F481784

General Info

Members Datasets Scaffolds Average Seq Length
809 232 808 92

Family's Representative Sequence

Representative Sequence 3300049661|Ga0501217_340245|Ga0501217_340245_173_457
Length 94
Sequence VVEQAFPAVVYILCFLTSSACAWLLGRSYLRSKARLLLWSSFCFLLLAGNNLLLVLDLLVFPEVNLRIGRLLFSLAAVSVLIFGFVWDLQEGEE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
228 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.37
Rhizoplane 3.71
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2102004 2162886012 Bacteria 1415
2 JGI24736J21556_1000382 3300001904 Bacteria 8398
3 JGI24741J21665_1049254 3300001915 Unclassified 620
4 JGI24740J21852_10006215 3300001979 Bacteria 4972
5 JGI24739J22299_10001003 3300001989 Bacteria 10472
6 JGI24739J22299_10006988 3300001989 Bacteria 4251
7 JGI24739J22299_10079134 3300001989 Bacteria 1012
8 JGI24737J22298_10000223 3300001990 Bacteria 18616
9 JGI24737J22298_10044515 3300001990 Bacteria 1357
10 JGI24737J22298_10085416 3300001990 Bacteria 938
11 JGI24737J22298_10090169 3300001990 Unclassified 910
12 JGI24737J22298_10128654 3300001990 Unclassified 748
13 JGI24743J22301_10007929 3300001991 Bacteria 1853
14 JGI24738J21930_10000303 3300002075 Bacteria 13548
15 JGI24738J21930_10088973 3300002075 Unclassified 652
16 JGI24738J21930_10100948 3300002075 Bacteria 616
17 JGI24744J21845_10007277 3300002077 Bacteria 2288
18 rootH2_10095655 3300003320 Bacteria 1832
19 rootH1_10152419 3300003323 Unclassified 1114
20 rootH1_10157953 3300003323 Bacteria 1462
21 Ga0065712_10077019 3300005290 Bacteria 3562
22 Ga0065712_10149958 3300005290 Bacteria 1377
23 Ga0065715_10187416 3300005293 Bacteria 1435
24 Ga0065715_10191064 3300005293 Bacteria 1407
25 Ga0065715_10650600 3300005293 Bacteria 671
26 Ga0070658_10001899 3300005327 Bacteria 17643
27 Ga0070658_10024710 3300005327 Bacteria 4818
28 Ga0070658_10064279 3300005327 Bacteria 2993
29 Ga0070658_10301679 3300005327 Bacteria 1366
30 Ga0070658_10394351 3300005327 Bacteria 1188
31 Ga0070658_10406753 3300005327 Bacteria 1169
32 Ga0070658_10954974 3300005327 Unclassified 745
33 Ga0070658_11053300 3300005327 Unclassified 707
34 Ga0070658_11274764 3300005327 Unclassified 638
35 Ga0070676_10043617 3300005328 Bacteria 2607
36 Ga0070676_10207660 3300005328 Bacteria 1287
37 Ga0070676_10652297 3300005328 Bacteria 764
38 Ga0070683_100000257 3300005329 Bacteria 36570
39 Ga0070683_100349142 3300005329 Bacteria 1409
40 Ga0070683_101015834 3300005329 Unclassified 796
41 Ga0070690_101717688 3300005330 Bacteria 510
42 Ga0070670_100063911 3300005331 Unclassified 3158
43 Ga0070670_100158275 3300005331 Bacteria 1962
44 Ga0070670_100214979 3300005331 Bacteria 1672
45 Ga0070670_100281742 3300005331 Bacteria 1451
46 Ga0070670_100399333 3300005331 Bacteria 1213
47 Ga0070670_100455929 3300005331 Bacteria 1134
48 Ga0070677_10009276 3300005333 Bacteria 3332
49 Ga0070677_10014989 3300005333 Bacteria 2739
50 Ga0070677_10027653 3300005333 Bacteria 2137
51 Ga0070677_10272529 3300005333 Bacteria 849
52 Ga0068869_100377927 3300005334 Bacteria 1160
53 Ga0070666_10006073 3300005335 Bacteria 7422
54 Ga0070666_10104009 3300005335 Bacteria 1959
55 Ga0070666_10105056 3300005335 Unclassified 1950
56 Ga0070666_10109982 3300005335 Unclassified 1905
57 Ga0070666_10172968 3300005335 Bacteria 1513
58 Ga0070666_10248030 3300005335 Bacteria 1260
59 Ga0070666_10442880 3300005335 Bacteria 937
60 Ga0070680_100028527 3300005336 Bacteria 4478
61 Ga0070680_100499085 3300005336 Bacteria 1041
62 Ga0070680_100850939 3300005336 Bacteria 786
63 Ga0070680_100948711 3300005336 Bacteria 742
64 Ga0070682_100196997 3300005337 Bacteria 1418
65 Ga0070682_100199921 3300005337 Bacteria 1409
66 Ga0068868_100132688 3300005338 Bacteria 2039
67 Ga0068868_100682380 3300005338 Unclassified 917
68 Ga0068868_101362035 3300005338 Bacteria 661
69 Ga0070660_100005816 3300005339 Bacteria 8538
70 Ga0070660_100018065 3300005339 Bacteria 5146
71 Ga0070660_100026498 3300005339 Bacteria 4316
72 Ga0070660_100067006 3300005339 Bacteria 2796
73 Ga0070660_100090322 3300005339 Bacteria 2415
74 Ga0070660_100147056 3300005339 Bacteria 1893
75 Ga0070660_100152111 3300005339 Bacteria 1861
76 Ga0070660_100327635 3300005339 Bacteria 1259
77 Ga0070660_100583485 3300005339 Bacteria 934
78 Ga0070660_100681345 3300005339 Unclassified 861
79 Ga0070660_100779492 3300005339 Unclassified 804
80 Ga0070660_101212589 3300005339 Unclassified 640
81 Ga0070687_100664857 3300005343 Bacteria 723
82 Ga0070661_100000125 3300005344 Bacteria 63406
83 Ga0070661_100027889 3300005344 Bacteria 4069
84 Ga0070661_100028675 3300005344 Bacteria 4016
85 Ga0070661_100071178 3300005344 Bacteria 2559
86 Ga0070661_100113884 3300005344 Bacteria 2021
87 Ga0070661_100287256 3300005344 Bacteria 1277
88 Ga0070661_100418173 3300005344 Unclassified 1062
89 Ga0070661_100660041 3300005344 Bacteria 849
90 Ga0070661_100683390 3300005344 Unclassified 835
91 Ga0070661_100803880 3300005344 Bacteria 772
92 Ga0070692_10450594 3300005345 Unclassified 823
93 Ga0070668_100152130 3300005347 Bacteria 1872
94 Ga0070668_100236045 3300005347 Bacteria 1513
95 Ga0070669_100011961 3300005353 Bacteria 6159
96 Ga0070669_100052346 3300005353 Bacteria 2987
97 Ga0070669_100182366 3300005353 Bacteria 1643
98 Ga0070669_101410519 3300005353 Bacteria 604
99 Ga0070675_100075980 3300005354 Unclassified 2793
100 Ga0070675_100135338 3300005354 Bacteria 2103
101 Ga0070675_100597647 3300005354 Unclassified 1000
102 Ga0070675_100625660 3300005354 Unclassified 977
103 Ga0070675_101880954 3300005354 Unclassified 552
104 Ga0070671_100007875 3300005355 Bacteria 8518
105 Ga0070671_100044630 3300005355 Bacteria 3684
106 Ga0070671_100087676 3300005355 Bacteria 2604
107 Ga0070671_100229044 3300005355 Bacteria 1577
108 Ga0070671_100652246 3300005355 Bacteria 911
109 Ga0070671_100726234 3300005355 Bacteria 862
110 Ga0070674_100069469 3300005356 Bacteria 2485
111 Ga0070674_101005025 3300005356 Bacteria 732
112 Ga0070673_100023615 3300005364 Bacteria 4494
113 Ga0070673_100029392 3300005364 Bacteria 4098
114 Ga0070673_100116633 3300005364 Bacteria 2221
115 Ga0070673_100139071 3300005364 Bacteria 2047
116 Ga0070673_100176106 3300005364 Bacteria 1828
117 Ga0070673_100267164 3300005364 Bacteria 1496
118 Ga0070659_100003922 3300005366 Bacteria 10586
119 Ga0070659_100007212 3300005366 Bacteria 8068
120 Ga0070659_100042839 3300005366 Bacteria 3539
121 Ga0070659_100057553 3300005366 Bacteria 3066
122 Ga0070659_100084231 3300005366 Bacteria 2542
123 Ga0070659_100164859 3300005366 Bacteria 1813
124 Ga0070659_100320488 3300005366 Bacteria 1296
125 Ga0070659_100713677 3300005366 Bacteria 868
126 Ga0070659_100724465 3300005366 Bacteria 861
127 Ga0070659_100893336 3300005366 Unclassified 776
128 Ga0070667_100000842 3300005367 Bacteria 28434
129 Ga0070667_100002368 3300005367 Bacteria 16509
130 Ga0070667_100097434 3300005367 Bacteria 2537
131 Ga0070667_100337612 3300005367 Bacteria 1362
132 Ga0070713_100462693 3300005436 Bacteria 1193
133 Ga0070663_100000234 3300005455 Bacteria 27971
134 Ga0070663_100030813 3300005455 Bacteria 3680
135 Ga0070663_100041985 3300005455 Bacteria 3212
136 Ga0070663_100150922 3300005455 Bacteria 1782
137 Ga0070663_100167182 3300005455 Bacteria 1697
138 Ga0070663_100357834 3300005455 Bacteria 1183
139 Ga0070663_100996109 3300005455 Bacteria 728
140 Ga0070663_101212781 3300005455 Unclassified 663
141 Ga0070663_101704488 3300005455 Unclassified 563
142 Ga0070678_100064422 3300005456 Bacteria 2716
143 Ga0070678_100078428 3300005456 Bacteria 2495
144 Ga0070678_100938109 3300005456 Unclassified 793
145 Ga0070662_100000010 3300005457 Bacteria 142717
146 Ga0070662_100006841 3300005457 Bacteria 7374
147 Ga0070662_100011566 3300005457 Bacteria 5823
148 Ga0070662_100068657 3300005457 Bacteria 2606
149 Ga0070662_100127922 3300005457 Bacteria 1955
150 Ga0070662_100445387 3300005457 Bacteria 1074
151 Ga0070662_100880328 3300005457 Unclassified 763
152 Ga0068867_100066654 3300005459 Bacteria 2682
153 Ga0070679_100120675 3300005530 Bacteria 2607
154 Ga0070679_100250873 3300005530 Bacteria 1726
155 Ga0070679_100532960 3300005530 Bacteria 1118
156 Ga0070679_100588432 3300005530 Bacteria 1056
157 Ga0070679_101311004 3300005530 Bacteria 670
158 Ga0070679_101490132 3300005530 Bacteria 623
159 Ga0070684_100060078 3300005535 Bacteria 3324
160 Ga0070684_100189185 3300005535 Bacteria 1873
161 Ga0070684_100821632 3300005535 Bacteria 869
162 Ga0070684_101647831 3300005535 Bacteria 605
163 Ga0068853_100000715 3300005539 Bacteria 22973
164 Ga0068853_100151679 3300005539 Bacteria 2086
165 Ga0068853_100161067 3300005539 Bacteria 2025
166 Ga0068853_100227344 3300005539 Bacteria 1706
167 Ga0068853_100227657 3300005539 Bacteria 1705
168 Ga0068853_100612475 3300005539 Unclassified 1035
169 Ga0068853_100624565 3300005539 Bacteria 1024
170 Ga0070672_100167415 3300005543 Bacteria 1826
171 Ga0070672_100227542 3300005543 Bacteria 1566
172 Ga0070672_100612275 3300005543 Bacteria 949
173 Ga0070693_100001081 3300005547 Bacteria 12202
174 Ga0070693_100158693 3300005547 Bacteria 1439
175 Ga0070693_100588207 3300005547 Bacteria 802
176 Ga0070665_100002076 3300005548 Bacteria 22480
177 Ga0070665_100009733 3300005548 Bacteria 9717
178 Ga0070665_100009746 3300005548 Bacteria 9712
179 Ga0070665_100012827 3300005548 Bacteria 8438
180 Ga0070665_100556726 3300005548 Bacteria 1159
181 Ga0068855_100001909 3300005563 Bacteria 25846
182 Ga0068855_100060863 3300005563 Bacteria 4413
183 Ga0068855_100204771 3300005563 Bacteria 2220
184 Ga0068855_100465585 3300005563 Bacteria 1378
185 Ga0068855_100469011 3300005563 Unclassified 1372
186 Ga0068855_100503908 3300005563 Unclassified 1315
187 Ga0068855_100741020 3300005563 Bacteria 1048
188 Ga0068855_100930176 3300005563 Bacteria 917
189 Ga0068855_101249986 3300005563 Unclassified 770
190 Ga0068855_101404228 3300005563 Bacteria 719
191 Ga0070664_100000615 3300005564 Bacteria 27211
192 Ga0070664_100021951 3300005564 Bacteria 5264
193 Ga0070664_100033988 3300005564 Bacteria 4275
194 Ga0070664_100099139 3300005564 Bacteria 2532
195 Ga0070664_100138010 3300005564 Bacteria 2145
196 Ga0070664_100737675 3300005564 Bacteria 919
197 Ga0068857_100041588 3300005577 Bacteria 4076
198 Ga0068857_100188969 3300005577 Bacteria 1876
199 Ga0068857_100191465 3300005577 Bacteria 1863
200 Ga0068857_100942769 3300005577 Bacteria 829
201 Ga0068854_100008303 3300005578 Bacteria 6668
202 Ga0068854_100011084 3300005578 Bacteria 5853
203 Ga0068854_100118372 3300005578 Bacteria 2007
204 Ga0068854_100316408 3300005578 Bacteria 1267
205 Ga0068854_100323774 3300005578 Bacteria 1254
206 Ga0068854_100337153 3300005578 Bacteria 1230
207 Ga0068854_100451458 3300005578 Bacteria 1074
208 Ga0068854_100470361 3300005578 Bacteria 1053
209 Ga0068854_100954862 3300005578 Unclassified 756
210 Ga0068856_100000442 3300005614 Bacteria 45717
211 Ga0068856_100011210 3300005614 Bacteria 8700
212 Ga0068856_100301739 3300005614 Bacteria 1619
213 Ga0068856_100771310 3300005614 Unclassified 981
214 Ga0068856_100978710 3300005614 Bacteria 864
215 Ga0068856_101475468 3300005614 Unclassified 694
216 Ga0068856_102433070 3300005614 Bacteria 531
217 Ga0068852_100000241 3300005616 Bacteria 37155
218 Ga0068852_100004297 3300005616 Bacteria 10055
219 Ga0068852_100018676 3300005616 Bacteria 5465
220 Ga0068852_100056875 3300005616 Bacteria 3382
221 Ga0068852_100232084 3300005616 Bacteria 1759
222 Ga0068852_100257478 3300005616 Bacteria 1674
223 Ga0068852_100789884 3300005616 Unclassified 963
224 Ga0068852_100822797 3300005616 Bacteria 943
225 Ga0068852_100879920 3300005616 Unclassified 912
226 Ga0068852_101777194 3300005616 Unclassified 639
227 Ga0068859_100642322 3300005617 Unclassified 1153
228 Ga0068864_100004493 3300005618 Bacteria 11474
229 Ga0068864_100519821 3300005618 Unclassified 1147
230 Ga0068864_101739356 3300005618 Unclassified 628
231 Ga0068861_102683897 3300005719 Bacteria 502
232 Ga0068851_10004973 3300005834 Bacteria 6019
233 Ga0068851_10144655 3300005834 Bacteria 1295
234 Ga0068851_10800478 3300005834 Bacteria 585
235 Ga0068863_100014278 3300005841 Bacteria 7649
236 Ga0068862_100020659 3300005844 Bacteria 5501
237 Ga0097621_100246041 3300006237 Unclassified 1565
238 Ga0068871_100064545 3300006358 Bacteria 2998
239 Ga0068871_100573619 3300006358 Bacteria 1024
240 Ga0068871_101688605 3300006358 Bacteria 600
241 Ga0075430_100671514 3300006846 Bacteria 854
242 Ga0097620_100642319 3300006931 Unclassified 1153
243 Ga0079104_1048787 3300006946 Bacteria 952
244 Ga0105240_10095158 3300009093 Bacteria 3632
245 Ga0105240_10100250 3300009093 Bacteria 3524
246 Ga0105240_10127198 3300009093 Bacteria 3060
247 Ga0105240_10334650 3300009093 Bacteria 1721
248 Ga0105240_11219910 3300009093 Unclassified 796
249 Ga0105240_12069201 3300009093 Unclassified 591
250 Ga0111539_12712655 3300009094 Bacteria 574
251 Ga0105245_10172523 3300009098 Bacteria 2060
252 Ga0105247_10288163 3300009101 Unclassified 1135
253 Ga0105247_10889170 3300009101 Bacteria 687
254 Ga0105243_10523408 3300009148 Bacteria 1128
255 Ga0105241_10046707 3300009174 Bacteria 3289
256 Ga0105241_10472204 3300009174 Unclassified 1113
257 Ga0105241_10640445 3300009174 Bacteria 964
258 Ga0105242_10362671 3300009176 Bacteria 1341
259 Ga0105242_12655807 3300009176 Unclassified 550
260 Ga0105248_10001127 3300009177 Bacteria 29711
261 Ga0105248_10001586 3300009177 Bacteria 25332
262 Ga0105248_10064040 3300009177 Bacteria 4127
263 Ga0105248_10205694 3300009177 Bacteria 2218
264 Ga0105237_10134559 3300009545 Bacteria 2466
265 Ga0105237_12196328 3300009545 Bacteria 561
266 Ga0105238_10001904 3300009551 Bacteria 20960
267 Ga0105238_10072019 3300009551 Bacteria 3453
268 Ga0105238_10096544 3300009551 Bacteria 2941
269 Ga0105238_10286464 3300009551 Bacteria 1629
270 Ga0105239_10776122 3300010375 Bacteria 1097
271 Ga0105239_11470741 3300010375 Bacteria 787
272 Ga0157315_1007917 3300012508 Unclassified 875
273 Ga0157373_10021351 3300013100 Bacteria 4703
274 Ga0157373_10021899 3300013100 Bacteria 4637
275 Ga0157373_10058801 3300013100 Bacteria 2724
276 Ga0157373_10059996 3300013100 Bacteria 2695
277 Ga0157373_10090777 3300013100 Bacteria 2151
278 Ga0157373_10213658 3300013100 Bacteria 1360
279 Ga0157373_10263662 3300013100 Bacteria 1219
280 Ga0157373_10298860 3300013100 Bacteria 1142
281 Ga0157373_10625052 3300013100 Bacteria 785
282 Ga0157373_11544602 3300013100 Bacteria 507
283 Ga0157371_10002401 3300013102 Bacteria 17923
284 Ga0157371_10102338 3300013102 Bacteria 2032
285 Ga0157371_10407381 3300013102 Bacteria 996
286 Ga0157371_10436944 3300013102 Unclassified 961
287 Ga0157371_10597310 3300013102 Unclassified 821
288 Ga0157371_11267875 3300013102 Bacteria 569
289 Ga0157371_11617954 3300013102 Unclassified 507
290 Ga0157370_10003954 3300013104 Bacteria 17255
291 Ga0157370_10192136 3300013104 Bacteria 1895
292 Ga0157370_10473729 3300013104 Unclassified 1151
293 Ga0157370_10725281 3300013104 Unclassified 906
294 Ga0157370_11053957 3300013104 Unclassified 735
295 Ga0157369_10000106 3300013105 Bacteria 117964
296 Ga0157369_10049843 3300013105 Bacteria 4537
297 Ga0157369_10203373 3300013105 Bacteria 2078
298 Ga0157369_10250557 3300013105 Bacteria 1848
299 Ga0157369_10996497 3300013105 Bacteria 858
300 Ga0157374_10035871 3300013296 Bacteria 4539
301 Ga0157374_10055319 3300013296 Bacteria 3703
302 Ga0157374_10460715 3300013296 Bacteria 1273
303 Ga0157378_10142820 3300013297 Bacteria 2224
304 Ga0163162_10075213 3300013306 Bacteria 3438
305 Ga0163162_10782407 3300013306 Bacteria 1072
306 Ga0163162_11042640 3300013306 Unclassified 925
307 Ga0157372_10431317 3300013307 Bacteria 1536
308 Ga0157372_10672971 3300013307 Bacteria 1205
309 Ga0157372_10712592 3300013307 Bacteria 1167
310 Ga0157372_10965571 3300013307 Bacteria 988
311 Ga0157372_11066021 3300013307 Bacteria 935
312 Ga0157372_11555876 3300013307 Unclassified 761
313 Ga0157372_12602767 3300013307 Unclassified 581
314 Ga0157375_10228490 3300013308 Bacteria 2019
315 Ga0157375_10974483 3300013308 Bacteria 989
316 Ga0163163_10001016 3300014325 Bacteria 23746
317 Ga0163163_10855137 3300014325 Bacteria 973
318 Ga0157380_10869011 3300014326 Bacteria 925
319 Ga0157380_11429228 3300014326 Bacteria 743
320 Ga0157379_10092035 3300014968 Bacteria 2720
321 Ga0163161_10096122 3300017792 Bacteria 2199
322 Ga0213874_10011211 3300021377 Bacteria 2265
323 Ga0213876_10000252 3300021384 Bacteria 50523
324 Ga0207666_1033351 3300025271 Bacteria 793
325 Ga0207697_10018686 3300025315 Bacteria 2841
326 Ga0207697_10471545 3300025315 Bacteria 556
327 Ga0207656_10018003 3300025321 Unclassified 2775
328 Ga0207656_10095685 3300025321 Bacteria 1354
329 Ga0207682_10025160 3300025893 Bacteria 2360
330 Ga0207682_10048298 3300025893 Bacteria 1754
331 Ga0207682_10117592 3300025893 Bacteria 1176
332 Ga0207692_10122221 3300025898 Bacteria 1459
333 Ga0207688_10109065 3300025901 Bacteria 1605
334 Ga0207680_10055355 3300025903 Bacteria 2390
335 Ga0207680_10108269 3300025903 Unclassified 1798
336 Ga0207680_10645517 3300025903 Bacteria 758
337 Ga0207647_10009245 3300025904 Bacteria 7009
338 Ga0207647_10056487 3300025904 Bacteria 2408
339 Ga0207647_10113491 3300025904 Bacteria 1601
340 Ga0207647_10276370 3300025904 Unclassified 959
341 Ga0207645_10104835 3300025907 Bacteria 1826
342 Ga0207645_10388657 3300025907 Bacteria 937
343 Ga0207705_10000151 3300025909 Bacteria 74614
344 Ga0207705_10000232 3300025909 Bacteria 55596
345 Ga0207705_10020766 3300025909 Bacteria 4687
346 Ga0207705_10083286 3300025909 Bacteria 2333
347 Ga0207705_10085270 3300025909 Bacteria 2307
348 Ga0207705_10474948 3300025909 Bacteria 970
349 Ga0207654_10154736 3300025911 Unclassified 1475
350 Ga0207707_10589459 3300025912 Bacteria 942
351 Ga0207707_11467681 3300025912 Unclassified 542
352 Ga0207695_10002502 3300025913 Bacteria 27010
353 Ga0207695_10011732 3300025913 Bacteria 10583
354 Ga0207695_10033176 3300025913 Bacteria 5638
355 Ga0207695_10676261 3300025913 Bacteria 913
356 Ga0207671_10229107 3300025914 Bacteria 1457
357 Ga0207660_10058884 3300025917 Bacteria 2756
358 Ga0207660_10769788 3300025917 Unclassified 786
359 Ga0207660_11689117 3300025917 Unclassified 509
360 Ga0207662_10498761 3300025918 Unclassified 838
361 Ga0207657_10000026 3300025919 Bacteria 143118
362 Ga0207657_10006968 3300025919 Bacteria 11641
363 Ga0207657_10038269 3300025919 Bacteria 4272
364 Ga0207657_10070275 3300025919 Bacteria 2968
365 Ga0207657_10106702 3300025919 Bacteria 2317
366 Ga0207657_10130785 3300025919 Bacteria 2057
367 Ga0207657_10317571 3300025919 Unclassified 1232
368 Ga0207657_10573858 3300025919 Bacteria 881
369 Ga0207657_11296882 3300025919 Unclassified 550
370 Ga0207649_10000318 3300025920 Bacteria 36532
371 Ga0207649_10007523 3300025920 Bacteria 5920
372 Ga0207649_10131760 3300025920 Bacteria 1699
373 Ga0207649_10145758 3300025920 Bacteria 1625
374 Ga0207649_10293073 3300025920 Bacteria 1187
375 Ga0207649_10373544 3300025920 Unclassified 1061
376 Ga0207649_11523809 3300025920 Bacteria 529
377 Ga0207649_11618885 3300025920 Bacteria 513
378 Ga0207652_10184328 3300025921 Bacteria 1877
379 Ga0207652_10191918 3300025921 Bacteria 1837
380 Ga0207652_10468183 3300025921 Bacteria 1135
381 Ga0207652_11240644 3300025921 Bacteria 648
382 Ga0207652_11768891 3300025921 Unclassified 523
383 Ga0207681_10007671 3300025923 Bacteria 6609
384 Ga0207681_10643801 3300025923 Bacteria 878
385 Ga0207694_10048486 3300025924 Bacteria 3287
386 Ga0207694_10227060 3300025924 Bacteria 1524
387 Ga0207694_10833312 3300025924 Bacteria 779
388 Ga0207694_10836312 3300025924 Unclassified 778
389 Ga0207650_10123515 3300025925 Bacteria 2018
390 Ga0207650_10155088 3300025925 Bacteria 1810
391 Ga0207650_10178476 3300025925 Bacteria 1691
392 Ga0207650_10263363 3300025925 Bacteria 1399
393 Ga0207650_10281919 3300025925 Unclassified 1353
394 Ga0207650_10360217 3300025925 Bacteria 1198
395 Ga0207659_10357002 3300025926 Bacteria 1214
396 Ga0207659_10814320 3300025926 Unclassified 802
397 Ga0207659_11499326 3300025926 Unclassified 577
398 Ga0207687_11016132 3300025927 Unclassified 711
399 Ga0207664_10099358 3300025929 Bacteria 2401
400 Ga0207644_10012166 3300025931 Bacteria 5710
401 Ga0207644_10089752 3300025931 Bacteria 2288
402 Ga0207644_10090695 3300025931 Bacteria 2278
403 Ga0207644_10158528 3300025931 Bacteria 1757
404 Ga0207644_10448841 3300025931 Bacteria 1059
405 Ga0207644_10638638 3300025931 Unclassified 885
406 Ga0207644_10853834 3300025931 Bacteria 762
407 Ga0207644_11061178 3300025931 Unclassified 680
408 Ga0207690_10001417 3300025932 Bacteria 15079
409 Ga0207690_10011217 3300025932 Bacteria 5351
410 Ga0207690_10031421 3300025932 Bacteria 3397
411 Ga0207690_10258140 3300025932 Bacteria 1349
412 Ga0207690_10453909 3300025932 Unclassified 1031
413 Ga0207690_10636128 3300025932 Unclassified 873
414 Ga0207690_10874299 3300025932 Unclassified 745
415 Ga0207690_11053827 3300025932 Unclassified 677
416 Ga0207690_11244770 3300025932 Bacteria 622
417 Ga0207706_10000031 3300025933 Bacteria 143109
418 Ga0207706_10001098 3300025933 Bacteria 27522
419 Ga0207706_10008288 3300025933 Bacteria 9585
420 Ga0207706_10065467 3300025933 Bacteria 3200
421 Ga0207706_10081080 3300025933 Bacteria 2852
422 Ga0207706_10096106 3300025933 Bacteria 2605
423 Ga0207706_10169165 3300025933 Bacteria 1921
424 Ga0207706_10772839 3300025933 Bacteria 817
425 Ga0207706_10810623 3300025933 Unclassified 795
426 Ga0207706_11151605 3300025933 Bacteria 646
427 Ga0207686_10746922 3300025934 Bacteria 781
428 Ga0207709_10505670 3300025935 Bacteria 944
429 Ga0207669_11586502 3300025937 Unclassified 558
430 Ga0207691_10045726 3300025940 Bacteria 4023
431 Ga0207691_10147407 3300025940 Bacteria 2071
432 Ga0207691_10397696 3300025940 Bacteria 1175
433 Ga0207691_10646391 3300025940 Bacteria 894
434 Ga0207691_10932353 3300025940 Unclassified 726
435 Ga0207711_10003583 3300025941 Bacteria 13431
436 Ga0207711_10030300 3300025941 Bacteria 4563
437 Ga0207711_10136228 3300025941 Bacteria 2206
438 Ga0207711_10190060 3300025941 Unclassified 1871
439 Ga0207711_10729288 3300025941 Bacteria 924
440 Ga0207689_10153965 3300025942 Bacteria 1895
441 Ga0207661_10002291 3300025944 Bacteria 13179
442 Ga0207661_10122260 3300025944 Bacteria 2218
443 Ga0207661_11065571 3300025944 Bacteria 744
444 Ga0207679_10000572 3300025945 Bacteria 24759
445 Ga0207679_10239097 3300025945 Unclassified 1538
446 Ga0207679_10349117 3300025945 Bacteria 1289
447 Ga0207679_10362464 3300025945 Bacteria 1266
448 Ga0207667_10037667 3300025949 Bacteria 5169
449 Ga0207667_10069864 3300025949 Bacteria 3656
450 Ga0207667_10090761 3300025949 Bacteria 3157
451 Ga0207667_10179975 3300025949 Bacteria 2171
452 Ga0207667_10239222 3300025949 Bacteria 1858
453 Ga0207667_11064600 3300025949 Unclassified 793
454 Ga0207667_11982982 3300025949 Bacteria 543
455 Ga0207651_10016342 3300025960 Bacteria 4344
456 Ga0207651_10151990 3300025960 Bacteria 1803
457 Ga0207651_10302143 3300025960 Bacteria 1331
458 Ga0207651_10559394 3300025960 Unclassified 995
459 Ga0207668_10000010 3300025972 Bacteria 185249
460 Ga0207640_10007063 3300025981 Bacteria 6185
461 Ga0207640_10013046 3300025981 Bacteria 4753
462 Ga0207640_10035455 3300025981 Bacteria 3123
463 Ga0207640_10299579 3300025981 Bacteria 1271
464 Ga0207640_10301244 3300025981 Bacteria 1268
465 Ga0207640_10507068 3300025981 Bacteria 1006
466 Ga0207640_11414187 3300025981 Unclassified 623
467 Ga0207658_10004019 3300025986 Bacteria 10294
468 Ga0207658_10076645 3300025986 Bacteria 2548
469 Ga0207658_10080552 3300025986 Bacteria 2494
470 Ga0207658_11492494 3300025986 Bacteria 618
471 Ga0207658_11723607 3300025986 Unclassified 572
472 Ga0207677_10220964 3300026023 Bacteria 1519
473 Ga0207677_10417306 3300026023 Unclassified 1142
474 Ga0207677_11050871 3300026023 Unclassified 740
475 Ga0207703_10138525 3300026035 Bacteria 2110
476 Ga0207639_10001178 3300026041 Bacteria 17759
477 Ga0207639_10147410 3300026041 Bacteria 1967
478 Ga0207639_10287572 3300026041 Bacteria 1448
479 Ga0207639_10292679 3300026041 Bacteria 1436
480 Ga0207639_10496425 3300026041 Unclassified 1114
481 Ga0207639_10917284 3300026041 Bacteria 819
482 Ga0207678_10000989 3300026067 Bacteria 25886
483 Ga0207678_10005287 3300026067 Bacteria 11558
484 Ga0207678_10080669 3300026067 Bacteria 2785
485 Ga0207678_10153784 3300026067 Unclassified 1964
486 Ga0207678_10162116 3300026067 Bacteria 1909
487 Ga0207678_10223810 3300026067 Bacteria 1611
488 Ga0207678_10469474 3300026067 Bacteria 1095
489 Ga0207702_10000891 3300026078 Bacteria 30976
490 Ga0207702_10005655 3300026078 Bacteria 10902
491 Ga0207702_10010126 3300026078 Bacteria 7897
492 Ga0207702_10030457 3300026078 Bacteria 4497
493 Ga0207702_10163764 3300026078 Bacteria 2033
494 Ga0207702_11330153 3300026078 Bacteria 712
495 Ga0207702_12110681 3300026078 Archaea 553
496 Ga0207641_10017148 3300026088 Bacteria 5924
497 Ga0207648_10023086 3300026089 Bacteria 5579
498 Ga0207676_10008133 3300026095 Bacteria 7455
499 Ga0207676_10078555 3300026095 Bacteria 2673
500 Ga0207676_11390684 3300026095 Unclassified 698
501 Ga0207676_11942477 3300026095 Unclassified 587
502 Ga0207674_10035328 3300026116 Bacteria 5217
503 Ga0207674_10096380 3300026116 Bacteria 2943
504 Ga0207674_10514666 3300026116 Bacteria 1156
505 Ga0207683_10014692 3300026121 Bacteria 6667
506 Ga0207683_10110332 3300026121 Bacteria 2463
507 Ga0207683_10989646 3300026121 Unclassified 781
508 Ga0207698_10002956 3300026142 Bacteria 10171
509 Ga0207698_10009609 3300026142 Bacteria 6174
510 Ga0207698_10016415 3300026142 Bacteria 4989
511 Ga0207698_10074672 3300026142 Bacteria 2706
512 Ga0207698_10225009 3300026142 Bacteria 1699
513 Ga0207698_10305848 3300026142 Bacteria 1482
514 Ga0207698_10624213 3300026142 Unclassified 1065
515 Ga0207698_10699054 3300026142 Unclassified 1009
516 Ga0207698_10714343 3300026142 Bacteria 998
517 Ga0207698_10896726 3300026142 Bacteria 894
518 Ga0207698_11294445 3300026142 Unclassified 744
519 Ga0209281_1063974 3300027111 Bacteria 554
520 Ga0209981_1015381 3300027378 Bacteria 1072
521 Ga0209970_1049701 3300027614 Bacteria 757
522 Ga0209983_1089699 3300027665 Unclassified 692
523 Ga0268266_10001182 3300028379 Bacteria 32222
524 Ga0268266_10007451 3300028379 Bacteria 9872
525 Ga0268266_10077345 3300028379 Bacteria 2893
526 Ga0268266_10183778 3300028379 Bacteria 1905
527 Ga0268266_11836538 3300028379 Unclassified 580
528 Ga0268265_10009628 3300028380 Bacteria 6525
529 Ga0307408_100021515 3300031548 Bacteria 4365
530 Ga0307408_100055059 3300031548 Bacteria 2878
531 Ga0307408_100316481 3300031548 Unclassified 1313
532 Ga0307408_100632649 3300031548 Unclassified 954
533 Ga0307405_10076710 3300031731 Bacteria 2169
534 Ga0307405_10189910 3300031731 Bacteria 1483
535 Ga0307405_10209212 3300031731 Bacteria 1423
536 Ga0307405_10233033 3300031731 Bacteria 1358
537 Ga0307405_10686767 3300031731 Bacteria 846
538 Ga0307405_11688891 3300031731 Bacteria 561
539 Ga0307413_10071038 3300031824 Bacteria 2192
540 Ga0307413_10164336 3300031824 Bacteria 1563
541 Ga0307413_10301444 3300031824 Bacteria 1215
542 Ga0307413_10679535 3300031824 Unclassified 853
543 Ga0307413_10876323 3300031824 Unclassified 760
544 Ga0307413_10980425 3300031824 Unclassified 723
545 Ga0307410_10005912 3300031852 Bacteria 6539
546 Ga0307410_10241895 3300031852 Bacteria 1399
547 Ga0307410_10269873 3300031852 Bacteria 1330
548 Ga0307410_10373925 3300031852 Bacteria 1145
549 Ga0307410_10387373 3300031852 Bacteria 1126
550 Ga0307410_10410416 3300031852 Bacteria 1096
551 Ga0307406_10032078 3300031901 Bacteria 3204
552 Ga0307406_10168493 3300031901 Bacteria 1582
553 Ga0307406_10692311 3300031901 Unclassified 850
554 Ga0307407_10084958 3300031903 Bacteria 1924
555 Ga0307407_10102953 3300031903 Bacteria 1776
556 Ga0307407_10278640 3300031903 Bacteria 1157
557 Ga0307407_10487270 3300031903 Unclassified 901
558 Ga0307407_10782182 3300031903 Bacteria 725
559 Ga0307412_10031102 3300031911 Bacteria 3367
560 Ga0307412_10048386 3300031911 Bacteria 2796
561 Ga0307412_10163739 3300031911 Bacteria 1656
562 Ga0307412_11187192 3300031911 Bacteria 683
563 Ga0307412_11496371 3300031911 Unclassified 613
564 Ga0307412_11711862 3300031911 Unclassified 576
565 Ga0307412_11847745 3300031911 Unclassified 556
566 Ga0307412_12151644 3300031911 Unclassified 519
567 Ga0307409_100019126 3300031995 Bacteria 4627
568 Ga0307409_100117826 3300031995 Bacteria 2241
569 Ga0307409_100135292 3300031995 Bacteria 2114
570 Ga0307409_100201397 3300031995 Bacteria 1781
571 Ga0307409_100314662 3300031995 Bacteria 1462
572 Ga0307409_100367523 3300031995 Bacteria 1363
573 Ga0307409_101510266 3300031995 Bacteria 699
574 Ga0307409_101939014 3300031995 Bacteria 618
575 Ga0307416_100274432 3300032002 Bacteria 1658
576 Ga0307416_100325149 3300032002 Bacteria 1542
577 Ga0307416_100411372 3300032002 Bacteria 1393
578 Ga0307416_101282301 3300032002 Bacteria 838
579 Ga0307416_103459952 3300032002 Unclassified 528
580 Ga0307416_103514236 3300032002 Unclassified 524
581 Ga0307414_10000536 3300032004 Bacteria 19786
582 Ga0307414_10002526 3300032004 Bacteria 9602
583 Ga0307414_10224282 3300032004 Bacteria 1545
584 Ga0307414_10266169 3300032004 Bacteria 1433
585 Ga0307414_11413227 3300032004 Bacteria 647
586 Ga0307411_10013558 3300032005 Bacteria 4501
587 Ga0307411_10032212 3300032005 Bacteria 3236
588 Ga0307411_10079151 3300032005 Bacteria 2256
589 Ga0307411_10084871 3300032005 Bacteria 2191
590 Ga0307411_10138656 3300032005 Bacteria 1790
591 Ga0307411_10424126 3300032005 Bacteria 1106
592 Ga0307411_10723194 3300032005 Bacteria 869
593 Ga0307415_100153682 3300032126 Bacteria 1774
594 Ga0307415_100230747 3300032126 Bacteria 1490
595 Ga0307415_100256486 3300032126 Bacteria 1424
596 Ga0307415_100572265 3300032126 Bacteria 1000
597 Ga0307415_100814170 3300032126 Bacteria 854
598 Ga0307415_101258758 3300032126 Bacteria 699
599 Ga0307415_101420232 3300032126 Bacteria 661
600 Ga0373930_0057921 3300034816 Unclassified 859
601 Ga0373959_0087205 3300034820 Unclassified 727
602 Ga0373952_0092297 3300035092 Unclassified 788
603 Ga0373954_0634977 3300035118 Unclassified 529
604 Ga0373956_0244655 3300035119 Bacteria 853
605 Ga0373956_0606019 3300035119 Unclassified 523
606 Ga0373960_0051867 3300035121 Unclassified 1220
607 Ga0373955_0407706 3300035172 Unclassified 826
608 Ga0373933_0088697 3300035724 Bacteria 1906
609 Ga0373933_0786815 3300035724 Bacteria 626
610 Ga0373937_0002021 3300036401 Bacteria 16928
611 Ga0373937_0106446 3300036401 Unclassified 2607
612 Ga0373937_1327239 3300036401 Bacteria 667
613 Ga0373937_1658272 3300036401 Bacteria 586
614 Ga0373925_1220972 3300037068 Unclassified 618
615 Ga0395899_0034393 3300037312 Bacteria 3805
616 Ga0395899_0037068 3300037312 Bacteria 3656
617 Ga0395899_0050080 3300037312 Bacteria 3102
618 Ga0395899_0061730 3300037312 Bacteria 2760
619 Ga0395899_0063340 3300037312 Bacteria 2720
620 Ga0395899_0079490 3300037312 Bacteria 2388
621 Ga0395899_0082928 3300037312 Bacteria 2331
622 Ga0395899_0094335 3300037312 Bacteria 2165
623 Ga0395899_0114907 3300037312 Bacteria 1932
624 Ga0395899_0146065 3300037312 Bacteria 1679
625 Ga0395899_0156903 3300037312 Bacteria 1610
626 Ga0395899_0227995 3300037312 Bacteria 1288
627 Ga0395899_0238139 3300037312 Bacteria 1253
628 Ga0395899_0512819 3300037312 Unclassified 776
629 Ga0395900_0001394 3300037418 Bacteria 28915
630 Ga0395900_0026006 3300037418 Bacteria 5993
631 Ga0395900_0033844 3300037418 Bacteria 5258
632 Ga0395900_0047139 3300037418 Bacteria 4437
633 Ga0395900_0057719 3300037418 Bacteria 3996
634 Ga0395900_0098145 3300037418 Bacteria 3010
635 Ga0395900_0120394 3300037418 Bacteria 2693
636 Ga0395900_0180659 3300037418 Bacteria 2144
637 Ga0395900_0214138 3300037418 Bacteria 1944
638 Ga0395900_0264197 3300037418 Bacteria 1717
639 Ga0395900_0419465 3300037418 Unclassified 1299
640 Ga0395900_0437241 3300037418 Bacteria 1266
641 Ga0395900_0450727 3300037418 Bacteria 1243
642 Ga0395900_0499748 3300037418 Bacteria 1166
643 Ga0395900_0565194 3300037418 Bacteria 1080
644 Ga0395900_0573773 3300037418 Bacteria 1070
645 Ga0395900_0611480 3300037418 Unclassified 1029
646 Ga0395900_0639264 3300037418 Bacteria 1001
647 Ga0395900_1052900 3300037418 Unclassified 732
648 Ga0395900_1084293 3300037418 Bacteria 718
649 Ga0395900_1392037 3300037418 Bacteria 614
650 Ga0395900_1483584 3300037418 Unclassified 590
651 Ga0395898_0024517 3300037466 Bacteria 6083
652 Ga0395898_0049701 3300037466 Unclassified 4108
653 Ga0395898_0064883 3300037466 Bacteria 3541
654 Ga0395898_0076467 3300037466 Bacteria 3233
655 Ga0395898_0106743 3300037466 Bacteria 2686
656 Ga0395898_0116659 3300037466 Bacteria 2558
657 Ga0395898_0133757 3300037466 Bacteria 2374
658 Ga0395898_0133848 3300037466 Bacteria 2373
659 Ga0395898_0165002 3300037466 Bacteria 2118
660 Ga0395898_0264782 3300037466 Bacteria 1639
661 Ga0395898_0331733 3300037466 Bacteria 1450
662 Ga0395898_0517435 3300037466 Bacteria 1134
663 Ga0395898_0695901 3300037466 Bacteria 958
664 Ga0395898_1366445 3300037466 Bacteria 636
665 Ga0395905_0001106 3300037471 Bacteria 33891
666 Ga0395905_0022646 3300037471 Bacteria 5939
667 Ga0395905_0032485 3300037471 Bacteria 4909
668 Ga0395905_0037636 3300037471 Unclassified 4541
669 Ga0395905_0049175 3300037471 Bacteria 3951
670 Ga0395905_0054282 3300037471 Bacteria 3750
671 Ga0395905_0054640 3300037471 Bacteria 3737
672 Ga0395905_0057256 3300037471 Bacteria 3646
673 Ga0395905_0058650 3300037471 Bacteria 3599
674 Ga0395905_0107873 3300037471 Bacteria 2614
675 Ga0395905_0116181 3300037471 Bacteria 2515
676 Ga0395905_0491054 3300037471 Bacteria 1127
677 Ga0395905_0521312 3300037471 Bacteria 1089
678 Ga0395905_0562541 3300037471 Bacteria 1041
679 Ga0395905_0845200 3300037471 Bacteria 818
680 Ga0395905_1149910 3300037471 Bacteria 679
681 Ga0395905_1391864 3300037471 Bacteria 605
682 Ga0395905_1508981 3300037471 Unclassified 576
683 Ga0436364_0279375 3300037853 Bacteria 1060
684 Ga0436364_0544140 3300037853 Bacteria 2277
685 Ga0395901_0024874 3300038443 Bacteria 6146
686 Ga0395901_0057025 3300038443 Bacteria 4063
687 Ga0395901_0083360 3300038443 Bacteria 3341
688 Ga0395901_0083426 3300038443 Bacteria 3340
689 Ga0395901_0158555 3300038443 Bacteria 2376
690 Ga0395901_0187206 3300038443 Bacteria 2171
691 Ga0395901_0282145 3300038443 Bacteria 1725
692 Ga0395901_0366533 3300038443 Bacteria 1484
693 Ga0395901_0368050 3300038443 Bacteria 1481
694 Ga0395901_0514020 3300038443 Bacteria 1217
695 Ga0395901_0626808 3300038443 Bacteria 1081
696 Ga0395901_0901023 3300038443 Bacteria 866
697 Ga0395901_1169261 3300038443 Bacteria 736
698 Ga0395901_1517650 3300038443 Bacteria 625
699 Ga0395901_1541995 3300038443 Unclassified 619
700 Ga0436365_1573894 3300039437 Bacteria 40649
701 Ga0436363_0981132 3300039450 Bacteria 4088
702 Ga0436363_1083017 3300039450 Bacteria 519
703 Ga0451791_1088308 3300041451 Bacteria 561
704 Ga0451807_1979107 3300041486 Unclassified 625
705 Ga0451853_2615642 3300041512 Unclassified 531
706 Ga0439445_0008474 3300042004 Bacteria 2405
707 Ga0439432_010454 3300042006 Bacteria 3211
708 Ga0466969_0003975 3300044656 Bacteria 7850
709 Ga0466972_0060729 3300044658 Bacteria 1813
710 Ga0466972_0169829 3300044658 Unclassified 1024
711 Ga0466972_0468196 3300044658 Bacteria 592
712 Ga0466965_0151320 3300044683 Bacteria 1213
713 Ga0466966_0001822 3300044684 Bacteria 13822
714 Ga0466966_0041887 3300044684 Bacteria 2941
715 Ga0466966_0400081 3300044684 Unclassified 825
716 Ga0466966_0478893 3300044684 Bacteria 748
717 Ga0466961_0029516 3300044693 Bacteria 3524
718 Ga0466961_0177851 3300044693 Bacteria 1322
719 Ga0466963_0013039 3300044694 Bacteria 5096
720 Ga0466963_0030059 3300044694 Bacteria 3502
721 Ga0466963_0033198 3300044694 Bacteria 3348
722 Ga0466963_0401227 3300044694 Bacteria 967
723 Ga0466963_1244149 3300044694 Unclassified 523
724 Ga0466964_0028821 3300044706 Bacteria 2189
725 Ga0466964_0527626 3300044706 Unclassified 638
726 Ga0466964_0794791 3300044706 Unclassified 534
727 Ga0466971_0018868 3300044719 Bacteria 3058
728 Ga0466971_0222631 3300044719 Unclassified 895
729 Ga0466968_0043339 3300044735 Bacteria 1904
730 Ga0466968_0252339 3300044735 Unclassified 838
731 Ga0466968_0460538 3300044735 Unclassified 630
732 Ga0466970_0009359 3300044765 Bacteria 4949
733 Ga0466970_0012994 3300044765 Bacteria 4265
734 Ga0466970_0137718 3300044765 Unclassified 1343
735 Ga0466970_0190738 3300044765 Bacteria 1139
736 Ga0466970_0694615 3300044765 Bacteria 593
737 Ga0466957_0005294 3300044842 Bacteria 7230
738 Ga0466957_0111514 3300044842 Bacteria 1735
739 Ga0466957_0162775 3300044842 Unclassified 1450
740 Ga0466960_0007103 3300044901 Bacteria 4528
741 Ga0466960_0156275 3300044901 Bacteria 1222
742 Ga0466960_0672063 3300044901 Unclassified 619
743 Ga0466959_0031205 3300045049 Bacteria 3943
744 Ga0466959_0087402 3300045049 Bacteria 2242
745 Ga0466959_0447866 3300045049 Bacteria 875
746 Ga0466959_0760979 3300045049 Unclassified 648
747 Ga0466958_0008311 3300045836 Bacteria 5747
748 Ga0466958_0066608 3300045836 Bacteria 2199
749 Ga0466958_0804440 3300045836 Bacteria 613
750 Ga0466967_0058604 3300045976 Bacteria 3404
751 Ga0466967_0210372 3300045976 Bacteria 1844
752 Ga0466967_0263853 3300045976 Bacteria 1648
753 Ga0466967_0289552 3300045976 Bacteria 1573
754 Ga0466967_0472157 3300045976 Bacteria 1228
755 Ga0466967_0816901 3300045976 Bacteria 926
756 Ga0466967_0876677 3300045976 Bacteria 892
757 Ga0495642_0372244 3300046528 Unclassified 629
758 Ga0495587_0372038 3300046536 Unclassified 795
759 Ga0495621_0019365 3300046539 Bacteria 2222
760 Ga0495667_0375645 3300046559 Unclassified 897
761 Ga0495667_0377669 3300046559 Unclassified 894
762 Ga0495668_0621981 3300046616 Bacteria 597
763 Ga0495599_0803156 3300046678 Unclassified 537
764 Ga0495669_0063753 3300046684 Bacteria 1672
765 Ga0495669_0550405 3300046684 Unclassified 561
766 Ga0495670_0262392 3300046691 Bacteria 922
767 Ga0495675_0181879 3300047444 Unclassified 1287
768 Ga0495677_0213325 3300047445 Bacteria 751
769 Ga0496100_1656223 3300048903 Unclassified 506
770 Ga0496102_0111311 3300048905 Bacteria 2553
771 Ga0496103_0034177 3300048906 Bacteria 3109
772 Ga0496106_0625856 3300048909 Bacteria 861
773 Ga0496106_0799005 3300048909 Unclassified 748
774 Ga0496107_0046892 3300048910 Bacteria 3111
775 Ga0496107_0351342 3300048910 Bacteria 1097
776 Ga0496107_0713653 3300048910 Unclassified 737
777 Ga0496107_1027817 3300048910 Unclassified 597
778 Ga0496107_1133145 3300048910 Unclassified 564
779 Ga0496108_0035706 3300048911 Bacteria 4133
780 Ga0496108_0745366 3300048911 Bacteria 847
781 Ga0496108_0936326 3300048911 Bacteria 742
782 Ga0496109_0004188 3300048912 Bacteria 12033
783 Ga0496109_0055116 3300048912 Bacteria 3627
784 Ga0496109_0244208 3300048912 Unclassified 1690
785 Ga0496110_0026346 3300048913 Bacteria 4974
786 Ga0496110_0317165 3300048913 Bacteria 1420
787 Ga0496110_0596932 3300048913 Unclassified 1002
788 Ga0496110_1110834 3300048913 Unclassified 699
789 Ga0496111_0089167 3300048914 Bacteria 2259
790 Ga0496111_0199170 3300048914 Bacteria 1489
791 Ga0496111_0250037 3300048914 Bacteria 1316
792 Ga0496112_0030806 3300048915 Bacteria 5196
793 Ga0496112_0036909 3300048915 Bacteria 4768
794 Ga0496112_0058370 3300048915 Bacteria 3800
795 Ga0496113_0110084 3300048916 Bacteria 2143
796 Ga0496113_0182481 3300048916 Bacteria 1664
797 Ga0501293_005423 3300049516 Bacteria 1024
798 Ga0501068_0167668 3300049584 Bacteria 1385
799 Ga0501216_088814 3300049660 Bacteria 665
800 Ga0501217_340245 3300049661 Unclassified 503
801 Ga0501242_039379 3300049674 Unclassified 664
802 Ga0501080_1247613 3300049742 Unclassified 638
803 Ga0501269_051370 3300049766 Bacteria 568
804 Ga0501204_028731 3300049850 Unclassified 763
805 Ga0495619_0377285 3300053085 Bacteria 980
806 Ga0501082_0203467 3300060353 Unclassified 1723
807 Ga0466962_0012689 3300061719 Bacteria 4053
808 Ga0466962_0598700 3300061719 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10100250 Ga0105240_101002506 75
2 3300025913 Ga0207695_10011732 Ga0207695_100117327 75
3 3300005834 Ga0068851_10800478 Ga0068851_108004782 77
4 3300009094 Ga0111539_12712655 Ga0111539_127126552 78
5 3300049766 Ga0501269_051370 Ga0501269_051370_11_250 79
6 3300014326 Ga0157380_10869011 Ga0157380_108690113 80
7 3300046684 Ga0495669_0063753 Ga0495669_0063753_11_256 81
8 iso_pu_bacteria 8056967851 8056975693 81
9 3300049584 Ga0501068_0167668 Ga0501068_0167668_743_1021 83
10 3300003323 rootH1_10157953 rootH1_101579534 85
11 3300031548 Ga0307408_100316481 Ga0307408_1003164813 85
12 3300031731 Ga0307405_10189910 Ga0307405_101899102 85
13 3300031731 Ga0307405_11688891 Ga0307405_116888912 85
14 3300032002 Ga0307416_101282301 Ga0307416_1012823012 85
15 3300044842 Ga0466957_0111514 Ga0466957_0111514_1378_1635 85
16 3300005335 Ga0070666_10105056 Ga0070666_101050564 87
17 3300021377 Ga0213874_10011211 Ga0213874_100112112 87
18 3300021384 Ga0213876_10000252 Ga0213876_1000025223 87
19 3300025903 Ga0207680_10108269 Ga0207680_101082694 87
20 3300025924 Ga0207694_10836312 Ga0207694_108363122 87
21 3300025941 Ga0207711_10190060 Ga0207711_101900604 87
22 3300028379 Ga0268266_11836538 Ga0268266_118365382 87
23 3300037853 Ga0436364_0279375 Ga0436364_0279375_387_650 87
24 3300037853 Ga0436364_0544140 Ga0436364_0544140_14_277 87
25 3300039437 Ga0436365_1573894 Ga0436365_1573894_27982_28245 87
26 3300039450 Ga0436363_0981132 Ga0436363_0981132_2350_2613 87
27 3300039450 Ga0436363_1083017 Ga0436363_1083017_63_326 87
28 3300005436 Ga0070713_100462693 Ga0070713_1004626934 88
29 3300005563 Ga0068855_100465585 Ga0068855_1004655853 88
30 3300006846 Ga0075430_100671514 Ga0075430_1006715143 88
31 3300009093 Ga0105240_10095158 Ga0105240_100951582 88
32 3300009545 Ga0105237_12196328 Ga0105237_121963282 88
33 3300009551 Ga0105238_10001904 Ga0105238_1000190425 88
34 3300013307 Ga0157372_10672971 Ga0157372_106729711 88
35 3300025898 Ga0207692_10122221 Ga0207692_101222212 88
36 3300025914 Ga0207671_10229107 Ga0207671_102291073 88
37 3300025924 Ga0207694_10048486 Ga0207694_100484865 88
38 3300035118 Ga0373954_0634977 Ga0373954_0634977_222_488 88
39 3300035119 Ga0373956_0244655 Ga0373956_0244655_456_722 88
40 3300035119 Ga0373956_0606019 Ga0373956_0606019_98_364 88
41 3300035172 Ga0373955_0407706 Ga0373955_0407706_536_802 88
42 3300035724 Ga0373933_0088697 Ga0373933_0088697_673_939 88
43 3300036401 Ga0373937_0002021 Ga0373937_0002021_10083_10349 88
44 3300036401 Ga0373937_0106446 Ga0373937_0106446_508_774 88
45 3300037068 Ga0373925_1220972 Ga0373925_1220972_31_297 88
46 3300046536 Ga0495587_0372038 Ga0495587_0372038_291_557 88
47 3300046559 Ga0495667_0375645 Ga0495667_0375645_250_516 88
48 3300046559 Ga0495667_0377669 Ga0495667_0377669_246_512 88
49 3300046678 Ga0495599_0803156 Ga0495599_0803156_197_463 88
50 3300047444 Ga0495675_0181879 Ga0495675_0181879_205_471 88
51 3300053085 Ga0495619_0377285 Ga0495619_0377285_632_898 88
52 3300035724 Ga0373933_0786815 Ga0373933_0786815_229_501 89
53 3300036401 Ga0373937_1327239 Ga0373937_1327239_261_533 89
54 3300036401 Ga0373937_1658272 Ga0373937_1658272_83_355 89
55 3300044901 Ga0466960_0156275 Ga0466960_0156275_531_800 89
56 3300049742 Ga0501080_1247613 Ga0501080_1247613_90_359 89
57 3300060353 Ga0501082_0203467 Ga0501082_0203467_480_749 89
58 3300005327 Ga0070658_10024710 Ga0070658_100247102 90
59 3300005347 Ga0070668_100236045 Ga0070668_1002360453 90
60 3300005366 Ga0070659_100713677 Ga0070659_1007136772 90
61 3300005367 Ga0070667_100002368 Ga0070667_10000236813 90
62 3300005530 Ga0070679_100588432 Ga0070679_1005884322 90
63 3300005530 Ga0070679_101311004 Ga0070679_1013110041 90
64 3300005535 Ga0070684_100821632 Ga0070684_1008216322 90
65 3300005548 Ga0070665_100002076 Ga0070665_10000207618 90
66 3300005548 Ga0070665_100556726 Ga0070665_1005567264 90
67 3300005578 Ga0068854_100316408 Ga0068854_1003164082 90
68 3300005614 Ga0068856_102433070 Ga0068856_1024330702 90
69 3300005616 Ga0068852_100789884 Ga0068852_1007898843 90
70 3300005719 Ga0068861_102683897 Ga0068861_1026838972 90
71 3300005844 Ga0068862_100020659 Ga0068862_1000206597 90
72 3300006946 Ga0079104_1048787 Ga0079104_10487872 90
73 3300009101 Ga0105247_10889170 Ga0105247_108891702 90
74 3300009177 Ga0105248_10205694 Ga0105248_102056943 90
75 3300009551 Ga0105238_10286464 Ga0105238_102864643 90
76 3300013100 Ga0157373_10625052 Ga0157373_106250522 90
77 3300014325 Ga0163163_10855137 Ga0163163_108551371 90
78 3300025909 Ga0207705_10020766 Ga0207705_100207663 90
79 3300025912 Ga0207707_10589459 Ga0207707_105894592 90
80 3300025920 Ga0207649_11618885 Ga0207649_116188852 90
81 3300025921 Ga0207652_11240644 Ga0207652_112406442 90
82 3300025924 Ga0207694_10227060 Ga0207694_102270603 90
83 3300025932 Ga0207690_11244770 Ga0207690_112447701 90
84 3300025933 Ga0207706_10081080 Ga0207706_100810805 90
85 3300025941 Ga0207711_10136228 Ga0207711_101362283 90
86 3300025972 Ga0207668_10000010 Ga0207668_10000010171 90
87 3300025986 Ga0207658_10004019 Ga0207658_100040192 90
88 3300026142 Ga0207698_10624213 Ga0207698_106242132 90
89 3300027111 Ga0209281_1063974 Ga0209281_10639741 90
90 3300027378 Ga0209981_1015381 Ga0209981_10153812 90
91 3300027614 Ga0209970_1049701 Ga0209970_10497011 90
92 3300027665 Ga0209983_1089699 Ga0209983_10896992 90
93 3300028379 Ga0268266_10001182 Ga0268266_1000118229 90
94 3300028379 Ga0268266_10077345 Ga0268266_100773454 90
95 3300028380 Ga0268265_10009628 Ga0268265_100096285 90
96 3300031548 Ga0307408_100055059 Ga0307408_1000550593 90
97 3300031731 Ga0307405_10076710 Ga0307405_100767104 90
98 3300031824 Ga0307413_10301444 Ga0307413_103014443 90
99 3300031852 Ga0307410_10241895 Ga0307410_102418953 90
100 3300031901 Ga0307406_10032078 Ga0307406_100320783 90
101 3300031903 Ga0307407_10278640 Ga0307407_102786403 90
102 3300031911 Ga0307412_10048386 Ga0307412_100483863 90
103 3300031995 Ga0307409_100367523 Ga0307409_1003675233 90
104 3300032002 Ga0307416_100411372 Ga0307416_1004113724 90
105 3300032004 Ga0307414_10224282 Ga0307414_102242822 90
106 3300032005 Ga0307411_10138656 Ga0307411_101386561 90
107 3300032126 Ga0307415_100153682 Ga0307415_1001536823 90
108 3300037312 Ga0395899_0079490 Ga0395899_0079490_193_465 90
109 3300037312 Ga0395899_0094335 Ga0395899_0094335_1365_1637 90
110 3300037312 Ga0395899_0238139 Ga0395899_0238139_301_573 90
111 3300037418 Ga0395900_0026006 Ga0395900_0026006_5033_5305 90
112 3300037418 Ga0395900_0573773 Ga0395900_0573773_734_1006 90
113 3300037466 Ga0395898_0064883 Ga0395898_0064883_2969_3241 90
114 3300037466 Ga0395898_0165002 Ga0395898_0165002_403_675 90
115 3300037466 Ga0395898_1366445 Ga0395898_1366445_62_334 90
116 3300037471 Ga0395905_0022646 Ga0395905_0022646_3626_3898 90
117 3300037471 Ga0395905_0032485 Ga0395905_0032485_776_1048 90
118 3300037471 Ga0395905_0049175 Ga0395905_0049175_2361_2633 90
119 3300037471 Ga0395905_0057256 Ga0395905_0057256_2288_2560 90
120 3300038443 Ga0395901_0187206 Ga0395901_0187206_426_698 90
121 3300038443 Ga0395901_0514020 Ga0395901_0514020_551_823 90
122 3300038443 Ga0395901_1169261 Ga0395901_1169261_70_342 90
123 3300044735 Ga0466968_0252339 Ga0466968_0252339_459_731 90
124 3300044765 Ga0466970_0190738 Ga0466970_0190738_509_781 90
125 3300001904 JGI24736J21556_1000382 JGI24736J21556_10003824 91
126 3300001915 JGI24741J21665_1049254 JGI24741J21665_10492541 91
127 3300001979 JGI24740J21852_10006215 JGI24740J21852_100062154 91
128 3300001989 JGI24739J22299_10006988 JGI24739J22299_100069883 91
129 3300001990 JGI24737J22298_10044515 JGI24737J22298_100445154 91
130 3300001990 JGI24737J22298_10085416 JGI24737J22298_100854162 91
131 3300001991 JGI24743J22301_10007929 JGI24743J22301_100079293 91
132 3300002075 JGI24738J21930_10100948 JGI24738J21930_101009481 91
133 3300003323 rootH1_10152419 rootH1_101524193 91
134 3300005293 Ga0065715_10650600 Ga0065715_106506002 91
135 3300005327 Ga0070658_10394351 Ga0070658_103943511 91
136 3300005327 Ga0070658_10406753 Ga0070658_104067532 91
137 3300005327 Ga0070658_11274764 Ga0070658_112747641 91
138 3300005328 Ga0070676_10207660 Ga0070676_102076602 91
139 3300005329 Ga0070683_100349142 Ga0070683_1003491422 91
140 3300005329 Ga0070683_101015834 Ga0070683_1010158342 91
141 3300005330 Ga0070690_101717688 Ga0070690_1017176882 91
142 3300005331 Ga0070670_100158275 Ga0070670_1001582753 91
143 3300005335 Ga0070666_10104009 Ga0070666_101040093 91
144 3300005335 Ga0070666_10248030 Ga0070666_102480303 91
145 3300005336 Ga0070680_100850939 Ga0070680_1008509392 91
146 3300005336 Ga0070680_100948711 Ga0070680_1009487111 91
147 3300005337 Ga0070682_100196997 Ga0070682_1001969974 91
148 3300005338 Ga0068868_101362035 Ga0068868_1013620351 91
149 3300005339 Ga0070660_100018065 Ga0070660_1000180653 91
150 3300005339 Ga0070660_100067006 Ga0070660_1000670065 91
151 3300005339 Ga0070660_100327635 Ga0070660_1003276352 91
152 3300005339 Ga0070660_100681345 Ga0070660_1006813453 91
153 3300005344 Ga0070661_100027889 Ga0070661_1000278892 91
154 3300005344 Ga0070661_100113884 Ga0070661_1001138843 91
155 3300005344 Ga0070661_100287256 Ga0070661_1002872562 91
156 3300005344 Ga0070661_100660041 Ga0070661_1006600412 91
157 3300005355 Ga0070671_100087676 Ga0070671_1000876765 91
158 3300005355 Ga0070671_100726234 Ga0070671_1007262342 91
159 3300005364 Ga0070673_100023615 Ga0070673_1000236153 91
160 3300005366 Ga0070659_100007212 Ga0070659_1000072123 91
161 3300005366 Ga0070659_100724465 Ga0070659_1007244652 91
162 3300005367 Ga0070667_100000842 Ga0070667_10000084238 91
163 3300005455 Ga0070663_100030813 Ga0070663_1000308135 91
164 3300005455 Ga0070663_100357834 Ga0070663_1003578341 91
165 3300005455 Ga0070663_101704488 Ga0070663_1017044881 91
166 3300005457 Ga0070662_100006841 Ga0070662_1000068416 91
167 3300005457 Ga0070662_100445387 Ga0070662_1004453872 91
168 3300005530 Ga0070679_100250873 Ga0070679_1002508734 91
169 3300005535 Ga0070684_100189185 Ga0070684_1001891851 91
170 3300005535 Ga0070684_101647831 Ga0070684_1016478311 91
171 3300005539 Ga0068853_100227657 Ga0068853_1002276573 91
172 3300005539 Ga0068853_100612475 Ga0068853_1006124751 91
173 3300005548 Ga0070665_100009746 Ga0070665_1000097464 91
174 3300005563 Ga0068855_100060863 Ga0068855_1000608632 91
175 3300005563 Ga0068855_100204771 Ga0068855_1002047712 91
176 3300005563 Ga0068855_100741020 Ga0068855_1007410203 91
177 3300005563 Ga0068855_101404228 Ga0068855_1014042282 91
178 3300005564 Ga0070664_100138010 Ga0070664_1001380103 91
179 3300005577 Ga0068857_100188969 Ga0068857_1001889695 91
180 3300005578 Ga0068854_100008303 Ga0068854_1000083031 91
181 3300005578 Ga0068854_100011084 Ga0068854_1000110849 91
182 3300005578 Ga0068854_100337153 Ga0068854_1003371532 91
183 3300005578 Ga0068854_100470361 Ga0068854_1004703614 91
184 3300005614 Ga0068856_100011210 Ga0068856_10001121011 91
185 3300005614 Ga0068856_100301739 Ga0068856_1003017392 91
186 3300005614 Ga0068856_100771310 Ga0068856_1007713102 91
187 3300005614 Ga0068856_100978710 Ga0068856_1009787103 91
188 3300005616 Ga0068852_100004297 Ga0068852_1000042972 91
189 3300005616 Ga0068852_100232084 Ga0068852_1002320844 91
190 3300005616 Ga0068852_100257478 Ga0068852_1002574783 91
191 3300005616 Ga0068852_100822797 Ga0068852_1008227974 91
192 3300006358 Ga0068871_101688605 Ga0068871_1016886052 91
193 3300009093 Ga0105240_10127198 Ga0105240_101271982 91
194 3300009093 Ga0105240_10334650 Ga0105240_103346505 91
195 3300009093 Ga0105240_11219910 Ga0105240_112199102 91
196 3300009093 Ga0105240_12069201 Ga0105240_120692011 91
197 3300009174 Ga0105241_10472204 Ga0105241_104722044 91
198 3300009177 Ga0105248_10064040 Ga0105248_100640404 91
199 3300009545 Ga0105237_10134559 Ga0105237_101345596 91
200 3300009551 Ga0105238_10096544 Ga0105238_100965445 91
201 3300010375 Ga0105239_10776122 Ga0105239_107761221 91
202 3300010375 Ga0105239_11470741 Ga0105239_114707411 91
203 3300013100 Ga0157373_10090777 Ga0157373_100907774 91
204 3300013100 Ga0157373_10213658 Ga0157373_102136584 91
205 3300013100 Ga0157373_10298860 Ga0157373_102988602 91
206 3300013100 Ga0157373_11544602 Ga0157373_115446022 91
207 3300013102 Ga0157371_10102338 Ga0157371_101023384 91
208 3300013102 Ga0157371_10436944 Ga0157371_104369441 91
209 3300013102 Ga0157371_11267875 Ga0157371_112678752 91
210 3300013104 Ga0157370_10725281 Ga0157370_107252812 91
211 3300013104 Ga0157370_11053957 Ga0157370_110539572 91
212 3300013105 Ga0157369_10000106 Ga0157369_1000010665 91
213 3300013105 Ga0157369_10049843 Ga0157369_100498432 91
214 3300013105 Ga0157369_10203373 Ga0157369_102033735 91
215 3300013105 Ga0157369_10996497 Ga0157369_109964973 91
216 3300013296 Ga0157374_10055319 Ga0157374_100553193 91
217 3300013307 Ga0157372_10712592 Ga0157372_107125924 91
218 3300013307 Ga0157372_10965571 Ga0157372_109655711 91
219 3300013307 Ga0157372_12602767 Ga0157372_126027672 91
220 3300025903 Ga0207680_10055355 Ga0207680_100553553 91
221 3300025904 Ga0207647_10056487 Ga0207647_100564876 91
222 3300025904 Ga0207647_10113491 Ga0207647_101134913 91
223 3300025904 Ga0207647_10276370 Ga0207647_102763702 91
224 3300025907 Ga0207645_10388657 Ga0207645_103886572 91
225 3300025909 Ga0207705_10000151 Ga0207705_1000015125 91
226 3300025909 Ga0207705_10474948 Ga0207705_104749482 91
227 3300025913 Ga0207695_10002502 Ga0207695_1000250218 91
228 3300025913 Ga0207695_10033176 Ga0207695_100331763 91
229 3300025913 Ga0207695_10676261 Ga0207695_106762614 91
230 3300025917 Ga0207660_10769788 Ga0207660_107697882 91
231 3300025919 Ga0207657_10006968 Ga0207657_100069687 91
232 3300025919 Ga0207657_10106702 Ga0207657_101067023 91
233 3300025919 Ga0207657_10573858 Ga0207657_105738582 91
234 3300025920 Ga0207649_10007523 Ga0207649_100075232 91
235 3300025920 Ga0207649_10131760 Ga0207649_101317605 91
236 3300025920 Ga0207649_10293073 Ga0207649_102930734 91
237 3300025920 Ga0207649_11523809 Ga0207649_115238092 91
238 3300025921 Ga0207652_10191918 Ga0207652_101919182 91
239 3300025931 Ga0207644_10638638 Ga0207644_106386383 91
240 3300025931 Ga0207644_10853834 Ga0207644_108538342 91
241 3300025932 Ga0207690_10011217 Ga0207690_100112173 91
242 3300025933 Ga0207706_10169165 Ga0207706_101691653 91
243 3300025941 Ga0207711_10729288 Ga0207711_107292883 91
244 3300025944 Ga0207661_10122260 Ga0207661_101222605 91
245 3300025944 Ga0207661_11065571 Ga0207661_110655712 91
246 3300025945 Ga0207679_10362464 Ga0207679_103624643 91
247 3300025949 Ga0207667_10037667 Ga0207667_100376672 91
248 3300025949 Ga0207667_10179975 Ga0207667_101799755 91
249 3300025949 Ga0207667_10239222 Ga0207667_102392222 91
250 3300025960 Ga0207651_10151990 Ga0207651_101519903 91
251 3300025981 Ga0207640_10007063 Ga0207640_100070633 91
252 3300025981 Ga0207640_10013046 Ga0207640_100130463 91
253 3300025981 Ga0207640_10299579 Ga0207640_102995792 91
254 3300025981 Ga0207640_10507068 Ga0207640_105070684 91
255 3300025986 Ga0207658_10076645 Ga0207658_100766453 91
256 3300025986 Ga0207658_11492494 Ga0207658_114924942 91
257 3300026023 Ga0207677_10220964 Ga0207677_102209643 91
258 3300026041 Ga0207639_10496425 Ga0207639_104964252 91
259 3300026041 Ga0207639_10917284 Ga0207639_109172842 91
260 3300026067 Ga0207678_10000989 Ga0207678_1000098923 91
261 3300026067 Ga0207678_10080669 Ga0207678_100806693 91
262 3300026078 Ga0207702_10005655 Ga0207702_100056554 91
263 3300026078 Ga0207702_10010126 Ga0207702_100101263 91
264 3300026078 Ga0207702_10030457 Ga0207702_100304578 91
265 3300026078 Ga0207702_11330153 Ga0207702_113301532 91
266 3300026116 Ga0207674_10514666 Ga0207674_105146663 91
267 3300026121 Ga0207683_10989646 Ga0207683_109896462 91
268 3300026142 Ga0207698_10002956 Ga0207698_100029565 91
269 3300026142 Ga0207698_10016415 Ga0207698_100164158 91
270 3300026142 Ga0207698_10305848 Ga0207698_103058483 91
271 3300026142 Ga0207698_11294445 Ga0207698_112944451 91
272 3300028379 Ga0268266_10183778 Ga0268266_101837785 91
273 3300031548 Ga0307408_100021515 Ga0307408_1000215156 91
274 3300031548 Ga0307408_100632649 Ga0307408_1006326492 91
275 3300031731 Ga0307405_10233033 Ga0307405_102330333 91
276 3300031824 Ga0307413_10876323 Ga0307413_108763232 91
277 3300031824 Ga0307413_10980425 Ga0307413_109804252 91
278 3300031852 Ga0307410_10005912 Ga0307410_100059122 91
279 3300031852 Ga0307410_10373925 Ga0307410_103739253 91
280 3300031852 Ga0307410_10387373 Ga0307410_103873733 91
281 3300031852 Ga0307410_10410416 Ga0307410_104104162 91
282 3300031901 Ga0307406_10168493 Ga0307406_101684932 91
283 3300031901 Ga0307406_10692311 Ga0307406_106923112 91
284 3300031903 Ga0307407_10084958 Ga0307407_100849583 91
285 3300031903 Ga0307407_10487270 Ga0307407_104872701 91
286 3300031903 Ga0307407_10782182 Ga0307407_107821822 91
287 3300031911 Ga0307412_10031102 Ga0307412_100311023 91
288 3300031911 Ga0307412_11496371 Ga0307412_114963712 91
289 3300031911 Ga0307412_11711862 Ga0307412_117118622 91
290 3300031911 Ga0307412_11847745 Ga0307412_118477451 91
291 3300031911 Ga0307412_12151644 Ga0307412_121516442 91
292 3300031995 Ga0307409_100019126 Ga0307409_1000191262 91
293 3300031995 Ga0307409_100117826 Ga0307409_1001178263 91
294 3300031995 Ga0307409_100201397 Ga0307409_1002013973 91
295 3300031995 Ga0307409_101510266 Ga0307409_1015102662 91
296 3300032002 Ga0307416_100325149 Ga0307416_1003251493 91
297 3300032002 Ga0307416_103459952 Ga0307416_1034599522 91
298 3300032004 Ga0307414_10000536 Ga0307414_1000053619 91
299 3300032004 Ga0307414_10002526 Ga0307414_100025263 91
300 3300032004 Ga0307414_10266169 Ga0307414_102661693 91
301 3300032005 Ga0307411_10032212 Ga0307411_100322124 91
302 3300032005 Ga0307411_10079151 Ga0307411_100791513 91
303 3300032005 Ga0307411_10084871 Ga0307411_100848713 91
304 3300032005 Ga0307411_10723194 Ga0307411_107231943 91
305 3300032126 Ga0307415_100230747 Ga0307415_1002307472 91
306 3300032126 Ga0307415_100572265 Ga0307415_1005722653 91
307 3300032126 Ga0307415_101258758 Ga0307415_1012587582 91
308 3300037312 Ga0395899_0034393 Ga0395899_0034393_3474_3749 91
309 3300037312 Ga0395899_0037068 Ga0395899_0037068_2314_2589 91
310 3300037312 Ga0395899_0061730 Ga0395899_0061730_1311_1586 91
311 3300037418 Ga0395900_0001394 Ga0395900_0001394_4408_4683 91
312 3300037418 Ga0395900_0057719 Ga0395900_0057719_1658_1933 91
313 3300037418 Ga0395900_0098145 Ga0395900_0098145_1154_1429 91
314 3300037418 Ga0395900_0120394 Ga0395900_0120394_1725_2000 91
315 3300037418 Ga0395900_0419465 Ga0395900_0419465_392_667 91
316 3300037418 Ga0395900_0499748 Ga0395900_0499748_198_473 91
317 3300037418 Ga0395900_0565194 Ga0395900_0565194_506_781 91
318 3300037418 Ga0395900_0611480 Ga0395900_0611480_249_524 91
319 3300037418 Ga0395900_1052900 Ga0395900_1052900_206_481 91
320 3300037418 Ga0395900_1483584 Ga0395900_1483584_229_504 91
321 3300037466 Ga0395898_0024517 Ga0395898_0024517_5624_5899 91
322 3300037466 Ga0395898_0106743 Ga0395898_0106743_697_972 91
323 3300037466 Ga0395898_0133757 Ga0395898_0133757_537_812 91
324 3300037466 Ga0395898_0331733 Ga0395898_0331733_625_900 91
325 3300037466 Ga0395898_0695901 Ga0395898_0695901_403_678 91
326 3300037471 Ga0395905_0001106 Ga0395905_0001106_24151_24426 91
327 3300037471 Ga0395905_0058650 Ga0395905_0058650_1822_2097 91
328 3300037471 Ga0395905_0116181 Ga0395905_0116181_1439_1714 91
329 3300037471 Ga0395905_1508981 Ga0395905_1508981_75_350 91
330 3300038443 Ga0395901_0083426 Ga0395901_0083426_1944_2219 91
331 3300038443 Ga0395901_0368050 Ga0395901_0368050_603_878 91
332 3300038443 Ga0395901_0626808 Ga0395901_0626808_500_775 91
333 3300044656 Ga0466969_0003975 Ga0466969_0003975_6245_6520 91
334 3300044684 Ga0466966_0001822 Ga0466966_0001822_1550_1825 91
335 3300044693 Ga0466961_0029516 Ga0466961_0029516_1452_1727 91
336 3300044694 Ga0466963_0013039 Ga0466963_0013039_4210_4485 91
337 3300044694 Ga0466963_0030059 Ga0466963_0030059_2755_3030 91
338 3300044694 Ga0466963_1244149 Ga0466963_1244149_101_376 91
339 3300044706 Ga0466964_0527626 Ga0466964_0527626_234_509 91
340 3300044719 Ga0466971_0018868 Ga0466971_0018868_2186_2461 91
341 3300044765 Ga0466970_0009359 Ga0466970_0009359_1962_2237 91
342 3300044842 Ga0466957_0005294 Ga0466957_0005294_6446_6721 91
343 3300045049 Ga0466959_0031205 Ga0466959_0031205_1236_1511 91
344 3300045049 Ga0466959_0760979 Ga0466959_0760979_226_501 91
345 3300045836 Ga0466958_0008311 Ga0466958_0008311_4238_4513 91
346 3300045976 Ga0466967_0472157 Ga0466967_0472157_384_659 91
347 3300048910 Ga0496107_1133145 Ga0496107_1133145_271_546 91
348 3300048911 Ga0496108_0745366 Ga0496108_0745366_442_717 91
349 3300048912 Ga0496109_0244208 Ga0496109_0244208_958_1233 91
350 3300048913 Ga0496110_1110834 Ga0496110_1110834_180_455 91
351 3300048915 Ga0496112_0036909 Ga0496112_0036909_3851_4126 91
352 3300048916 Ga0496113_0110084 Ga0496113_0110084_358_633 91
353 3300049516 Ga0501293_005423 Ga0501293_005423_135_413 91
354 3300049660 Ga0501216_088814 Ga0501216_088814_170_448 91
355 3300049661 Ga0501217_340245 Ga0501217_340245_173_457 91
356 3300049674 Ga0501242_039379 Ga0501242_039379_245_526 91
357 3300049850 Ga0501204_028731 Ga0501204_028731_198_479 91
358 3300061719 Ga0466962_0012689 Ga0466962_0012689_61_336 91
359 2162886012 MBSR1b_contig_2102004 MBSR1b_0166.00001860 92
360 3300001989 JGI24739J22299_10001003 JGI24739J22299_100010034 92
361 3300001989 JGI24739J22299_10079134 JGI24739J22299_100791342 92
362 3300001990 JGI24737J22298_10000223 JGI24737J22298_1000022311 92
363 3300001990 JGI24737J22298_10090169 JGI24737J22298_100901693 92
364 3300001990 JGI24737J22298_10128654 JGI24737J22298_101286543 92
365 3300002075 JGI24738J21930_10000303 JGI24738J21930_100003034 92
366 3300002075 JGI24738J21930_10088973 JGI24738J21930_100889732 92
367 3300002077 JGI24744J21845_10007277 JGI24744J21845_100072773 92
368 3300003320 rootH2_10095655 rootH2_100956554 92
369 3300005290 Ga0065712_10077019 Ga0065712_100770193 92
370 3300005290 Ga0065712_10149958 Ga0065712_101499583 92
371 3300005293 Ga0065715_10187416 Ga0065715_101874162 92
372 3300005293 Ga0065715_10191064 Ga0065715_101910643 92
373 3300005327 Ga0070658_10001899 Ga0070658_1000189911 92
374 3300005327 Ga0070658_10064279 Ga0070658_100642795 92
375 3300005327 Ga0070658_10301679 Ga0070658_103016793 92
376 3300005327 Ga0070658_10954974 Ga0070658_109549741 92
377 3300005327 Ga0070658_11053300 Ga0070658_110533001 92
378 3300005328 Ga0070676_10043617 Ga0070676_100436173 92
379 3300005328 Ga0070676_10652297 Ga0070676_106522972 92
380 3300005329 Ga0070683_100000257 Ga0070683_10000025732 92
381 3300005331 Ga0070670_100063911 Ga0070670_1000639114 92
382 3300005331 Ga0070670_100214979 Ga0070670_1002149791 92
383 3300005331 Ga0070670_100281742 Ga0070670_1002817424 92
384 3300005331 Ga0070670_100399333 Ga0070670_1003993332 92
385 3300005331 Ga0070670_100455929 Ga0070670_1004559294 92
386 3300005333 Ga0070677_10009276 Ga0070677_100092765 92
387 3300005333 Ga0070677_10014989 Ga0070677_100149895 92
388 3300005333 Ga0070677_10027653 Ga0070677_100276533 92
389 3300005333 Ga0070677_10272529 Ga0070677_102725291 92
390 3300005334 Ga0068869_100377927 Ga0068869_1003779272 92
391 3300005335 Ga0070666_10006073 Ga0070666_100060733 92
392 3300005335 Ga0070666_10109982 Ga0070666_101099823 92
393 3300005335 Ga0070666_10172968 Ga0070666_101729683 92
394 3300005335 Ga0070666_10442880 Ga0070666_104428802 92
395 3300005336 Ga0070680_100028527 Ga0070680_1000285273 92
396 3300005336 Ga0070680_100499085 Ga0070680_1004990853 92
397 3300005337 Ga0070682_100199921 Ga0070682_1001999213 92
398 3300005338 Ga0068868_100132688 Ga0068868_1001326884 92
399 3300005338 Ga0068868_100682380 Ga0068868_1006823802 92
400 3300005339 Ga0070660_100005816 Ga0070660_1000058162 92
401 3300005339 Ga0070660_100026498 Ga0070660_1000264984 92
402 3300005339 Ga0070660_100090322 Ga0070660_1000903223 92
403 3300005339 Ga0070660_100147056 Ga0070660_1001470563 92
404 3300005339 Ga0070660_100152111 Ga0070660_1001521113 92
405 3300005339 Ga0070660_100583485 Ga0070660_1005834851 92
406 3300005339 Ga0070660_100779492 Ga0070660_1007794921 92
407 3300005339 Ga0070660_101212589 Ga0070660_1012125891 92
408 3300005343 Ga0070687_100664857 Ga0070687_1006648572 92
409 3300005344 Ga0070661_100000125 Ga0070661_10000012537 92
410 3300005344 Ga0070661_100028675 Ga0070661_1000286754 92
411 3300005344 Ga0070661_100071178 Ga0070661_1000711785 92
412 3300005344 Ga0070661_100418173 Ga0070661_1004181732 92
413 3300005344 Ga0070661_100683390 Ga0070661_1006833902 92
414 3300005344 Ga0070661_100803880 Ga0070661_1008038802 92
415 3300005345 Ga0070692_10450594 Ga0070692_104505942 92
416 3300005347 Ga0070668_100152130 Ga0070668_1001521304 92
417 3300005353 Ga0070669_100011961 Ga0070669_1000119613 92
418 3300005353 Ga0070669_100052346 Ga0070669_1000523464 92
419 3300005353 Ga0070669_100182366 Ga0070669_1001823661 92
420 3300005353 Ga0070669_101410519 Ga0070669_1014105191 92
421 3300005354 Ga0070675_100075980 Ga0070675_1000759803 92
422 3300005354 Ga0070675_100135338 Ga0070675_1001353383 92
423 3300005354 Ga0070675_100597647 Ga0070675_1005976472 92
424 3300005354 Ga0070675_100625660 Ga0070675_1006256603 92
425 3300005354 Ga0070675_101880954 Ga0070675_1018809541 92
426 3300005355 Ga0070671_100007875 Ga0070671_1000078755 92
427 3300005355 Ga0070671_100044630 Ga0070671_1000446303 92
428 3300005355 Ga0070671_100229044 Ga0070671_1002290443 92
429 3300005355 Ga0070671_100652246 Ga0070671_1006522462 92
430 3300005356 Ga0070674_100069469 Ga0070674_1000694693 92
431 3300005356 Ga0070674_101005025 Ga0070674_1010050252 92
432 3300005364 Ga0070673_100029392 Ga0070673_1000293923 92
433 3300005364 Ga0070673_100116633 Ga0070673_1001166333 92
434 3300005364 Ga0070673_100139071 Ga0070673_1001390711 92
435 3300005364 Ga0070673_100176106 Ga0070673_1001761063 92
436 3300005364 Ga0070673_100267164 Ga0070673_1002671643 92
437 3300005366 Ga0070659_100003922 Ga0070659_1000039222 92
438 3300005366 Ga0070659_100042839 Ga0070659_1000428393 92
439 3300005366 Ga0070659_100057553 Ga0070659_1000575533 92
440 3300005366 Ga0070659_100084231 Ga0070659_1000842313 92
441 3300005366 Ga0070659_100164859 Ga0070659_1001648592 92
442 3300005366 Ga0070659_100320488 Ga0070659_1003204883 92
443 3300005366 Ga0070659_100893336 Ga0070659_1008933362 92
444 3300005367 Ga0070667_100097434 Ga0070667_1000974343 92
445 3300005367 Ga0070667_100337612 Ga0070667_1003376122 92
446 3300005455 Ga0070663_100000234 Ga0070663_1000002346 92
447 3300005455 Ga0070663_100041985 Ga0070663_1000419855 92
448 3300005455 Ga0070663_100150922 Ga0070663_1001509223 92
449 3300005455 Ga0070663_100167182 Ga0070663_1001671822 92
450 3300005455 Ga0070663_100996109 Ga0070663_1009961092 92
451 3300005455 Ga0070663_101212781 Ga0070663_1012127811 92
452 3300005456 Ga0070678_100064422 Ga0070678_1000644224 92
453 3300005456 Ga0070678_100078428 Ga0070678_1000784282 92
454 3300005456 Ga0070678_100938109 Ga0070678_1009381091 92
455 3300005457 Ga0070662_100000010 Ga0070662_10000001016 92
456 3300005457 Ga0070662_100011566 Ga0070662_1000115663 92
457 3300005457 Ga0070662_100068657 Ga0070662_1000686573 92
458 3300005457 Ga0070662_100127922 Ga0070662_1001279223 92
459 3300005457 Ga0070662_100880328 Ga0070662_1008803282 92
460 3300005459 Ga0068867_100066654 Ga0068867_1000666543 92
461 3300005530 Ga0070679_100120675 Ga0070679_1001206753 92
462 3300005530 Ga0070679_100532960 Ga0070679_1005329603 92
463 3300005530 Ga0070679_101490132 Ga0070679_1014901322 92
464 3300005535 Ga0070684_100060078 Ga0070684_1000600783 92
465 3300005539 Ga0068853_100000715 Ga0068853_10000071513 92
466 3300005539 Ga0068853_100151679 Ga0068853_1001516792 92
467 3300005539 Ga0068853_100161067 Ga0068853_1001610673 92
468 3300005539 Ga0068853_100227344 Ga0068853_1002273443 92
469 3300005539 Ga0068853_100624565 Ga0068853_1006245652 92
470 3300005543 Ga0070672_100167415 Ga0070672_1001674153 92
471 3300005543 Ga0070672_100227542 Ga0070672_1002275424 92
472 3300005543 Ga0070672_100612275 Ga0070672_1006122752 92
473 3300005547 Ga0070693_100001081 Ga0070693_1000010814 92
474 3300005547 Ga0070693_100158693 Ga0070693_1001586932 92
475 3300005547 Ga0070693_100588207 Ga0070693_1005882072 92
476 3300005548 Ga0070665_100009733 Ga0070665_1000097339 92
477 3300005548 Ga0070665_100012827 Ga0070665_1000128274 92
478 3300005563 Ga0068855_100001909 Ga0068855_1000019094 92
479 3300005563 Ga0068855_100469011 Ga0068855_1004690112 92
480 3300005563 Ga0068855_100503908 Ga0068855_1005039082 92
481 3300005563 Ga0068855_100930176 Ga0068855_1009301763 92
482 3300005563 Ga0068855_101249986 Ga0068855_1012499862 92
483 3300005564 Ga0070664_100000615 Ga0070664_10000061518 92
484 3300005564 Ga0070664_100021951 Ga0070664_1000219514 92
485 3300005564 Ga0070664_100033988 Ga0070664_1000339884 92
486 3300005564 Ga0070664_100099139 Ga0070664_1000991395 92
487 3300005564 Ga0070664_100737675 Ga0070664_1007376752 92
488 3300005577 Ga0068857_100041588 Ga0068857_1000415885 92
489 3300005577 Ga0068857_100191465 Ga0068857_1001914653 92
490 3300005577 Ga0068857_100942769 Ga0068857_1009427692 92
491 3300005578 Ga0068854_100118372 Ga0068854_1001183723 92
492 3300005578 Ga0068854_100323774 Ga0068854_1003237743 92
493 3300005578 Ga0068854_100451458 Ga0068854_1004514583 92
494 3300005578 Ga0068854_100954862 Ga0068854_1009548622 92
495 3300005614 Ga0068856_100000442 Ga0068856_10000044233 92
496 3300005614 Ga0068856_101475468 Ga0068856_1014754681 92
497 3300005616 Ga0068852_100000241 Ga0068852_10000024131 92
498 3300005616 Ga0068852_100018676 Ga0068852_1000186763 92
499 3300005616 Ga0068852_100056875 Ga0068852_1000568753 92
500 3300005616 Ga0068852_100879920 Ga0068852_1008799201 92
501 3300005616 Ga0068852_101777194 Ga0068852_1017771942 92
502 3300005617 Ga0068859_100642322 Ga0068859_1006423222 92
503 3300005618 Ga0068864_100004493 Ga0068864_1000044935 92
504 3300005618 Ga0068864_100519821 Ga0068864_1005198213 92
505 3300005618 Ga0068864_101739356 Ga0068864_1017393562 92
506 3300005834 Ga0068851_10004973 Ga0068851_100049734 92
507 3300005834 Ga0068851_10144655 Ga0068851_101446553 92
508 3300005841 Ga0068863_100014278 Ga0068863_1000142787 92
509 3300006237 Ga0097621_100246041 Ga0097621_1002460412 92
510 3300006358 Ga0068871_100064545 Ga0068871_1000645453 92
511 3300006358 Ga0068871_100573619 Ga0068871_1005736193 92
512 3300006931 Ga0097620_100642319 Ga0097620_1006423193 92
513 3300009098 Ga0105245_10172523 Ga0105245_101725234 92
514 3300009101 Ga0105247_10288163 Ga0105247_102881632 92
515 3300009148 Ga0105243_10523408 Ga0105243_105234083 92
516 3300009174 Ga0105241_10046707 Ga0105241_100467074 92
517 3300009174 Ga0105241_10640445 Ga0105241_106404452 92
518 3300009176 Ga0105242_10362671 Ga0105242_103626712 92
519 3300009176 Ga0105242_12655807 Ga0105242_126558072 92
520 3300009177 Ga0105248_10001127 Ga0105248_100011275 92
521 3300009177 Ga0105248_10001586 Ga0105248_1000158610 92
522 3300009551 Ga0105238_10072019 Ga0105238_100720193 92
523 3300012508 Ga0157315_1007917 Ga0157315_10079172 92
524 3300013100 Ga0157373_10021351 Ga0157373_100213513 92
525 3300013100 Ga0157373_10021899 Ga0157373_100218996 92
526 3300013100 Ga0157373_10058801 Ga0157373_100588013 92
527 3300013100 Ga0157373_10059996 Ga0157373_100599964 92
528 3300013100 Ga0157373_10263662 Ga0157373_102636622 92
529 3300013102 Ga0157371_10002401 Ga0157371_1000240113 92
530 3300013102 Ga0157371_10407381 Ga0157371_104073812 92
531 3300013102 Ga0157371_10597310 Ga0157371_105973102 92
532 3300013102 Ga0157371_11617954 Ga0157371_116179542 92
533 3300013104 Ga0157370_10003954 Ga0157370_1000395411 92
534 3300013104 Ga0157370_10192136 Ga0157370_101921362 92
535 3300013104 Ga0157370_10473729 Ga0157370_104737292 92
536 3300013105 Ga0157369_10250557 Ga0157369_102505574 92
537 3300013296 Ga0157374_10035871 Ga0157374_100358714 92
538 3300013296 Ga0157374_10460715 Ga0157374_104607153 92
539 3300013297 Ga0157378_10142820 Ga0157378_101428203 92
540 3300013306 Ga0163162_10075213 Ga0163162_100752133 92
541 3300013306 Ga0163162_10782407 Ga0163162_107824071 92
542 3300013306 Ga0163162_11042640 Ga0163162_110426402 92
543 3300013307 Ga0157372_10431317 Ga0157372_104313171 92
544 3300013307 Ga0157372_11066021 Ga0157372_110660212 92
545 3300013307 Ga0157372_11555876 Ga0157372_115558762 92
546 3300013308 Ga0157375_10228490 Ga0157375_102284905 92
547 3300013308 Ga0157375_10974483 Ga0157375_109744832 92
548 3300014325 Ga0163163_10001016 Ga0163163_100010162 92
549 3300014326 Ga0157380_11429228 Ga0157380_114292282 92
550 3300014968 Ga0157379_10092035 Ga0157379_100920353 92
551 3300017792 Ga0163161_10096122 Ga0163161_100961224 92
552 3300025271 Ga0207666_1033351 Ga0207666_10333512 92
553 3300025315 Ga0207697_10018686 Ga0207697_100186863 92
554 3300025315 Ga0207697_10471545 Ga0207697_104715452 92
555 3300025321 Ga0207656_10018003 Ga0207656_100180034 92
556 3300025321 Ga0207656_10095685 Ga0207656_100956852 92
557 3300025893 Ga0207682_10025160 Ga0207682_100251604 92
558 3300025893 Ga0207682_10048298 Ga0207682_100482983 92
559 3300025893 Ga0207682_10117592 Ga0207682_101175922 92
560 3300025901 Ga0207688_10109065 Ga0207688_101090652 92
561 3300025903 Ga0207680_10645517 Ga0207680_106455172 92
562 3300025904 Ga0207647_10009245 Ga0207647_100092453 92
563 3300025907 Ga0207645_10104835 Ga0207645_101048354 92
564 3300025909 Ga0207705_10000232 Ga0207705_1000023236 92
565 3300025909 Ga0207705_10083286 Ga0207705_100832864 92
566 3300025909 Ga0207705_10085270 Ga0207705_100852703 92
567 3300025911 Ga0207654_10154736 Ga0207654_101547362 92
568 3300025912 Ga0207707_11467681 Ga0207707_114676811 92
569 3300025917 Ga0207660_10058884 Ga0207660_100588843 92
570 3300025917 Ga0207660_11689117 Ga0207660_116891172 92
571 3300025918 Ga0207662_10498761 Ga0207662_104987613 92
572 3300025919 Ga0207657_10000026 Ga0207657_10000026118 92
573 3300025919 Ga0207657_10038269 Ga0207657_100382693 92
574 3300025919 Ga0207657_10070275 Ga0207657_100702754 92
575 3300025919 Ga0207657_10130785 Ga0207657_101307853 92
576 3300025919 Ga0207657_10317571 Ga0207657_103175713 92
577 3300025919 Ga0207657_11296882 Ga0207657_112968822 92
578 3300025920 Ga0207649_10000318 Ga0207649_1000031810 92
579 3300025920 Ga0207649_10145758 Ga0207649_101457582 92
580 3300025920 Ga0207649_10373544 Ga0207649_103735442 92
581 3300025921 Ga0207652_10184328 Ga0207652_101843283 92
582 3300025921 Ga0207652_10468183 Ga0207652_104681833 92
583 3300025921 Ga0207652_11768891 Ga0207652_117688911 92
584 3300025923 Ga0207681_10007671 Ga0207681_100076715 92
585 3300025923 Ga0207681_10643801 Ga0207681_106438012 92
586 3300025924 Ga0207694_10833312 Ga0207694_108333122 92
587 3300025925 Ga0207650_10123515 Ga0207650_101235153 92
588 3300025925 Ga0207650_10155088 Ga0207650_101550884 92
589 3300025925 Ga0207650_10178476 Ga0207650_101784763 92
590 3300025925 Ga0207650_10263363 Ga0207650_102633633 92
591 3300025925 Ga0207650_10281919 Ga0207650_102819193 92
592 3300025925 Ga0207650_10360217 Ga0207650_103602172 92
593 3300025926 Ga0207659_10357002 Ga0207659_103570024 92
594 3300025926 Ga0207659_10814320 Ga0207659_108143202 92
595 3300025926 Ga0207659_11499326 Ga0207659_114993261 92
596 3300025927 Ga0207687_11016132 Ga0207687_110161322 92
597 3300025929 Ga0207664_10099358 Ga0207664_100993583 92
598 3300025931 Ga0207644_10012166 Ga0207644_100121664 92
599 3300025931 Ga0207644_10089752 Ga0207644_100897523 92
600 3300025931 Ga0207644_10090695 Ga0207644_100906953 92
601 3300025931 Ga0207644_10158528 Ga0207644_101585284 92
602 3300025931 Ga0207644_10448841 Ga0207644_104488413 92
603 3300025931 Ga0207644_11061178 Ga0207644_110611782 92
604 3300025932 Ga0207690_10001417 Ga0207690_100014172 92
605 3300025932 Ga0207690_10031421 Ga0207690_100314213 92
606 3300025932 Ga0207690_10258140 Ga0207690_102581402 92
607 3300025932 Ga0207690_10453909 Ga0207690_104539092 92
608 3300025932 Ga0207690_10636128 Ga0207690_106361282 92
609 3300025932 Ga0207690_10874299 Ga0207690_108742992 92
610 3300025932 Ga0207690_11053827 Ga0207690_110538272 92
611 3300025933 Ga0207706_10000031 Ga0207706_1000003117 92
612 3300025933 Ga0207706_10001098 Ga0207706_100010983 92
613 3300025933 Ga0207706_10008288 Ga0207706_100082887 92
614 3300025933 Ga0207706_10065467 Ga0207706_100654673 92
615 3300025933 Ga0207706_10096106 Ga0207706_100961063 92
616 3300025933 Ga0207706_10772839 Ga0207706_107728391 92
617 3300025933 Ga0207706_10810623 Ga0207706_108106231 92
618 3300025933 Ga0207706_11151605 Ga0207706_111516052 92
619 3300025934 Ga0207686_10746922 Ga0207686_107469223 92
620 3300025935 Ga0207709_10505670 Ga0207709_105056702 92
621 3300025937 Ga0207669_11586502 Ga0207669_115865022 92
622 3300025940 Ga0207691_10045726 Ga0207691_100457265 92
623 3300025940 Ga0207691_10147407 Ga0207691_101474074 92
624 3300025940 Ga0207691_10397696 Ga0207691_103976962 92
625 3300025940 Ga0207691_10646391 Ga0207691_106463912 92
626 3300025940 Ga0207691_10932353 Ga0207691_109323532 92
627 3300025941 Ga0207711_10003583 Ga0207711_100035834 92
628 3300025941 Ga0207711_10030300 Ga0207711_100303004 92
629 3300025942 Ga0207689_10153965 Ga0207689_101539653 92
630 3300025944 Ga0207661_10002291 Ga0207661_100022917 92
631 3300025945 Ga0207679_10000572 Ga0207679_1000057216 92
632 3300025945 Ga0207679_10239097 Ga0207679_102390974 92
633 3300025945 Ga0207679_10349117 Ga0207679_103491172 92
634 3300025949 Ga0207667_10069864 Ga0207667_100698642 92
635 3300025949 Ga0207667_10090761 Ga0207667_100907611 92
636 3300025949 Ga0207667_11064600 Ga0207667_110646002 92
637 3300025949 Ga0207667_11982982 Ga0207667_119829821 92
638 3300025960 Ga0207651_10016342 Ga0207651_100163424 92
639 3300025960 Ga0207651_10302143 Ga0207651_103021432 92
640 3300025960 Ga0207651_10559394 Ga0207651_105593943 92
641 3300025981 Ga0207640_10035455 Ga0207640_100354554 92
642 3300025981 Ga0207640_10301244 Ga0207640_103012442 92
643 3300025981 Ga0207640_11414187 Ga0207640_114141872 92
644 3300025986 Ga0207658_10080552 Ga0207658_100805523 92
645 3300025986 Ga0207658_11723607 Ga0207658_117236072 92
646 3300026023 Ga0207677_10417306 Ga0207677_104173062 92
647 3300026023 Ga0207677_11050871 Ga0207677_110508712 92
648 3300026035 Ga0207703_10138525 Ga0207703_101385252 92
649 3300026041 Ga0207639_10001178 Ga0207639_1000117813 92
650 3300026041 Ga0207639_10147410 Ga0207639_101474102 92
651 3300026041 Ga0207639_10287572 Ga0207639_102875722 92
652 3300026041 Ga0207639_10292679 Ga0207639_102926793 92
653 3300026067 Ga0207678_10005287 Ga0207678_100052875 92
654 3300026067 Ga0207678_10153784 Ga0207678_101537843 92
655 3300026067 Ga0207678_10162116 Ga0207678_101621164 92
656 3300026067 Ga0207678_10223810 Ga0207678_102238103 92
657 3300026067 Ga0207678_10469474 Ga0207678_104694743 92
658 3300026078 Ga0207702_10000891 Ga0207702_1000089114 92
659 3300026078 Ga0207702_10163764 Ga0207702_101637643 92
660 3300026078 Ga0207702_12110681 Ga0207702_121106812 92
661 3300026088 Ga0207641_10017148 Ga0207641_100171482 92
662 3300026089 Ga0207648_10023086 Ga0207648_100230865 92
663 3300026095 Ga0207676_10008133 Ga0207676_100081335 92
664 3300026095 Ga0207676_10078555 Ga0207676_100785553 92
665 3300026095 Ga0207676_11390684 Ga0207676_113906842 92
666 3300026095 Ga0207676_11942477 Ga0207676_119424772 92
667 3300026116 Ga0207674_10035328 Ga0207674_100353286 92
668 3300026116 Ga0207674_10096380 Ga0207674_100963804 92
669 3300026121 Ga0207683_10014692 Ga0207683_100146928 92
670 3300026121 Ga0207683_10110332 Ga0207683_101103324 92
671 3300026142 Ga0207698_10009609 Ga0207698_100096093 92
672 3300026142 Ga0207698_10074672 Ga0207698_100746723 92
673 3300026142 Ga0207698_10225009 Ga0207698_102250094 92
674 3300026142 Ga0207698_10699054 Ga0207698_106990541 92
675 3300026142 Ga0207698_10714343 Ga0207698_107143433 92
676 3300026142 Ga0207698_10896726 Ga0207698_108967263 92
677 3300028379 Ga0268266_10007451 Ga0268266_100074514 92
678 3300031731 Ga0307405_10209212 Ga0307405_102092123 92
679 3300031731 Ga0307405_10686767 Ga0307405_106867672 92
680 3300031824 Ga0307413_10071038 Ga0307413_100710383 92
681 3300031824 Ga0307413_10164336 Ga0307413_101643363 92
682 3300031824 Ga0307413_10679535 Ga0307413_106795351 92
683 3300031852 Ga0307410_10269873 Ga0307410_102698733 92
684 3300031903 Ga0307407_10102953 Ga0307407_101029533 92
685 3300031911 Ga0307412_10163739 Ga0307412_101637393 92
686 3300031911 Ga0307412_11187192 Ga0307412_111871922 92
687 3300031995 Ga0307409_100135292 Ga0307409_1001352923 92
688 3300031995 Ga0307409_100314662 Ga0307409_1003146622 92
689 3300031995 Ga0307409_101939014 Ga0307409_1019390142 92
690 3300032002 Ga0307416_100274432 Ga0307416_1002744322 92
691 3300032002 Ga0307416_103514236 Ga0307416_1035142362 92
692 3300032004 Ga0307414_11413227 Ga0307414_114132272 92
693 3300032005 Ga0307411_10013558 Ga0307411_100135585 92
694 3300032005 Ga0307411_10424126 Ga0307411_104241262 92
695 3300032126 Ga0307415_100256486 Ga0307415_1002564863 92
696 3300032126 Ga0307415_100814170 Ga0307415_1008141702 92
697 3300032126 Ga0307415_101420232 Ga0307415_1014202322 92
698 3300034816 Ga0373930_0057921 Ga0373930_0057921_454_735 92
699 3300034820 Ga0373959_0087205 Ga0373959_0087205_377_658 92
700 3300035092 Ga0373952_0092297 Ga0373952_0092297_86_367 92
701 3300035121 Ga0373960_0051867 Ga0373960_0051867_304_585 92
702 3300037312 Ga0395899_0050080 Ga0395899_0050080_257_535 92
703 3300037312 Ga0395899_0063340 Ga0395899_0063340_959_1237 92
704 3300037312 Ga0395899_0082928 Ga0395899_0082928_961_1239 92
705 3300037312 Ga0395899_0114907 Ga0395899_0114907_1608_1886 92
706 3300037312 Ga0395899_0146065 Ga0395899_0146065_1167_1445 92
707 3300037312 Ga0395899_0156903 Ga0395899_0156903_389_667 92
708 3300037312 Ga0395899_0227995 Ga0395899_0227995_728_1006 92
709 3300037312 Ga0395899_0512819 Ga0395899_0512819_232_513 92
710 3300037418 Ga0395900_0033844 Ga0395900_0033844_805_1083 92
711 3300037418 Ga0395900_0047139 Ga0395900_0047139_3190_3471 92
712 3300037418 Ga0395900_0180659 Ga0395900_0180659_1631_1909 92
713 3300037418 Ga0395900_0214138 Ga0395900_0214138_39_344 92
714 3300037418 Ga0395900_0264197 Ga0395900_0264197_691_969 92
715 3300037418 Ga0395900_0437241 Ga0395900_0437241_421_699 92
716 3300037418 Ga0395900_0450727 Ga0395900_0450727_458_742 92
717 3300037418 Ga0395900_0639264 Ga0395900_0639264_39_344 92
718 3300037418 Ga0395900_1084293 Ga0395900_1084293_26_304 92
719 3300037418 Ga0395900_1392037 Ga0395900_1392037_120_398 92
720 3300037466 Ga0395898_0049701 Ga0395898_0049701_2410_2691 92
721 3300037466 Ga0395898_0076467 Ga0395898_0076467_2814_3194 92
722 3300037466 Ga0395898_0116659 Ga0395898_0116659_557_835 92
723 3300037466 Ga0395898_0133848 Ga0395898_0133848_1178_1456 92
724 3300037466 Ga0395898_0264782 Ga0395898_0264782_444_722 92
725 3300037466 Ga0395898_0517435 Ga0395898_0517435_223_501 92
726 3300037471 Ga0395905_0037636 Ga0395905_0037636_1931_2212 92
727 3300037471 Ga0395905_0054282 Ga0395905_0054282_2188_2466 92
728 3300037471 Ga0395905_0054640 Ga0395905_0054640_926_1204 92
729 3300037471 Ga0395905_0107873 Ga0395905_0107873_886_1170 92
730 3300037471 Ga0395905_0491054 Ga0395905_0491054_12_290 92
731 3300037471 Ga0395905_0521312 Ga0395905_0521312_364_642 92
732 3300037471 Ga0395905_0562541 Ga0395905_0562541_415_693 92
733 3300037471 Ga0395905_0845200 Ga0395905_0845200_341_619 92
734 3300037471 Ga0395905_1149910 Ga0395905_1149910_167_445 92
735 3300037471 Ga0395905_1391864 Ga0395905_1391864_262_540 92
736 3300038443 Ga0395901_0024874 Ga0395901_0024874_5010_5291 92
737 3300038443 Ga0395901_0057025 Ga0395901_0057025_960_1238 92
738 3300038443 Ga0395901_0083360 Ga0395901_0083360_1770_2048 92
739 3300038443 Ga0395901_0158555 Ga0395901_0158555_1181_1459 92
740 3300038443 Ga0395901_0282145 Ga0395901_0282145_658_936 92
741 3300038443 Ga0395901_0366533 Ga0395901_0366533_960_1238 92
742 3300038443 Ga0395901_0901023 Ga0395901_0901023_505_783 92
743 3300038443 Ga0395901_1517650 Ga0395901_1517650_53_331 92
744 3300038443 Ga0395901_1541995 Ga0395901_1541995_148_432 92
745 3300041451 Ga0451791_1088308 Ga0451791_1088308_61_339 92
746 3300041486 Ga0451807_1979107 Ga0451807_1979107_65_352 92
747 3300041512 Ga0451853_2615642 Ga0451853_2615642_166_453 92
748 3300042004 Ga0439445_0008474 Ga0439445_0008474_1553_1834 92
749 3300042006 Ga0439432_010454 Ga0439432_010454_1253_1534 92
750 3300044658 Ga0466972_0060729 Ga0466972_0060729_734_1012 92
751 3300044658 Ga0466972_0169829 Ga0466972_0169829_325_603 92
752 3300044658 Ga0466972_0468196 Ga0466972_0468196_82_360 92
753 3300044683 Ga0466965_0151320 Ga0466965_0151320_897_1175 92
754 3300044684 Ga0466966_0041887 Ga0466966_0041887_472_750 92
755 3300044684 Ga0466966_0400081 Ga0466966_0400081_526_804 92
756 3300044684 Ga0466966_0478893 Ga0466966_0478893_307_585 92
757 3300044693 Ga0466961_0177851 Ga0466961_0177851_497_775 92
758 3300044694 Ga0466963_0033198 Ga0466963_0033198_1814_2095 92
759 3300044694 Ga0466963_0401227 Ga0466963_0401227_503_781 92
760 3300044706 Ga0466964_0028821 Ga0466964_0028821_811_1089 92
761 3300044706 Ga0466964_0794791 Ga0466964_0794791_26_304 92
762 3300044719 Ga0466971_0222631 Ga0466971_0222631_335_613 92
763 3300044735 Ga0466968_0043339 Ga0466968_0043339_69_347 92
764 3300044735 Ga0466968_0460538 Ga0466968_0460538_82_360 92
765 3300044765 Ga0466970_0012994 Ga0466970_0012994_1243_1521 92
766 3300044765 Ga0466970_0137718 Ga0466970_0137718_430_708 92
767 3300044765 Ga0466970_0694615 Ga0466970_0694615_197_475 92
768 3300044842 Ga0466957_0162775 Ga0466957_0162775_134_412 92
769 3300044901 Ga0466960_0007103 Ga0466960_0007103_556_834 92
770 3300044901 Ga0466960_0672063 Ga0466960_0672063_15_293 92
771 3300045049 Ga0466959_0087402 Ga0466959_0087402_1026_1304 92
772 3300045049 Ga0466959_0447866 Ga0466959_0447866_123_404 92
773 3300045836 Ga0466958_0066608 Ga0466958_0066608_796_1074 92
774 3300045836 Ga0466958_0804440 Ga0466958_0804440_157_435 92
775 3300045976 Ga0466967_0058604 Ga0466967_0058604_2143_2421 92
776 3300045976 Ga0466967_0210372 Ga0466967_0210372_1495_1773 92
777 3300045976 Ga0466967_0263853 Ga0466967_0263853_179_457 92
778 3300045976 Ga0466967_0289552 Ga0466967_0289552_583_861 92
779 3300045976 Ga0466967_0816901 Ga0466967_0816901_517_795 92
780 3300045976 Ga0466967_0876677 Ga0466967_0876677_512_790 92
781 3300046528 Ga0495642_0372244 Ga0495642_0372244_43_321 92
782 3300046539 Ga0495621_0019365 Ga0495621_0019365_1190_1468 92
783 3300046616 Ga0495668_0621981 Ga0495668_0621981_158_445 92
784 3300046684 Ga0495669_0550405 Ga0495669_0550405_228_509 92
785 3300046691 Ga0495670_0262392 Ga0495670_0262392_110_388 92
786 3300047445 Ga0495677_0213325 Ga0495677_0213325_436_714 92
787 3300048903 Ga0496100_1656223 Ga0496100_1656223_165_443 92
788 3300048905 Ga0496102_0111311 Ga0496102_0111311_1500_1778 92
789 3300048906 Ga0496103_0034177 Ga0496103_0034177_751_1029 92
790 3300048909 Ga0496106_0625856 Ga0496106_0625856_297_575 92
791 3300048909 Ga0496106_0799005 Ga0496106_0799005_223_504 92
792 3300048910 Ga0496107_0046892 Ga0496107_0046892_1341_1646 92
793 3300048910 Ga0496107_0351342 Ga0496107_0351342_67_345 92
794 3300048910 Ga0496107_0713653 Ga0496107_0713653_25_303 92
795 3300048910 Ga0496107_1027817 Ga0496107_1027817_223_504 92
796 3300048911 Ga0496108_0035706 Ga0496108_0035706_1605_1883 92
797 3300048911 Ga0496108_0936326 Ga0496108_0936326_409_687 92
798 3300048912 Ga0496109_0004188 Ga0496109_0004188_3289_3567 92
799 3300048912 Ga0496109_0055116 Ga0496109_0055116_3020_3298 92
800 3300048913 Ga0496110_0026346 Ga0496110_0026346_3155_3433 92
801 3300048913 Ga0496110_0317165 Ga0496110_0317165_486_764 92
802 3300048913 Ga0496110_0596932 Ga0496110_0596932_249_530 92
803 3300048914 Ga0496111_0089167 Ga0496111_0089167_30_335 92
804 3300048914 Ga0496111_0199170 Ga0496111_0199170_72_377 92
805 3300048914 Ga0496111_0250037 Ga0496111_0250037_452_730 92
806 3300048915 Ga0496112_0030806 Ga0496112_0030806_2699_2977 92
807 3300048915 Ga0496112_0058370 Ga0496112_0058370_2665_2943 92
808 3300048916 Ga0496113_0182481 Ga0496113_0182481_1110_1388 92
809 3300061719 Ga0466962_0598700 Ga0466962_0598700_118_396 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19447

DUF5985

Family of unknown function (DUF5985)

6

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xna-assembly1.cif.gz_A crystal structure of somatostatin receptor 2 (sstr2) with peptide antagonist cyn 154806 0.7823 1 58
5jsi-assembly1.cif.gz_A structure of membrane protein 0.7439 5 84
6li3-assembly1.cif.gz_R cryo-em structure of gpr52-minigs-nb35 0.7421 4 65
6qzh-assembly1.cif.gz_A structure of the human cc chemokine receptor 7 in complex with the intracellular allosteric antagonist cmp2105 and the insertion protein sialidase nana 0.7348 5 84
6li1-assembly1.cif.gz_A crystal structure of gpr52 ligand free form with flavodoxin fusion 0.7221 4 84
ID Description Score Start End Superfamily
af_A0A096ST30_64_152_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8173 8 86 1.20.1280.290
af_F4JMN0_99_187_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7891 7 86 1.20.1280.290
af_Q18826_258_405_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.7822 7 81 1.20.1410.10
af_A0A0R4IVC9_32_339_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7549 3 58 1.20.1070.10
af_A0A096ST30_64_152_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7301 8 86 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A4P6FJP1-F1-model_v4 GGDEF domain-containing protein 0.9736 1 92 GO:0016020
AF-A0A4P6FJP1-F1-model_v4 GGDEF domain-containing protein 0.9632 1 92 GO:0016020
AF-A0A521YRM9-F1-model_v4 GGDEF domain-containing protein 0.9563 5 89 GO:0016020
AF-A0A7Y5U9J7-F1-model_v4 Uncharacterized protein 0.9544 7 91 GO:0016020
AF-A0A1F4FLY1-F1-model_v4 GGDEF domain-containing protein 0.953 5 89 GO:0016020

Feature Viewer

pLDDT pTM Quality
71.87 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map