteria 4000
461 Ga0207694_10017147 3300025924 Bacteria 5472
462 Ga0207650_10003891 3300025925 Bacteria 10207
463 Ga0207650_10031221 3300025925 Bacteria 3845
464 Ga0207650_10032713 3300025925 Bacteria 3763
465 Ga0207650_10157230 3300025925 Bacteria 1798
466 Ga0207650_10193685 3300025925 Unclassified 1625
467 Ga0207659_10004539 3300025926 Bacteria 8401
468 Ga0207659_10015811 3300025926 Bacteria 4901
469 Ga0207659_10027857 3300025926 Unclassified 3832
470 Ga0207659_10065442 3300025926 Bacteria 2634
471 Ga0207659_10069961 3300025926 Unclassified 2558
472 Ga0207659_10229314 3300025926 Bacteria 1497
473 Ga0207659_10244514 3300025926 Bacteria 1453
474 Ga0207687_10015370 3300025927 Bacteria 5018
475 Ga0207687_10091704 3300025927 Bacteria 2217
476 Ga0207687_10254205 3300025927 Bacteria 1398
477 Ga0207700_10006428 3300025928 Bacteria 7095
478 Ga0207700_10010795 3300025928 Bacteria 5791
479 Ga0207700_10011502 3300025928 Bacteria 5646
480 Ga0207700_10018717 3300025928 Bacteria 4661
481 Ga0207664_10027582 3300025929 Bacteria 4307
482 Ga0207664_10028620 3300025929 Bacteria 4236
483 Ga0207644_10058359 3300025931 Bacteria 2789
484 Ga0207644_10111276 3300025931 Bacteria 2071
485 Ga0207644_10143927 3300025931 Bacteria 1838
486 Ga0207644_10163751 3300025931 Bacteria 1731
487 Ga0207644_10200141 3300025931 Bacteria 1575
488 Ga0207690_10017063 3300025932 Bacteria 4427
489 Ga0207706_10001938 3300025933 Bacteria 20310
490 Ga0207706_10002250 3300025933 Bacteria 18839
491 Ga0207706_10019693 3300025933 Bacteria 6070
492 Ga0207706_10069336 3300025933 Bacteria 3101
493 Ga0207706_10316094 3300025933 Bacteria 1359
494 Ga0207686_10013376 3300025934 Bacteria 4539
495 Ga0207686_10128383 3300025934 Bacteria 1736
496 Ga0207709_10006456 3300025935 Bacteria 6585
497 Ga0207709_10013344 3300025935 Unclassified 4534
498 Ga0207709_10107375 3300025935 Bacteria 1859
499 Ga0207670_10114540 3300025936 Unclassified 1949
500 Ga0207669_10001842 3300025937 Bacteria 8987
501 Ga0207669_10091101 3300025937 Bacteria 1985
502 Ga0207704_10001074 3300025938 Bacteria 12159
503 Ga0207704_10045525 3300025938 Bacteria 2607
504 Ga0207704_10215426 3300025938 Unclassified 1417
505 Ga0207665_10013355 3300025939 Bacteria 5399
506 Ga0207665_10027580 3300025939 Bacteria 3751
507 Ga0207665_10053118 3300025939 Bacteria 2731
508 Ga0207665_10096468 3300025939 Bacteria 2057
509 Ga0207691_10050261 3300025940 Bacteria 3817
510 Ga0207691_10101840 3300025940 Bacteria 2562
511 Ga0207691_10106371 3300025940 Unclassified 2499
512 Ga0207691_10118127 3300025940 Bacteria 2353
513 Ga0207691_10158245 3300025940 Bacteria 1988
514 Ga0207691_10188170 3300025940 Bacteria 1802
515 Ga0207711_10005483 3300025941 Bacteria 10724
516 Ga0207711_10009834 3300025941 Bacteria 7953
517 Ga0207711_10016467 3300025941 Bacteria 6142
518 Ga0207711_10053601 3300025941 Bacteria 3459
519 Ga0207711_10062045 3300025941 Bacteria 3224
520 Ga0207711_10196875 3300025941 Bacteria 1838
521 Ga0207689_10001309 3300025942 Bacteria 24002
522 Ga0207689_10002016 3300025942 Bacteria 19197
523 Ga0207689_10026191 3300025942 Bacteria 4884
524 Ga0207689_10055899 3300025942 Bacteria 3247
525 Ga0207689_10093036 3300025942 Bacteria 2476
526 Ga0207689_10422139 3300025942 Bacteria 1113
527 Ga0207661_10007066 3300025944 Bacteria 7969
528 Ga0207661_10093395 3300025944 Bacteria 2511
529 Ga0207661_10110547 3300025944 Bacteria 2323
530 Ga0207661_10331203 3300025944 Bacteria 1370
531 Ga0207679_10088710 3300025945 Bacteria 2385
532 Ga0207679_10150075 3300025945 Bacteria 1896
533 Ga0207667_10093794 3300025949 Bacteria 3100
534 Ga0207651_10024253 3300025960 Bacteria 3748
535 Ga0207651_10059839 3300025960 Bacteria 2641
536 Ga0207651_10062386 3300025960 Unclassified 2597
537 Ga0207651_10251809 3300025960 Bacteria 1445
538 Ga0207712_10001648 3300025961 Bacteria 15022
539 Ga0207712_10053488 3300025961 Bacteria 2833
540 Ga0207668_10003006 3300025972 Bacteria 9883
541 Ga0207668_10045090 3300025972 Bacteria 3005
542 Ga0207668_10057516 3300025972 Bacteria 2713
543 Ga0207668_10057770 3300025972 Bacteria 2708
544 Ga0207668_10098757 3300025972 Bacteria 2164
545 Ga0207640_10072425 3300025981 Bacteria 2324
546 Ga0207658_10001120 3300025986 Bacteria 21630
547 Ga0207658_10022773 3300025986 Unclassified 4364
548 Ga0207677_10187446 3300026023 Bacteria 1633
549 Ga0207703_10024428 3300026035 Bacteria 4755
550 Ga0207703_10032621 3300026035 Bacteria 4122
551 Ga0207703_10092161 3300026035 Bacteria 2550
552 Ga0207703_10250278 3300026035 Bacteria 1597
553 Ga0207703_10337456 3300026035 Bacteria 1384
554 Ga0207639_10022082 3300026041 Unclassified 4580
555 Ga0207639_10071600 3300026041 Bacteria 2712
556 Ga0207678_10003973 3300026067 Bacteria 13303
557 Ga0207678_10017829 3300026067 Bacteria 6234
558 Ga0207678_10039877 3300026067 Bacteria 4074
559 Ga0207678_10055192 3300026067 Bacteria 3422
560 Ga0207678_10065330 3300026067 Bacteria 3124
561 Ga0207708_10002050 3300026075 Bacteria 14854
562 Ga0207708_10019350 3300026075 Bacteria 5131
563 Ga0207702_10010786 3300026078 Bacteria 7625
564 Ga0207702_10016471 3300026078 Bacteria 6117
565 Ga0207702_10070948 3300026078 Bacteria 2998
566 Ga0207702_10132835 3300026078 Bacteria 2242
567 Ga0207702_10476480 3300026078 Unclassified 1214
568 Ga0207641_10004026 3300026088 Bacteria 12828
569 Ga0207641_10011650 3300026088 Bacteria 7220
570 Ga0207641_10033637 3300026088 Bacteria 4258
571 Ga0207641_10040080 3300026088 Bacteria 3919
572 Ga0207641_10583954 3300026088 Unclassified 1092
573 Ga0207648_10004966 3300026089 Bacteria 13532
574 Ga0207648_10054652 3300026089 Bacteria 3487
575 Ga0207648_10089055 3300026089 Bacteria 2695
576 Ga0207648_10105343 3300026089 Unclassified 2474
577 Ga0207648_10288469 3300026089 Bacteria 1469
578 Ga0207676_10031151 3300026095 Bacteria 4009
579 Ga0207676_10178014 3300026095 Bacteria 1859
580 Ga0207676_10357550 3300026095 Bacteria 1352
581 Ga0207674_10066804 3300026116 Bacteria 3621
582 Ga0207674_10161838 3300026116 Bacteria 2192
583 Ga0207675_100002143 3300026118 Bacteria 19595
584 Ga0207675_100004017 3300026118 Bacteria 14267
585 Ga0207675_100011609 3300026118 Bacteria 8236
586 Ga0207675_100110210 3300026118 Unclassified 2597
587 Ga0207675_100242509 3300026118 Bacteria 1742
588 Ga0207675_100493722 3300026118 Bacteria 1218
589 Ga0207683_10008947 3300026121 Bacteria 8528
590 Ga0207683_10022981 3300026121 Bacteria 5360
591 Ga0207683_10049841 3300026121 Unclassified 3666
592 Ga0207683_10086952 3300026121 Bacteria 2780
593 Ga0207683_10152960 3300026121 Bacteria 2083
594 Ga0207683_10314397 3300026121 Unclassified 1434
595 Ga0207683_10433784 3300026121 Unclassified 1211
596 Ga0207698_10016333 3300026142 Bacteria 5001
597 Ga0210002_1000480 3300027617 Bacteria 5430
598 Ga0209998_10004149 3300027717 Bacteria 3090
599 Ga0209974_10015016 3300027876 Bacteria 2572
600 Ga0207428_10026774 3300027907 Bacteria 4807
601 Ga0207428_10033415 3300027907 Bacteria 4225
602 Ga0268266_10068218 3300028379 Bacteria 3079
603 Ga0268266_10089370 3300028379 Bacteria 2697
604 Ga0268265_10011377 3300028380 Bacteria 6017
605 Ga0268265_10079071 3300028380 Bacteria 2589
606 Ga0268265_10215411 3300028380 Bacteria 1676
607 Ga0268264_10059114 3300028381 Bacteria 3211
608 Ga0268264_10132586 3300028381 Bacteria 2211
609 Ga0373958_0004188 3300034819 Bacteria 2121
610 Ga0373928_0017118 3300035084 Bacteria 1489
611 Ga0373944_0004942 3300035089 Bacteria 3496
612 Ga0373944_0052525 3300035089 Bacteria 1288
613 Ga0373932_0043622 3300035112 Bacteria 1305
614 Ga0373945_0004916 3300035116 Bacteria 4259
615 Ga0373960_0024062 3300035121 Bacteria 1644
616 Ga0373960_0057730 3300035121 Bacteria 1169
617 Ga0373946_0030790 3300035171 Bacteria 2144
618 Ga0373942_0003209 3300035207 Unclassified 3865
619 Ga0373962_0039419 3300035242 Bacteria 1325
620 Ga0373931_0011437 3300035691 Bacteria 4288
621 Ga0373935_0003786 3300035692 Bacteria 8832
622 Ga0373935_0081081 3300035692 Bacteria 2109
623 Ga0373935_0187445 3300035692 Bacteria 1423
624 Ga0373927_0005078 3300035695 Bacteria 9106
625 Ga0373947_0003596 3300035725 Bacteria 9141
626 Ga0373947_0084664 3300035725 Bacteria 1968
627 Ga0373937_0183364 3300036401 Unclassified 1966
628 Ga0373925_0178821 3300037068 Bacteria 1678
629 Ga0395899_0093652 3300037312 Bacteria 2174
630 Ga0395900_0036651 3300037418 Bacteria 5056
631 Ga0395898_0056057 3300037466 Bacteria 3843
632 Ga0395901_0098722 3300038443 Bacteria 3062
633 Ga0436365_0603453 3300039437 Bacteria 22491
634 Ga0451577_0038108 3300042876 Bacteria 4324
635 Ga0466963_0015264 3300044694 Bacteria 4752
636 Ga0466967_0065364 3300045976 Bacteria 3237
637 Ga0495592_0147327 3300046454 Bacteria 1631
638 Ga0495629_0004872 3300046459 Bacteria 10073
639 Ga0495629_0020743 3300046459 Bacteria 4691
640 Ga0495641_0019012 3300046461 Bacteria 3528
641 Ga0495641_0055914 3300046461 Bacteria 1790
642 Ga0495653_0116607 3300046463 Bacteria 1909
643 Ga0495580_0033653 3300046472 Unclassified 3691
644 Ga0495580_0136800 3300046472 Bacteria 1699
645 Ga0495582_0049720 3300046473 Bacteria 2309
646 Ga0495639_0025320 3300046475 Bacteria 2616
647 Ga0495662_0085214 3300046476 Bacteria 1538
648 Ga0495664_0018922 3300046477 Bacteria 3953
649 Ga0495594_0108250 3300046499 Bacteria 1566
650 Ga0495594_0233497 3300046499 Bacteria 1048
651 Ga0495666_0069776 3300046526 Bacteria 1672
652 Ga0495652_0168068 3300046529 Bacteria 1695
653 Ga0495652_0314135 3300046529 Bacteria 1134
654 Ga0495640_0007576 3300046533 Bacteria 8529
655 Ga0495645_0020797 3300046543 Bacteria 4741
656 Ga0495656_0026012 3300046615 Bacteria 2326
657 Ga0495634_0013365 3300046642 Bacteria 5932
658 Ga0495635_0045902 3300046663 Bacteria 3014
659 Ga0495599_0021227 3300046678 Unclassified 4050
660 Ga0495647_0016619 3300046681 Bacteria 2593
661 Ga0495647_0059259 3300046681 Bacteria 1507
662 Ga0495658_0002353 3300046683 Bacteria 9548
663 Ga0495658_0109986 3300046683 Bacteria 1656
664 Ga0495613_0014240 3300046689 Bacteria 5902
665 Ga0495613_0051889 3300046689 Bacteria 3022
666 Ga0495624_0008421 3300046690 Bacteria 7190
667 Ga0495624_0205267 3300046690 Bacteria 1196
668 Ga0495581_0112554 3300047315 Bacteria 1582
669 Ga0495604_0213285 3300047317 Bacteria 1333
670 Ga0495636_0097866 3300047318 Bacteria 1280
671 Ga0495676_0029756 3300047321 Bacteria 4646
672 Ga0495676_0042354 3300047321 Bacteria 3739
673 Ga0495676_0069292 3300047321 Bacteria 2722
674 Ga0495676_0247487 3300047321 Bacteria 1218
675 Ga0495684_0013309 3300047471 Bacteria 6339
676 Ga0495593_0014345 3300047673 Plasmid 4505
677 Ga0496100_0001168 3300048903 Bacteria 12758
678 Ga0496100_0005170 3300048903 Bacteria 7000
679 Ga0496100_0061981 3300048903 Bacteria 2466
680 Ga0496100_0083650 3300048903 Bacteria 2161
681 Ga0496101_0001061 3300048904 Bacteria 16247
682 Ga0496101_0015762 3300048904 Bacteria 5101
683 Ga0496101_0018966 3300048904 Bacteria 4687
684 Ga0496101_0019389 3300048904 Bacteria 4643
685 Ga0496101_0302607 3300048904 Bacteria 1253
686 Ga0496102_0003259 3300048905 Bacteria 13765
687 Ga0496102_0017050 3300048905 Bacteria 6356
688 Ga0496102_0028398 3300048905 Bacteria 4996
689 Ga0496102_0055823 3300048905 Bacteria 3602
690 Ga0496102_0066527 3300048905 Bacteria 3303
691 Ga0496102_0093971 3300048905 Bacteria 2778
692 Ga0496103_0001620 3300048906 Bacteria 14765
693 Ga0496103_0008890 3300048906 Bacteria 5957
694 Ga0496103_0022056 3300048906 Bacteria 3833
695 Ga0496103_0091332 3300048906 Bacteria 1921
696 Ga0496104_0001014 3300048907 Bacteria 24071
697 Ga0496104_0019352 3300048907 Bacteria 6226
698 Ga0496104_0040311 3300048907 Bacteria 4377
699 Ga0496105_0000651 3300048908 Bacteria 23264
700 Ga0496105_0028481 3300048908 Bacteria 4567
701 Ga0496105_0088666 3300048908 Bacteria 2555
702 Ga0496105_0230868 3300048908 Bacteria 1504
703 Ga0496105_0251724 3300048908 Unclassified 1431
704 Ga0496106_0002729 3300048909 Bacteria 13080
705 Ga0496106_0003791 3300048909 Bacteria 11266
706 Ga0496106_0062148 3300048909 Unclassified 2835
707 Ga0496106_0081679 3300048909 Bacteria 2483
708 Ga0496106_0169936 3300048909 Bacteria 1728
709 Ga0496106_0378484 3300048909 Bacteria 1137
710 Ga0496106_0390936 3300048909 Bacteria 1118
711 Ga0496107_0000128 3300048910 Bacteria 36808
712 Ga0496107_0004872 3300048910 Bacteria 9119
713 Ga0496107_0058446 3300048910 Bacteria 2788
714 Ga0496107_0190234 3300048910 Unclassified 1525
715 Ga0496108_0007538 3300048911 Bacteria 8819
716 Ga0496108_0035512 3300048911 Bacteria 4144
717 Ga0496108_0059836 3300048911 Bacteria 3204
718 Ga0496108_0221158 3300048911 Bacteria 1645
719 Ga0496108_0311961 3300048911 Bacteria 1371
720 Ga0496108_0418388 3300048911 Bacteria 1170
721 Ga0496109_0015782 3300048912 Bacteria 6593
722 Ga0496109_0030945 3300048912 Bacteria 4798
723 Ga0496109_0099774 3300048912 Bacteria 2693
724 Ga0496109_0537404 3300048912 Bacteria 1103
725 Ga0496110_0039268 3300048913 Bacteria 4121
726 Ga0496110_0052018 3300048913 Bacteria 3600
727 Ga0496110_0054211 3300048913 Bacteria 3526
728 Ga0496110_0062208 3300048913 Bacteria 3296
729 Ga0496110_0080086 3300048913 Bacteria 2910
730 Ga0496110_0083904 3300048913 Bacteria 2843
731 Ga0496110_0089627 3300048913 Unclassified 2749
732 Ga0496110_0309579 3300048913 Bacteria 1439
733 Ga0496111_0141953 3300048914 Bacteria 1780
734 Ga0496111_0188299 3300048914 Bacteria 1534
735 Ga0496112_0002907 3300048915 Bacteria 13941
736 Ga0496112_0081964 3300048915 Bacteria 3190
737 Ga0496112_0144056 3300048915 Bacteria 2351
738 Ga0496112_0208260 3300048915 Bacteria 1913
739 Ga0496113_0040243 3300048916 Bacteria 3443
740 Ga0496114_0000798 3300048917 Bacteria 23548
741 Ga0496114_0005350 3300048917 Bacteria 10034
742 Ga0496114_0016033 3300048917 Bacteria 6029
743 Ga0496114_0060942 3300048917 Bacteria 3154
744 Ga0496114_0248169 3300048917 Bacteria 1566
745 Ga0496115_0000863 3300048918 Bacteria 22027
746 Ga0496115_0021330 3300048918 Bacteria 5003
747 Ga0496115_0026788 3300048918 Bacteria 4503
748 Ga0496115_0051433 3300048918 Bacteria 3304
749 Ga0496115_0144709 3300048918 Bacteria 1961
750 Ga0496115_0221857 3300048918 Bacteria 1560
751 Ga0501038_0068351 3300049574 Bacteria 3020
752 Ga0501041_0194920 3300049577 Unclassified 1269
753 Ga0501046_0046754 3300049580 Bacteria 3434
754 Ga0501068_0109468 3300049584 Unclassified 1717
755 Ga0501075_0022847 3300049591 Bacteria 4574
756 Ga0501075_0107827 3300049591 Bacteria 2117
757 Ga0501076_0189991 3300049592 Unclassified 1676
758 Ga0501076_0382363 3300049592 Bacteria 1157
759 Ga0501079_0032638 3300049741 Bacteria 4004
760 Ga0501079_0060436 3300049741 Unclassified 2923
761 Ga0501081_0002573 3300049743 Bacteria 11459
762 Ga0501045_0183242 3300049824 Unclassified 1560
763 nmdc:mga0k408_33269_c1 3300050493 Bacteria 2948
764 nmdc:mga05p37_100429_c1 3300050507 Bacteria 3564
765 nmdc:mga05p37_1228_c1 3300050507 Bacteria 29701
766 nmdc:mga05p37_240584_c1 3300050507 Bacteria 2177
767 nmdc:mga05p37_240995_c1 3300050507 Bacteria 2174
768 nmdc:mga05p37_264064_c1 3300050507 Bacteria 2059
769 nmdc:mga05p37_45786_c1 3300050507 Bacteria 5380
770 nmdc:mga05p37_4626_c1 3300050507 Bacteria 16088
771 nmdc:mga05p37_5837_c1 3300050507 Bacteria 14478
772 nmdc:mga05p37_79587_c1 3300050507 Bacteria 4036
773 nmdc:mga05p37_96150_c1 3300050507 Bacteria 3649
774 nmdc:mga09592_129365_c1 3300050508 Unclassified 2172
775 nmdc:mga09592_55877_c1 3300050508 Bacteria 3336
776 nmdc:mga09592_83464_c1 3300050508 Bacteria 2724
777 nmdc:mga09592_96515_c1 3300050508 Bacteria 2529
778 nmdc:mga0qj67_214013_c1 3300050509 Bacteria 1565
779 nmdc:mga0qj67_56576_c1 3300050509 Bacteria 3109
780 nmdc:mga06r32_127729_c1 3300050510 Bacteria 2512
781 nmdc:mga06r32_179746_c1 3300050510 Bacteria 2101
782 nmdc:mga06r32_41932_c1 3300050510 Bacteria 4350
783 nmdc:mga06r32_66314_c1 3300050510 Bacteria 3483
784 nmdc:mga08y16_214172_c1 3300050511 Bacteria 1995
785 nmdc:mga08y16_9287_c1 3300050511 Bacteria 10314
786 nmdc:mga08y16_94890_c1 3300050511 Bacteria 3108
787 nmdc:mga0n895_141047_c1 3300050512 Bacteria 2438
788 nmdc:mga0n895_16499_c1 3300050512 Bacteria 6779
789 nmdc:mga0n895_338656_c1 3300050512 Bacteria 1524
790 nmdc:mga0n895_86_c1 3300050512 Bacteria 53794
791 nmdc:mga0n895_99189_c1 3300050512 Bacteria 2921
792 nmdc:mga0rr50_147235_c1 3300050513 Bacteria 1900
793 nmdc:mga0rr50_54695_c1 3300050513 Bacteria 2975
794 nmdc:mga08x19_34361_c1 3300050514 Bacteria 3204
795 nmdc:mga08x19_77197_c1 3300050514 Bacteria 2181
796 nmdc:mga0a205_157543_c1 3300050515 Bacteria 2169
797 Ga0495601_0008787 3300053077 Bacteria 5960
798 Ga0495601_0010293 3300053077 Bacteria 5561
799 Ga0495601_0026357 3300053077 Bacteria 3589
800 Ga0495612_0059128 3300053078 Bacteria 1584
801 Ga0495595_0074802 3300053084 Bacteria 1606
802 Ga0495619_0000264 3300053085 Bacteria 38172
803 Ga0495619_0003681 3300053085 Bacteria 9883
804 Ga0495619_0007454 3300053085 Bacteria 6932
805 Ga0495619_0216567 3300053085 Bacteria 1326
806 Ga0495619_0308771 3300053085 Bacteria 1095
807 Ga0501084_0028338 3300054114 Bacteria 4681
808 Ga0501084_0325272 3300054114 Unclassified 1299
809 Ga0501082_0027329 3300060353 Bacteria 4913
810 Ga0501082_0267584 3300060353 Unclassified 1487
811 Ga0530510_0086545 3300061734 Bacteria 2283
812 Ga0163162_10287769
813 MRS1b_contig_6784039
814 MBSR1b_contig_882870
815 JGI24032J14994_100295
816 JGI24739J22299_10031835
817 JGI24737J22298_10014591
818 JGI24737J22298_10047911
819 JGI24738J21930_10002922
820 JGI24034J26672_10011736
821 JGI24742J22300_10015015
822 Ga0065712_10144697
823 Ga0065715_10113088
824 Ga0070676_10001115
825 Ga0070676_10013710
826 Ga0070676_10029868
827 Ga0070676_10082049
828 Ga0070683_100061328
829 Ga0070683_100209036
830 Ga0070683_100397825
831 Ga0070690_100000733
832 Ga0070690_100001204
833 Ga0070690_100070373
834 Ga0070690_100158791
835 Ga0070670_100002717
836 Ga0070670_100006462
837 Ga0070670_100102618
838 Ga0070670_100110672
839 Ga0070670_100214119
840 Ga0070677_10025019
841 Ga0070677_10053499
842 Ga0070677_10080122
843 Ga0068869_100005375
844 Ga0068869_100012072
845 Ga0068869_100154619
846 Ga0070666_10004816
847 Ga0070666_10029470
848 Ga0070666_10181837
849 Ga0070680_100270198
850 Ga0070682_100083950
851 Ga0068868_100010228
852 Ga0068868_100041488
853 Ga0068868_100041715
854 Ga0068868_100047575
855 Ga0070660_100174536
856 Ga0070660_100179531
857 Ga0070660_100391315
858 Ga0070689_100082006
859 Ga0070687_100000465
860 Ga0070687_100022739
861 Ga0070687_100030154
862 Ga0070661_100046743
863 Ga0070661_100214522
864 Ga0070661_100248921
865 Ga0070692_10032790
866 Ga0070668_100004443
867 Ga0070668_100008982
868 Ga0070668_100024181
869 Ga0070669_100005480
870 Ga0070669_100009462
871 Ga0070669_100021046
872 Ga0070669_100213970
873 Ga0070675_100001596
874 Ga0070675_100004885
875 Ga0070675_100069815
876 Ga0070675_100099265
877 Ga0070675_100203341
878 Ga0070675_100371494
879 Ga0070671_100045459
880 Ga0070671_100067213
881 Ga0070671_100133028
882 Ga0070671_100148073
883 Ga0070671_100295644
884 Ga0070674_100003460
885 Ga0070674_100058198
886 Ga0070674_100112755
887 Ga0070674_100120838
888 Ga0070673_100047511
889 Ga0070673_100131683
890 Ga0070673_100241564
891 Ga0070673_100268794
892 Ga0070673_100293829
893 Ga0070688_100033917
894 Ga0070688_100036214
895 Ga0070688_100057094
896 Ga0070688_100088255
897 Ga0070659_100023095
898 Ga0070659_100041128
899 Ga0070659_100088830
900 Ga0070667_100001597
901 Ga0070667_100088517
902 Ga0070667_100092440
903 Ga0070667_100140459
904 Ga0070667_100334786
905 Ga0070709_10027792
906 Ga0070709_10029795
907 Ga0070709_10038516
908 Ga0070714_100010139
909 Ga0070714_100016417
910 Ga0070714_100031548
911 Ga0070713_100015296
912 Ga0070713_100061564
913 Ga0070713_100076862
914 Ga0070713_100144625
915 Ga0070710_10001879
916 Ga0070710_10053428
917 Ga0070710_10078254
918 Ga0070701_10000282
919 Ga0070711_100006902
920 Ga0070711_100009195
921 Ga0070711_100023613
922 Ga0070711_100252050
923 Ga0070705_100274994
924 Ga0070700_100018008
925 Ga0070700_100025736
926 Ga0070694_100210299
927 Ga0070708_100080885
928 Ga0070708_100205136
929 Ga0070663_100025241
930 Ga0070663_100027024
931 Ga0070663_100053332
932 Ga0070663_100122404
933 Ga0070678_100005950
934 Ga0070678_100010050
935 Ga0070678_100032812
936 Ga0070678_100077813
937 Ga0070678_100112973
938 Ga0070678_100128339
939 Ga0070678_100136064
940 Ga0070678_100186848
941 Ga0070662_100001112
942 Ga0070662_100001931
943 Ga0070662_100014907
944 Ga0070662_100202110
945 Ga0070662_100246805
946 Ga0070681_10161265
947 Ga0070681_10337953
948 Ga0070681_10351017
949 Ga0070681_10407252
950 Ga0068867_100046895
951 Ga0068867_100056783
952 Ga0068867_100059993
953 Ga0068867_100135679
954 Ga0068867_100290969
955 Ga0070706_100017695
956 Ga0070706_100190562
957 Ga0070706_100219154
958 Ga0070707_100076955
959 Ga0070707_100129903
960 Ga0070707_100223078
961 Ga0070707_100310448
962 Ga0070698_100025627
963 Ga0070698_100054325
964 Ga0070698_100062180
965 Ga0070699_100006150
966 Ga0070699_100080725
967 Ga0070679_100519633
968 Ga0070684_100030869
969 Ga0070684_100332893
970 Ga0070697_100082684
971 Ga0068853_100001828
972 Ga0068853_100145834
973 Ga0070672_100065752
974 Ga0070672_100097215
975 Ga0070672_100137974
976 Ga0070686_100017643
977 Ga0070686_100190731
978 Ga0070695_100067577
979 Ga0070695_100125644
980 Ga0070696_100319492
981 Ga0070693_100037127
982 Ga0070693_100143054
983 Ga0070665_100099009
984 Ga0070665_100230175
985 Ga0070665_100329006
986 Ga0070704_100061598
987 Ga0070704_100112370
988 Ga0070704_100134049
989 Ga0068855_100081398
990 Ga0068855_100095513
991 Ga0070664_100084724
992 Ga0070664_100098003
993 Ga0070664_100115896
994 Ga0068857_100155659
995 Ga0068857_100178235
996 Ga0068854_100020979
997 Ga0068854_100121479
998 Ga0068856_100002558
999 Ga0068856_100020454
1000 Ga0068856_100022205
1001 Ga0070702_100042084
1002 Ga0070702_100073722
1003 Ga0068852_100032557
1004 Ga0068852_100052912
1005 Ga0068859_100162372
1006 Ga0068859_100297044
1007 Ga0068864_100005666
1008 Ga0068864_100021888
1009 Ga0068864_100066986
1010 Ga0068864_100079157
1011 Ga0068864_100109804
1012 Ga0068864_100152191
1013 Ga0068864_100404572
1014 Ga0068866_10001199
1015 Ga0068866_10214296
1016 Ga0068861_100007427
1017 Ga0068861_100007735
1018 Ga0068861_100043933
1019 Ga0068861_100352498
1020 Ga0068861_100415332
1021 Ga0068851_10015987
1022 Ga0068870_10032971
1023 Ga0068870_10183553
1024 Ga0068863_100003856
1025 Ga0068863_100009671
1026 Ga0068863_100088056
1027 Ga0068863_100525950
1028 Ga0068858_100001628
1029 Ga0068858_100029195
1030 Ga0068858_100056612
1031 Ga0068858_100192775
1032 Ga0068860_100005959
1033 Ga0068860_100182508
1034 Ga0068862_100017354
1035 Ga0068862_100076834
1036 Ga0068862_100124637
1037 Ga0081455_10003973
1038 Ga0081455_10072746
1039 Ga0070717_10030609
1040 Ga0070717_10031714
1041 Ga0070717_10032244
1042 Ga0070717_10206825
1043 Ga0070717_10288862
1044 Ga0070717_10404674
1045 Ga0075365_10014278
1046 Ga0075432_10010684
1047 Ga0070715_10001323
1048 Ga0070715_10006681
1049 Ga0070716_100002434
1050 Ga0070716_100083668
1051 Ga0070716_100093447
1052 Ga0070712_100019701
1053 Ga0070712_100207453
1054 Ga0075367_10006227
1055 Ga0075367_10009190
1056 Ga0075427_10002600
1057 Ga0097621_100018205
1058 Ga0097621_100045471
1059 Ga0097621_100308440
1060 Ga0068871_100012832
1061 Ga0068871_100016881
1062 Ga0068871_100049446
1063 Ga0068871_100133617
1064 Ga0068871_100336803
1065 Ga0075428_100000444
1066 Ga0075428_100026034
1067 Ga0075428_100283637
1068 Ga0075428_100484451
1069 Ga0075430_100058970
1070 Ga0075430_100106794
1071 Ga0075431_100049404
1072 Ga0075431_100084825
1073 Ga0075431_100102192
1074 Ga0075431_100190980
1075 Ga0075433_10122194
1076 Ga0075433_10152043
1077 Ga0075433_10191100
1078 Ga0075434_100000006
1079 Ga0075434_100011911
1080 Ga0075434_100038684
1081 Ga0075434_100104628
1082 Ga0075434_100123566
1083 Ga0075434_100198571
1084 Ga0075429_100015045
1085 Ga0075429_100019934
1086 Ga0075429_100036413
1087 Ga0075429_100089486
1088 Ga0068865_100000489
1089 Ga0068865_100034004
1090 Ga0068865_100068443
1091 Ga0068865_100240053
1092 Ga0075436_100037172
1093 Ga0075436_100198146
1094 Ga0097620_100162373
1095 Ga0097620_100297080
1096 Ga0075435_100001000
1097 Ga0075435_100018614
1098 Ga0075435_100052784
1099 Ga0075435_100157818
1100 Ga0075435_100222224
1101 Ga0075435_100452341
1102 Ga0099794_10045623
1103 Ga0099794_10073726
1104 Ga0105250_10102251
1105 Ga0105240_10174648
1106 Ga0105240_10181683
1107 Ga0111539_10035538
1108 Ga0111539_10067055
1109 Ga0111539_10215320
1110 Ga0105245_10003238
1111 Ga0105245_10042386
1112 Ga0105245_10144658
1113 Ga0105245_10174288
1114 Ga0105245_10259734
1115 Ga0105247_10021218
1116 Ga0105247_10023692
1117 Ga0105247_10106130
1118 Ga0105247_10195223
1119 Ga0114129_10006726
1120 Ga0114129_10018549
1121 Ga0114129_10029075
1122 Ga0114129_10047817
1123 Ga0114129_10103731
1124 Ga0114129_10150164
1125 Ga0114129_10157563
1126 Ga0114129_10232623
1127 Ga0114129_10894651
1128 Ga0105243_10004676
1129 Ga0105243_10334624
1130 Ga0105243_10344775
1131 Ga0105243_10406658
1132 Ga0105241_10111899
1133 Ga0105241_10155660
1134 Ga0105241_10168028
1135 Ga0105242_10010539
1136 Ga0105242_10051854
1137 Ga0105242_10222323
1138 Ga0105242_10296881
1139 Ga0105248_10001658
1140 Ga0105248_10004389
1141 Ga0105248_10013419
1142 Ga0105248_10066208
1143 Ga0105248_10081789
1144 Ga0105248_10318130
1145 Ga0105237_10101222
1146 Ga0105237_10128625
1147 Ga0105237_10147150
1148 Ga0105237_10366668
1149 Ga0105238_10021494
1150 Ga0105238_10124978
1151 Ga0105238_10155539
1152 Ga0105238_10520144
1153 Ga0105249_10002449
1154 Ga0105249_10091284
1155 Ga0105249_10446595
1156 Ga0105239_10053926
1157 Ga0105239_10090744
1158 Ga0105239_10106012
1159 Ga0105239_10168581
1160 Ga0105239_10511231
1161 Ga0105246_10004552
1162 Ga0105246_10018315
1163 Ga0105246_10026071
1164 Ga0105246_10028867
1165 Ga0105246_10097515
1166 Ga0105246_10364362
1167 Ga0157373_10015572
1168 Ga0157373_10094754
1169 Ga0157371_10150595
1170 Ga0157370_10061959
1171 Ga0157369_10123245
1172 Ga0157369_10415435
1173 Ga0157374_10134215
1174 Ga0157374_10162154
1175 Ga0157374_10313007
1176 Ga0157378_10026701
1177 Ga0157378_10043417
1178 Ga0157378_10191863
1179 Ga0157378_10280724
1180 Ga0157378_10315744
1181 Ga0163162_10008439
1182 Ga0163162_10012986
1183 Ga0163162_10032019
1184 Ga0163162_10040171
1185 Ga0163162_10191338
1186 Ga0163162_10211759
1187 Ga0163162_10528918
1188 Ga0163162_10542336
1189 Ga0157372_10011197
1190 Ga0157372_10720524
1191 Ga0157375_10000947
1192 Ga0157375_10019214
1193 Ga0157375_10040715
1194 Ga0157375_10103846
1195 Ga0157375_10492350
1196 Ga0163163_10075964
1197 Ga0163163_10158606
1198 Ga0163163_10364276
1199 Ga0157380_10000934
1200 Ga0157380_10026034
1201 Ga0157380_10056036
1202 Ga0157377_10018220
1203 Ga0157377_10086061
1204 Ga0157377_10154891
1205 Ga0157379_10001638
1206 Ga0157379_10040671
1207 Ga0157379_10040890
1208 Ga0157379_10079234
1209 Ga0157379_10185662
1210 Ga0157376_10000497
1211 Ga0157376_10040770
1212 Ga0157376_10072408
1213 Ga0157376_10108064
1214 Ga0157376_10111242
1215 Ga0157376_10149872
1216 Ga0157376_10150892
1217 Ga0157376_10201476
1218 Ga0157376_10245796
1219 Ga0157376_10273870
1220 Ga0163161_10001222
1221 Ga0163161_10045089
1222 Ga0163161_10058267
1223 Ga0163161_10315797
1224 Ga0213876_10025985
1225 Ga0207666_1012854
1226 Ga0207697_10008311
1227 Ga0207697_10015479
1228 Ga0207697_10090303
1229 Ga0207692_10002319
1230 Ga0207692_10015565
1231 Ga0207692_10137885
1232 Ga0207642_10044793
1233 Ga0207710_10016911
1234 Ga0207688_10022190
1235 Ga0207688_10149694
1236 Ga0207680_10074675
1237 Ga0207680_10104322
1238 Ga0207680_10126437
1239 Ga0207647_10034247
1240 Ga0207685_10002336
1241 Ga0207685_10030812
1242 Ga0207645_10001581
1243 Ga0207645_10077239
1244 Ga0207645_10263679
1245 Ga0207643_10001702
1246 Ga0207643_10094850
1247 Ga0207705_10210251
1248 Ga0207684_10005715
1249 Ga0207684_10027002
1250 Ga0207684_10157375
1251 Ga0207684_10236506
1252 Ga0207654_10111691
1253 Ga0207707_10222666
1254 Ga0207707_10246375
1255 Ga0207695_10302729
1256 Ga0207671_10066000
1257 Ga0207693_10111071
1258 Ga0207663_10019153
1259 Ga0207663_10045880
1260 Ga0207663_10055274
1261 Ga0207663_10150270
1262 Ga0207662_10080990
1263 Ga0207662_10202943
1264 Ga0207657_10016580
1265 Ga0207657_10018338
1266 Ga0207657_10324105
1267 Ga0207649_10065432
1268 Ga0207649_10229291
1269 Ga0207652_10107107
1270 Ga0207646_10360728
1271 Ga0207681_10022757
1272 Ga0207694_10017147
1273 Ga0207650_10003891
1274 Ga0207650_10031221
1275 Ga0207650_10032713
1276 Ga0207650_10157230
1277 Ga0207650_10193685
1278 Ga0207659_10004539
1279 Ga0207659_10015811
1280 Ga0207659_10027857
1281 Ga0207659_10065442
1282 Ga0207659_10069961
1283 Ga0207659_10229314
1284 Ga0207659_10244514
1285 Ga0207687_10015370
1286 Ga0207687_10091704
1287 Ga0207687_10254205
1288 Ga0207700_10006428
1289 Ga0207700_10010795
1290 Ga0207700_10011502
1291 Ga0207700_10018717
1292 Ga0207664_10027582
1293 Ga0207664_10028620
1294 Ga0207644_10058359
1295 Ga0207644_10111276
1296 Ga0207644_10143927
1297 Ga0207644_10163751
1298 Ga0207644_10200141
1299 Ga0207690_10017063
1300 Ga0207706_10001938
1301 Ga0207706_10002250
1302 Ga0207706_10019693
1303 Ga0207706_10069336
1304 Ga0207706_10316094
1305 Ga0207686_10013376
1306 Ga0207686_10128383
1307 Ga0207709_10006456
1308 Ga0207709_10013344
1309 Ga0207709_10107375
1310 Ga0207670_10114540
1311 Ga0207669_10001842
1312 Ga0207669_10091101
1313 Ga0207704_10001074
1314 Ga0207704_10045525
1315 Ga0207704_10215426
1316 Ga0207665_10013355
1317 Ga0207665_10027580
1318 Ga0207665_10053118
1319 Ga0207665_10096468
1320 Ga0207691_10050261
1321 Ga0207691_10101840
1322 Ga0207691_10106371
1323 Ga0207691_10118127
1324 Ga0207691_10158245
1325 Ga0207691_10188170
1326 Ga0207711_10005483
1327 Ga0207711_10009834
1328 Ga0207711_10016467
1329 Ga0207711_10053601
1330 Ga0207711_10062045
1331 Ga0207711_10196875
1332 Ga0207689_10001309
1333 Ga0207689_10002016
1334 Ga0207689_10026191
1335 Ga0207689_10055899
1336 Ga0207689_10093036
1337 Ga0207689_10422139
1338 Ga0207661_10007066
1339 Ga0207661_10093395
1340 Ga0207661_10110547
1341 Ga0207661_10331203
1342 Ga0207679_10088710
1343 Ga0207679_10150075
1344 Ga0207667_10093794
1345 Ga0207651_10024253
1346 Ga0207651_10059839
1347 Ga0207651_10062386
1348 Ga0207651_10251809
1349 Ga0207712_10001648
1350 Ga0207712_10053488
1351 Ga0207668_10003006
1352 Ga0207668_10045090
1353 Ga0207668_10057516
1354 Ga0207668_10057770
1355 Ga0207668_10098757
1356 Ga0207640_10072425
1357 Ga0207658_10001120
1358 Ga0207658_10022773
1359 Ga0207677_10187446
1360 Ga0207703_10024428
1361 Ga0207703_10032621
1362 Ga0207703_10092161
1363 Ga0207703_10250278
1364 Ga0207703_10337456
1365 Ga0207639_10022082
1366 Ga0207639_10071600
1367 Ga0207678_10003973
1368 Ga0207678_10017829
1369 Ga0207678_10039877
1370 Ga0207678_10055192
1371 Ga0207678_10065330
1372 Ga0207708_10002050
1373 Ga0207708_10019350
1374 Ga0207702_10010786
1375 Ga0207702_10016471
1376 Ga0207702_10070948
1377 Ga0207702_10132835
1378 Ga0207702_10476480
1379 Ga0207641_10004026
1380 Ga0207641_10011650
1381 Ga0207641_10033637
1382 Ga0207641_10040080
1383 Ga0207641_10583954
1384 Ga0207648_10004966
1385 Ga0207648_10054652
1386 Ga0207648_10089055
1387 Ga0207648_10105343
1388 Ga0207648_10288469
1389 Ga0207676_10031151
1390 Ga0207676_10178014
1391 Ga0207676_10357550
1392 Ga0207674_10066804
1393 Ga0207674_10161838
1394 Ga0207675_100002143
1395 Ga0207675_100004017
1396 Ga0207675_100011609
1397 Ga0207675_100110210
1398 Ga0207675_100242509
1399 Ga0207675_100493722
1400 Ga0207683_10008947
1401 Ga0207683_10022981
1402 Ga0207683_10049841
1403 Ga0207683_10086952
1404 Ga0207683_10152960
1405 Ga0207683_10314397
1406 Ga0207683_10433784
1407 Ga0207698_10016333
1408 Ga0210002_1000480
1409 Ga0209998_10004149
1410 Ga0209974_10015016
1411 Ga0207428_10026774
1412 Ga0207428_10033415
1413 Ga0268266_10068218
1414 Ga0268266_10089370
1415 Ga0268265_10011377
1416 Ga0268265_10079071
1417 Ga0268265_10215411
1418 Ga0268264_10059114
1419 Ga0268264_10132586
1420 Ga0373958_0004188
1421 Ga0373928_0017118
1422 Ga0373944_0004942
1423 Ga0373944_0052525
1424 Ga0373932_0043622
1425 Ga0373945_0004916
1426 Ga0373960_0024062
1427 Ga0373960_0057730
1428 Ga0373946_0030790
1429 Ga0373942_0003209
1430 Ga0373962_0039419
1431 Ga0373931_0011437
1432 Ga0373935_0003786
1433 Ga0373935_0081081
1434 Ga0373935_0187445
1435 Ga0373927_0005078
1436 Ga0373947_0003596
1437 Ga0373947_0084664
1438 Ga0373937_0183364
1439 Ga0373925_0178821
1440 Ga0395899_0093652
1441 Ga0395900_0036651
1442 Ga0395898_0056057
1443 Ga0395901_0098722
1444 Ga0436365_0603453
1445 Ga0451577_0038108
1446 Ga0466963_0015264
1447 Ga0466967_0065364
1448 Ga0495592_0147327
1449 Ga0495629_0004872
1450 Ga0495629_0020743
1451 Ga0495641_0019012
1452 Ga0495641_0055914
1453 Ga0495653_0116607
1454 Ga0495580_0033653
1455 Ga0495580_0136800
1456 Ga0495582_0049720
1457 Ga0495639_0025320
1458 Ga0495662_0085214
1459 Ga0495664_0018922
1460 Ga0495594_0108250
1461 Ga0495594_0233497
1462 Ga0495666_0069776
1463 Ga0495652_0168068
1464 Ga0495652_0314135
1465 Ga0495640_0007576
1466 Ga0495645_0020797
1467 Ga0495656_0026012
1468 Ga0495634_0013365
1469 Ga0495635_0045902
1470 Ga0495599_0021227
1471 Ga0495647_0016619
1472 Ga0495647_0059259
1473 Ga0495658_0002353
1474 Ga0495658_0109986
1475 Ga0495613_0014240
1476 Ga0495613_0051889
1477 Ga0495624_0008421
1478 Ga0495624_0205267
1479 Ga0495581_0112554
1480 Ga0495604_0213285
1481 Ga0495636_0097866
1482 Ga0495676_0029756
1483 Ga0495676_0042354
1484 Ga0495676_0069292
1485 Ga0495676_0247487
1486 Ga0495684_0013309
1487 Ga0495593_0014345
1488 Ga0496100_0001168
1489 Ga0496100_0005170
1490 Ga0496100_0061981
1491 Ga0496100_0083650
1492 Ga0496101_0001061
1493 Ga0496101_0015762
1494 Ga0496101_0018966
1495 Ga0496101_0019389
1496 Ga0496101_0302607
1497 Ga0496102_0003259
1498 Ga0496102_0017050
1499 Ga0496102_0028398
1500 Ga0496102_0055823
1501 Ga0496102_0066527
1502 Ga0496102_0093971
1503 Ga0496103_0001620
1504 Ga0496103_0008890
1505 Ga0496103_0022056
1506 Ga0496103_0091332
1507 Ga0496104_0001014
1508 Ga0496104_0019352
1509 Ga0496104_0040311
1510 Ga0496105_0000651
1511 Ga0496105_0028481
1512 Ga0496105_0088666
1513 Ga0496105_0230868
1514 Ga0496105_0251724
1515 Ga0496106_0002729
1516 Ga0496106_0003791
1517 Ga0496106_0062148
1518 Ga0496106_0081679
1519 Ga0496106_0169936
1520 Ga0496106_0378484
1521 Ga0496106_0390936
1522 Ga0496107_0000128
1523 Ga0496107_0004872
1524 Ga0496107_0058446
1525 Ga0496107_0190234
1526 Ga0496108_0007538
1527 Ga0496108_0035512
1528 Ga0496108_0059836
1529 Ga0496108_0221158
1530 Ga0496108_0311961
1531 Ga0496108_0418388
1532 Ga0496109_0015782
1533 Ga0496109_0030945
1534 Ga0496109_0099774
1535 Ga0496109_0537404
1536 Ga0496110_0039268
1537 Ga0496110_0052018
1538 Ga0496110_0054211
1539 Ga0496110_0062208
1540 Ga0496110_0080086
1541 Ga0496110_0083904
1542 Ga0496110_0089627
1543 Ga0496110_0309579
1544 Ga0496111_0141953
1545 Ga0496111_0188299
1546 Ga0496112_0002907
1547 Ga0496112_0081964
1548 Ga0496112_0144056
1549 Ga0496112_0208260
1550 Ga0496113_0040243
1551 Ga0496114_0000798
1552 Ga0496114_0005350
1553 Ga0496114_0016033
1554 Ga0496114_0060942
1555 Ga0496114_0248169
1556 Ga0496115_0000863
1557 Ga0496115_0021330
1558 Ga0496115_0026788
1559 Ga0496115_0051433
1560 Ga0496115_0144709
1561 Ga0496115_0221857
1562 Ga0501038_0068351
1563 Ga0501041_0194920
1564 Ga0501046_0046754
1565 Ga0501068_0109468
1566 Ga0501075_0022847
1567 Ga0501075_0107827
1568 Ga0501076_0189991
1569 Ga0501076_0382363
1570 Ga0501079_0032638
1571 Ga0501079_0060436
1572 Ga0501081_0002573
1573 Ga0501045_0183242
1574 nmdc:mga0k408_33269_c1
1575 nmdc:mga05p37_100429_c1
1576 nmdc:mga05p37_1228_c1
1577 nmdc:mga05p37_240584_c1
1578 nmdc:mga05p37_240995_c1
1579 nmdc:mga05p37_264064_c1
1580 nmdc:mga05p37_45786_c1
1581 nmdc:mga05p37_4626_c1
1582 nmdc:mga05p37_5837_c1
1583 nmdc:mga05p37_79587_c1
1584 nmdc:mga05p37_96150_c1
1585 nmdc:mga09592_129365_c1
1586 nmdc:mga09592_55877_c1
1587 nmdc:mga09592_83464_c1
1588 nmdc:mga09592_96515_c1
1589 nmdc:mga0qj67_214013_c1
1590 nmdc:mga0qj67_56576_c1
1591 nmdc:mga06r32_127729_c1
1592 nmdc:mga06r32_179746_c1
1593 nmdc:mga06r32_41932_c1
1594 nmdc:mga06r32_66314_c1
1595 nmdc:mga08y16_214172_c1
1596 nmdc:mga08y16_9287_c1
1597 nmdc:mga08y16_94890_c1
1598 nmdc:mga0n895_141047_c1
1599 nmdc:mga0n895_16499_c1
1600 nmdc:mga0n895_338656_c1
1601 nmdc:mga0n895_86_c1
1602 nmdc:mga0n895_99189_c1
1603 nmdc:mga0rr50_147235_c1
1604 nmdc:mga0rr50_54695_c1
1605 nmdc:mga08x19_34361_c1
1606 nmdc:mga08x19_77197_c1
1607 nmdc:mga0a205_157543_c1
1608 Ga0495601_0008787
1609 Ga0495601_0010293
1610 Ga0495601_0026357
1611 Ga0495612_0059128
1612 Ga0495595_0074802
1613 Ga0495619_0000264
1614 Ga0495619_0003681
1615 Ga0495619_0007454
1616 Ga0495619_0216567
1617 Ga0495619_0308771
1618 Ga0501084_0028338
1619 Ga0501084_0325272
1620 Ga0501082_0027329
1621 Ga0501082_0267584
1622 Ga0530510_0086545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

83

378

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9301 27 324
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9241 27 324
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9206 29 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9185 31 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9125 31 325
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9166 27 296 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9108 27 296 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8959 148 324 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8913 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.874 148 325 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537SB65-F1-model_v4 ABC transporter substrate-binding protein 0.9526 129 326
AF-A0A1F3YG64-F1-model_v4 ABC transporter substrate-binding protein 0.9523 29 326
AF-A0A536YEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9523 101 326
AF-A0A2V7D520-F1-model_v4 ABC transporter substrate-binding protein 0.9507 227 325
AF-A0A0S8BAA5-F1-model_v4 ABC transporter substrate-binding protein 0.9505 96 326

Map