F481784
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 809 | 232 | 808 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300049661|Ga0501217_340245|Ga0501217_340245_173_457 |
| Length | 94 |
| Sequence | VVEQAFPAVVYILCFLTSSACAWLLGRSYLRSKARLLLWSSFCFLLLAGNNLLLVLDLLVFPEVNLRIGRLLFSLAAVSVLIFGFVWDLQEGEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 184 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 224 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 225 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 232 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.37 |
| Rhizoplane | 3.71 |
| Rhizosphere | 94.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2102004 | 2162886012 | Bacteria | 1415 |
| 2 | JGI24736J21556_1000382 | 3300001904 | Bacteria | 8398 |
| 3 | JGI24741J21665_1049254 | 3300001915 | Unclassified | 620 |
| 4 | JGI24740J21852_10006215 | 3300001979 | Bacteria | 4972 |
| 5 | JGI24739J22299_10001003 | 3300001989 | Bacteria | 10472 |
| 6 | JGI24739J22299_10006988 | 3300001989 | Bacteria | 4251 |
| 7 | JGI24739J22299_10079134 | 3300001989 | Bacteria | 1012 |
| 8 | JGI24737J22298_10000223 | 3300001990 | Bacteria | 18616 |
| 9 | JGI24737J22298_10044515 | 3300001990 | Bacteria | 1357 |
| 10 | JGI24737J22298_10085416 | 3300001990 | Bacteria | 938 |
| 11 | JGI24737J22298_10090169 | 3300001990 | Unclassified | 910 |
| 12 | JGI24737J22298_10128654 | 3300001990 | Unclassified | 748 |
| 13 | JGI24743J22301_10007929 | 3300001991 | Bacteria | 1853 |
| 14 | JGI24738J21930_10000303 | 3300002075 | Bacteria | 13548 |
| 15 | JGI24738J21930_10088973 | 3300002075 | Unclassified | 652 |
| 16 | JGI24738J21930_10100948 | 3300002075 | Bacteria | 616 |
| 17 | JGI24744J21845_10007277 | 3300002077 | Bacteria | 2288 |
| 18 | rootH2_10095655 | 3300003320 | Bacteria | 1832 |
| 19 | rootH1_10152419 | 3300003323 | Unclassified | 1114 |
| 20 | rootH1_10157953 | 3300003323 | Bacteria | 1462 |
| 21 | Ga0065712_10077019 | 3300005290 | Bacteria | 3562 |
| 22 | Ga0065712_10149958 | 3300005290 | Bacteria | 1377 |
| 23 | Ga0065715_10187416 | 3300005293 | Bacteria | 1435 |
| 24 | Ga0065715_10191064 | 3300005293 | Bacteria | 1407 |
| 25 | Ga0065715_10650600 | 3300005293 | Bacteria | 671 |
| 26 | Ga0070658_10001899 | 3300005327 | Bacteria | 17643 |
| 27 | Ga0070658_10024710 | 3300005327 | Bacteria | 4818 |
| 28 | Ga0070658_10064279 | 3300005327 | Bacteria | 2993 |
| 29 | Ga0070658_10301679 | 3300005327 | Bacteria | 1366 |
| 30 | Ga0070658_10394351 | 3300005327 | Bacteria | 1188 |
| 31 | Ga0070658_10406753 | 3300005327 | Bacteria | 1169 |
| 32 | Ga0070658_10954974 | 3300005327 | Unclassified | 745 |
| 33 | Ga0070658_11053300 | 3300005327 | Unclassified | 707 |
| 34 | Ga0070658_11274764 | 3300005327 | Unclassified | 638 |
| 35 | Ga0070676_10043617 | 3300005328 | Bacteria | 2607 |
| 36 | Ga0070676_10207660 | 3300005328 | Bacteria | 1287 |
| 37 | Ga0070676_10652297 | 3300005328 | Bacteria | 764 |
| 38 | Ga0070683_100000257 | 3300005329 | Bacteria | 36570 |
| 39 | Ga0070683_100349142 | 3300005329 | Bacteria | 1409 |
| 40 | Ga0070683_101015834 | 3300005329 | Unclassified | 796 |
| 41 | Ga0070690_101717688 | 3300005330 | Bacteria | 510 |
| 42 | Ga0070670_100063911 | 3300005331 | Unclassified | 3158 |
| 43 | Ga0070670_100158275 | 3300005331 | Bacteria | 1962 |
| 44 | Ga0070670_100214979 | 3300005331 | Bacteria | 1672 |
| 45 | Ga0070670_100281742 | 3300005331 | Bacteria | 1451 |
| 46 | Ga0070670_100399333 | 3300005331 | Bacteria | 1213 |
| 47 | Ga0070670_100455929 | 3300005331 | Bacteria | 1134 |
| 48 | Ga0070677_10009276 | 3300005333 | Bacteria | 3332 |
| 49 | Ga0070677_10014989 | 3300005333 | Bacteria | 2739 |
| 50 | Ga0070677_10027653 | 3300005333 | Bacteria | 2137 |
| 51 | Ga0070677_10272529 | 3300005333 | Bacteria | 849 |
| 52 | Ga0068869_100377927 | 3300005334 | Bacteria | 1160 |
| 53 | Ga0070666_10006073 | 3300005335 | Bacteria | 7422 |
| 54 | Ga0070666_10104009 | 3300005335 | Bacteria | 1959 |
| 55 | Ga0070666_10105056 | 3300005335 | Unclassified | 1950 |
| 56 | Ga0070666_10109982 | 3300005335 | Unclassified | 1905 |
| 57 | Ga0070666_10172968 | 3300005335 | Bacteria | 1513 |
| 58 | Ga0070666_10248030 | 3300005335 | Bacteria | 1260 |
| 59 | Ga0070666_10442880 | 3300005335 | Bacteria | 937 |
| 60 | Ga0070680_100028527 | 3300005336 | Bacteria | 4478 |
| 61 | Ga0070680_100499085 | 3300005336 | Bacteria | 1041 |
| 62 | Ga0070680_100850939 | 3300005336 | Bacteria | 786 |
| 63 | Ga0070680_100948711 | 3300005336 | Bacteria | 742 |
| 64 | Ga0070682_100196997 | 3300005337 | Bacteria | 1418 |
| 65 | Ga0070682_100199921 | 3300005337 | Bacteria | 1409 |
| 66 | Ga0068868_100132688 | 3300005338 | Bacteria | 2039 |
| 67 | Ga0068868_100682380 | 3300005338 | Unclassified | 917 |
| 68 | Ga0068868_101362035 | 3300005338 | Bacteria | 661 |
| 69 | Ga0070660_100005816 | 3300005339 | Bacteria | 8538 |
| 70 | Ga0070660_100018065 | 3300005339 | Bacteria | 5146 |
| 71 | Ga0070660_100026498 | 3300005339 | Bacteria | 4316 |
| 72 | Ga0070660_100067006 | 3300005339 | Bacteria | 2796 |
| 73 | Ga0070660_100090322 | 3300005339 | Bacteria | 2415 |
| 74 | Ga0070660_100147056 | 3300005339 | Bacteria | 1893 |
| 75 | Ga0070660_100152111 | 3300005339 | Bacteria | 1861 |
| 76 | Ga0070660_100327635 | 3300005339 | Bacteria | 1259 |
| 77 | Ga0070660_100583485 | 3300005339 | Bacteria | 934 |
| 78 | Ga0070660_100681345 | 3300005339 | Unclassified | 861 |
| 79 | Ga0070660_100779492 | 3300005339 | Unclassified | 804 |
| 80 | Ga0070660_101212589 | 3300005339 | Unclassified | 640 |
| 81 | Ga0070687_100664857 | 3300005343 | Bacteria | 723 |
| 82 | Ga0070661_100000125 | 3300005344 | Bacteria | 63406 |
| 83 | Ga0070661_100027889 | 3300005344 | Bacteria | 4069 |
| 84 | Ga0070661_100028675 | 3300005344 | Bacteria | 4016 |
| 85 | Ga0070661_100071178 | 3300005344 | Bacteria | 2559 |
| 86 | Ga0070661_100113884 | 3300005344 | Bacteria | 2021 |
| 87 | Ga0070661_100287256 | 3300005344 | Bacteria | 1277 |
| 88 | Ga0070661_100418173 | 3300005344 | Unclassified | 1062 |
| 89 | Ga0070661_100660041 | 3300005344 | Bacteria | 849 |
| 90 | Ga0070661_100683390 | 3300005344 | Unclassified | 835 |
| 91 | Ga0070661_100803880 | 3300005344 | Bacteria | 772 |
| 92 | Ga0070692_10450594 | 3300005345 | Unclassified | 823 |
| 93 | Ga0070668_100152130 | 3300005347 | Bacteria | 1872 |
| 94 | Ga0070668_100236045 | 3300005347 | Bacteria | 1513 |
| 95 | Ga0070669_100011961 | 3300005353 | Bacteria | 6159 |
| 96 | Ga0070669_100052346 | 3300005353 | Bacteria | 2987 |
| 97 | Ga0070669_100182366 | 3300005353 | Bacteria | 1643 |
| 98 | Ga0070669_101410519 | 3300005353 | Bacteria | 604 |
| 99 | Ga0070675_100075980 | 3300005354 | Unclassified | 2793 |
| 100 | Ga0070675_100135338 | 3300005354 | Bacteria | 2103 |
| 101 | Ga0070675_100597647 | 3300005354 | Unclassified | 1000 |
| 102 | Ga0070675_100625660 | 3300005354 | Unclassified | 977 |
| 103 | Ga0070675_101880954 | 3300005354 | Unclassified | 552 |
| 104 | Ga0070671_100007875 | 3300005355 | Bacteria | 8518 |
| 105 | Ga0070671_100044630 | 3300005355 | Bacteria | 3684 |
| 106 | Ga0070671_100087676 | 3300005355 | Bacteria | 2604 |
| 107 | Ga0070671_100229044 | 3300005355 | Bacteria | 1577 |
| 108 | Ga0070671_100652246 | 3300005355 | Bacteria | 911 |
| 109 | Ga0070671_100726234 | 3300005355 | Bacteria | 862 |
| 110 | Ga0070674_100069469 | 3300005356 | Bacteria | 2485 |
| 111 | Ga0070674_101005025 | 3300005356 | Bacteria | 732 |
| 112 | Ga0070673_100023615 | 3300005364 | Bacteria | 4494 |
| 113 | Ga0070673_100029392 | 3300005364 | Bacteria | 4098 |
| 114 | Ga0070673_100116633 | 3300005364 | Bacteria | 2221 |
| 115 | Ga0070673_100139071 | 3300005364 | Bacteria | 2047 |
| 116 | Ga0070673_100176106 | 3300005364 | Bacteria | 1828 |
| 117 | Ga0070673_100267164 | 3300005364 | Bacteria | 1496 |
| 118 | Ga0070659_100003922 | 3300005366 | Bacteria | 10586 |
| 119 | Ga0070659_100007212 | 3300005366 | Bacteria | 8068 |
| 120 | Ga0070659_100042839 | 3300005366 | Bacteria | 3539 |
| 121 | Ga0070659_100057553 | 3300005366 | Bacteria | 3066 |
| 122 | Ga0070659_100084231 | 3300005366 | Bacteria | 2542 |
| 123 | Ga0070659_100164859 | 3300005366 | Bacteria | 1813 |
| 124 | Ga0070659_100320488 | 3300005366 | Bacteria | 1296 |
| 125 | Ga0070659_100713677 | 3300005366 | Bacteria | 868 |
| 126 | Ga0070659_100724465 | 3300005366 | Bacteria | 861 |
| 127 | Ga0070659_100893336 | 3300005366 | Unclassified | 776 |
| 128 | Ga0070667_100000842 | 3300005367 | Bacteria | 28434 |
| 129 | Ga0070667_100002368 | 3300005367 | Bacteria | 16509 |
| 130 | Ga0070667_100097434 | 3300005367 | Bacteria | 2537 |
| 131 | Ga0070667_100337612 | 3300005367 | Bacteria | 1362 |
| 132 | Ga0070713_100462693 | 3300005436 | Bacteria | 1193 |
| 133 | Ga0070663_100000234 | 3300005455 | Bacteria | 27971 |
| 134 | Ga0070663_100030813 | 3300005455 | Bacteria | 3680 |
| 135 | Ga0070663_100041985 | 3300005455 | Bacteria | 3212 |
| 136 | Ga0070663_100150922 | 3300005455 | Bacteria | 1782 |
| 137 | Ga0070663_100167182 | 3300005455 | Bacteria | 1697 |
| 138 | Ga0070663_100357834 | 3300005455 | Bacteria | 1183 |
| 139 | Ga0070663_100996109 | 3300005455 | Bacteria | 728 |
| 140 | Ga0070663_101212781 | 3300005455 | Unclassified | 663 |
| 141 | Ga0070663_101704488 | 3300005455 | Unclassified | 563 |
| 142 | Ga0070678_100064422 | 3300005456 | Bacteria | 2716 |
| 143 | Ga0070678_100078428 | 3300005456 | Bacteria | 2495 |
| 144 | Ga0070678_100938109 | 3300005456 | Unclassified | 793 |
| 145 | Ga0070662_100000010 | 3300005457 | Bacteria | 142717 |
| 146 | Ga0070662_100006841 | 3300005457 | Bacteria | 7374 |
| 147 | Ga0070662_100011566 | 3300005457 | Bacteria | 5823 |
| 148 | Ga0070662_100068657 | 3300005457 | Bacteria | 2606 |
| 149 | Ga0070662_100127922 | 3300005457 | Bacteria | 1955 |
| 150 | Ga0070662_100445387 | 3300005457 | Bacteria | 1074 |
| 151 | Ga0070662_100880328 | 3300005457 | Unclassified | 763 |
| 152 | Ga0068867_100066654 | 3300005459 | Bacteria | 2682 |
| 153 | Ga0070679_100120675 | 3300005530 | Bacteria | 2607 |
| 154 | Ga0070679_100250873 | 3300005530 | Bacteria | 1726 |
| 155 | Ga0070679_100532960 | 3300005530 | Bacteria | 1118 |
| 156 | Ga0070679_100588432 | 3300005530 | Bacteria | 1056 |
| 157 | Ga0070679_101311004 | 3300005530 | Bacteria | 670 |
| 158 | Ga0070679_101490132 | 3300005530 | Bacteria | 623 |
| 159 | Ga0070684_100060078 | 3300005535 | Bacteria | 3324 |
| 160 | Ga0070684_100189185 | 3300005535 | Bacteria | 1873 |
| 161 | Ga0070684_100821632 | 3300005535 | Bacteria | 869 |
| 162 | Ga0070684_101647831 | 3300005535 | Bacteria | 605 |
| 163 | Ga0068853_100000715 | 3300005539 | Bacteria | 22973 |
| 164 | Ga0068853_100151679 | 3300005539 | Bacteria | 2086 |
| 165 | Ga0068853_100161067 | 3300005539 | Bacteria | 2025 |
| 166 | Ga0068853_100227344 | 3300005539 | Bacteria | 1706 |
| 167 | Ga0068853_100227657 | 3300005539 | Bacteria | 1705 |
| 168 | Ga0068853_100612475 | 3300005539 | Unclassified | 1035 |
| 169 | Ga0068853_100624565 | 3300005539 | Bacteria | 1024 |
| 170 | Ga0070672_100167415 | 3300005543 | Bacteria | 1826 |
| 171 | Ga0070672_100227542 | 3300005543 | Bacteria | 1566 |
| 172 | Ga0070672_100612275 | 3300005543 | Bacteria | 949 |
| 173 | Ga0070693_100001081 | 3300005547 | Bacteria | 12202 |
| 174 | Ga0070693_100158693 | 3300005547 | Bacteria | 1439 |
| 175 | Ga0070693_100588207 | 3300005547 | Bacteria | 802 |
| 176 | Ga0070665_100002076 | 3300005548 | Bacteria | 22480 |
| 177 | Ga0070665_100009733 | 3300005548 | Bacteria | 9717 |
| 178 | Ga0070665_100009746 | 3300005548 | Bacteria | 9712 |
| 179 | Ga0070665_100012827 | 3300005548 | Bacteria | 8438 |
| 180 | Ga0070665_100556726 | 3300005548 | Bacteria | 1159 |
| 181 | Ga0068855_100001909 | 3300005563 | Bacteria | 25846 |
| 182 | Ga0068855_100060863 | 3300005563 | Bacteria | 4413 |
| 183 | Ga0068855_100204771 | 3300005563 | Bacteria | 2220 |
| 184 | Ga0068855_100465585 | 3300005563 | Bacteria | 1378 |
| 185 | Ga0068855_100469011 | 3300005563 | Unclassified | 1372 |
| 186 | Ga0068855_100503908 | 3300005563 | Unclassified | 1315 |
| 187 | Ga0068855_100741020 | 3300005563 | Bacteria | 1048 |
| 188 | Ga0068855_100930176 | 3300005563 | Bacteria | 917 |
| 189 | Ga0068855_101249986 | 3300005563 | Unclassified | 770 |
| 190 | Ga0068855_101404228 | 3300005563 | Bacteria | 719 |
| 191 | Ga0070664_100000615 | 3300005564 | Bacteria | 27211 |
| 192 | Ga0070664_100021951 | 3300005564 | Bacteria | 5264 |
| 193 | Ga0070664_100033988 | 3300005564 | Bacteria | 4275 |
| 194 | Ga0070664_100099139 | 3300005564 | Bacteria | 2532 |
| 195 | Ga0070664_100138010 | 3300005564 | Bacteria | 2145 |
| 196 | Ga0070664_100737675 | 3300005564 | Bacteria | 919 |
| 197 | Ga0068857_100041588 | 3300005577 | Bacteria | 4076 |
| 198 | Ga0068857_100188969 | 3300005577 | Bacteria | 1876 |
| 199 | Ga0068857_100191465 | 3300005577 | Bacteria | 1863 |
| 200 | Ga0068857_100942769 | 3300005577 | Bacteria | 829 |
| 201 | Ga0068854_100008303 | 3300005578 | Bacteria | 6668 |
| 202 | Ga0068854_100011084 | 3300005578 | Bacteria | 5853 |
| 203 | Ga0068854_100118372 | 3300005578 | Bacteria | 2007 |
| 204 | Ga0068854_100316408 | 3300005578 | Bacteria | 1267 |
| 205 | Ga0068854_100323774 | 3300005578 | Bacteria | 1254 |
| 206 | Ga0068854_100337153 | 3300005578 | Bacteria | 1230 |
| 207 | Ga0068854_100451458 | 3300005578 | Bacteria | 1074 |
| 208 | Ga0068854_100470361 | 3300005578 | Bacteria | 1053 |
| 209 | Ga0068854_100954862 | 3300005578 | Unclassified | 756 |
| 210 | Ga0068856_100000442 | 3300005614 | Bacteria | 45717 |
| 211 | Ga0068856_100011210 | 3300005614 | Bacteria | 8700 |
| 212 | Ga0068856_100301739 | 3300005614 | Bacteria | 1619 |
| 213 | Ga0068856_100771310 | 3300005614 | Unclassified | 981 |
| 214 | Ga0068856_100978710 | 3300005614 | Bacteria | 864 |
| 215 | Ga0068856_101475468 | 3300005614 | Unclassified | 694 |
| 216 | Ga0068856_102433070 | 3300005614 | Bacteria | 531 |
| 217 | Ga0068852_100000241 | 3300005616 | Bacteria | 37155 |
| 218 | Ga0068852_100004297 | 3300005616 | Bacteria | 10055 |
| 219 | Ga0068852_100018676 | 3300005616 | Bacteria | 5465 |
| 220 | Ga0068852_100056875 | 3300005616 | Bacteria | 3382 |
| 221 | Ga0068852_100232084 | 3300005616 | Bacteria | 1759 |
| 222 | Ga0068852_100257478 | 3300005616 | Bacteria | 1674 |
| 223 | Ga0068852_100789884 | 3300005616 | Unclassified | 963 |
| 224 | Ga0068852_100822797 | 3300005616 | Bacteria | 943 |
| 225 | Ga0068852_100879920 | 3300005616 | Unclassified | 912 |
| 226 | Ga0068852_101777194 | 3300005616 | Unclassified | 639 |
| 227 | Ga0068859_100642322 | 3300005617 | Unclassified | 1153 |
| 228 | Ga0068864_100004493 | 3300005618 | Bacteria | 11474 |
| 229 | Ga0068864_100519821 | 3300005618 | Unclassified | 1147 |
| 230 | Ga0068864_101739356 | 3300005618 | Unclassified | 628 |
| 231 | Ga0068861_102683897 | 3300005719 | Bacteria | 502 |
| 232 | Ga0068851_10004973 | 3300005834 | Bacteria | 6019 |
| 233 | Ga0068851_10144655 | 3300005834 | Bacteria | 1295 |
| 234 | Ga0068851_10800478 | 3300005834 | Bacteria | 585 |
| 235 | Ga0068863_100014278 | 3300005841 | Bacteria | 7649 |
| 236 | Ga0068862_100020659 | 3300005844 | Bacteria | 5501 |
| 237 | Ga0097621_100246041 | 3300006237 | Unclassified | 1565 |
| 238 | Ga0068871_100064545 | 3300006358 | Bacteria | 2998 |
| 239 | Ga0068871_100573619 | 3300006358 | Bacteria | 1024 |
| 240 | Ga0068871_101688605 | 3300006358 | Bacteria | 600 |
| 241 | Ga0075430_100671514 | 3300006846 | Bacteria | 854 |
| 242 | Ga0097620_100642319 | 3300006931 | Unclassified | 1153 |
| 243 | Ga0079104_1048787 | 3300006946 | Bacteria | 952 |
| 244 | Ga0105240_10095158 | 3300009093 | Bacteria | 3632 |
| 245 | Ga0105240_10100250 | 3300009093 | Bacteria | 3524 |
| 246 | Ga0105240_10127198 | 3300009093 | Bacteria | 3060 |
| 247 | Ga0105240_10334650 | 3300009093 | Bacteria | 1721 |
| 248 | Ga0105240_11219910 | 3300009093 | Unclassified | 796 |
| 249 | Ga0105240_12069201 | 3300009093 | Unclassified | 591 |
| 250 | Ga0111539_12712655 | 3300009094 | Bacteria | 574 |
| 251 | Ga0105245_10172523 | 3300009098 | Bacteria | 2060 |
| 252 | Ga0105247_10288163 | 3300009101 | Unclassified | 1135 |
| 253 | Ga0105247_10889170 | 3300009101 | Bacteria | 687 |
| 254 | Ga0105243_10523408 | 3300009148 | Bacteria | 1128 |
| 255 | Ga0105241_10046707 | 3300009174 | Bacteria | 3289 |
| 256 | Ga0105241_10472204 | 3300009174 | Unclassified | 1113 |
| 257 | Ga0105241_10640445 | 3300009174 | Bacteria | 964 |
| 258 | Ga0105242_10362671 | 3300009176 | Bacteria | 1341 |
| 259 | Ga0105242_12655807 | 3300009176 | Unclassified | 550 |
| 260 | Ga0105248_10001127 | 3300009177 | Bacteria | 29711 |
| 261 | Ga0105248_10001586 | 3300009177 | Bacteria | 25332 |
| 262 | Ga0105248_10064040 | 3300009177 | Bacteria | 4127 |
| 263 | Ga0105248_10205694 | 3300009177 | Bacteria | 2218 |
| 264 | Ga0105237_10134559 | 3300009545 | Bacteria | 2466 |
| 265 | Ga0105237_12196328 | 3300009545 | Bacteria | 561 |
| 266 | Ga0105238_10001904 | 3300009551 | Bacteria | 20960 |
| 267 | Ga0105238_10072019 | 3300009551 | Bacteria | 3453 |
| 268 | Ga0105238_10096544 | 3300009551 | Bacteria | 2941 |
| 269 | Ga0105238_10286464 | 3300009551 | Bacteria | 1629 |
| 270 | Ga0105239_10776122 | 3300010375 | Bacteria | 1097 |
| 271 | Ga0105239_11470741 | 3300010375 | Bacteria | 787 |
| 272 | Ga0157315_1007917 | 3300012508 | Unclassified | 875 |
| 273 | Ga0157373_10021351 | 3300013100 | Bacteria | 4703 |
| 274 | Ga0157373_10021899 | 3300013100 | Bacteria | 4637 |
| 275 | Ga0157373_10058801 | 3300013100 | Bacteria | 2724 |
| 276 | Ga0157373_10059996 | 3300013100 | Bacteria | 2695 |
| 277 | Ga0157373_10090777 | 3300013100 | Bacteria | 2151 |
| 278 | Ga0157373_10213658 | 3300013100 | Bacteria | 1360 |
| 279 | Ga0157373_10263662 | 3300013100 | Bacteria | 1219 |
| 280 | Ga0157373_10298860 | 3300013100 | Bacteria | 1142 |
| 281 | Ga0157373_10625052 | 3300013100 | Bacteria | 785 |
| 282 | Ga0157373_11544602 | 3300013100 | Bacteria | 507 |
| 283 | Ga0157371_10002401 | 3300013102 | Bacteria | 17923 |
| 284 | Ga0157371_10102338 | 3300013102 | Bacteria | 2032 |
| 285 | Ga0157371_10407381 | 3300013102 | Bacteria | 996 |
| 286 | Ga0157371_10436944 | 3300013102 | Unclassified | 961 |
| 287 | Ga0157371_10597310 | 3300013102 | Unclassified | 821 |
| 288 | Ga0157371_11267875 | 3300013102 | Bacteria | 569 |
| 289 | Ga0157371_11617954 | 3300013102 | Unclassified | 507 |
| 290 | Ga0157370_10003954 | 3300013104 | Bacteria | 17255 |
| 291 | Ga0157370_10192136 | 3300013104 | Bacteria | 1895 |
| 292 | Ga0157370_10473729 | 3300013104 | Unclassified | 1151 |
| 293 | Ga0157370_10725281 | 3300013104 | Unclassified | 906 |
| 294 | Ga0157370_11053957 | 3300013104 | Unclassified | 735 |
| 295 | Ga0157369_10000106 | 3300013105 | Bacteria | 117964 |
| 296 | Ga0157369_10049843 | 3300013105 | Bacteria | 4537 |
| 297 | Ga0157369_10203373 | 3300013105 | Bacteria | 2078 |
| 298 | Ga0157369_10250557 | 3300013105 | Bacteria | 1848 |
| 299 | Ga0157369_10996497 | 3300013105 | Bacteria | 858 |
| 300 | Ga0157374_10035871 | 3300013296 | Bacteria | 4539 |
| 301 | Ga0157374_10055319 | 3300013296 | Bacteria | 3703 |
| 302 | Ga0157374_10460715 | 3300013296 | Bacteria | 1273 |
| 303 | Ga0157378_10142820 | 3300013297 | Bacteria | 2224 |
| 304 | Ga0163162_10075213 | 3300013306 | Bacteria | 3438 |
| 305 | Ga0163162_10782407 | 3300013306 | Bacteria | 1072 |
| 306 | Ga0163162_11042640 | 3300013306 | Unclassified | 925 |
| 307 | Ga0157372_10431317 | 3300013307 | Bacteria | 1536 |
| 308 | Ga0157372_10672971 | 3300013307 | Bacteria | 1205 |
| 309 | Ga0157372_10712592 | 3300013307 | Bacteria | 1167 |
| 310 | Ga0157372_10965571 | 3300013307 | Bacteria | 988 |
| 311 | Ga0157372_11066021 | 3300013307 | Bacteria | 935 |
| 312 | Ga0157372_11555876 | 3300013307 | Unclassified | 761 |
| 313 | Ga0157372_12602767 | 3300013307 | Unclassified | 581 |
| 314 | Ga0157375_10228490 | 3300013308 | Bacteria | 2019 |
| 315 | Ga0157375_10974483 | 3300013308 | Bacteria | 989 |
| 316 | Ga0163163_10001016 | 3300014325 | Bacteria | 23746 |
| 317 | Ga0163163_10855137 | 3300014325 | Bacteria | 973 |
| 318 | Ga0157380_10869011 | 3300014326 | Bacteria | 925 |
| 319 | Ga0157380_11429228 | 3300014326 | Bacteria | 743 |
| 320 | Ga0157379_10092035 | 3300014968 | Bacteria | 2720 |
| 321 | Ga0163161_10096122 | 3300017792 | Bacteria | 2199 |
| 322 | Ga0213874_10011211 | 3300021377 | Bacteria | 2265 |
| 323 | Ga0213876_10000252 | 3300021384 | Bacteria | 50523 |
| 324 | Ga0207666_1033351 | 3300025271 | Bacteria | 793 |
| 325 | Ga0207697_10018686 | 3300025315 | Bacteria | 2841 |
| 326 | Ga0207697_10471545 | 3300025315 | Bacteria | 556 |
| 327 | Ga0207656_10018003 | 3300025321 | Unclassified | 2775 |
| 328 | Ga0207656_10095685 | 3300025321 | Bacteria | 1354 |
| 329 | Ga0207682_10025160 | 3300025893 | Bacteria | 2360 |
| 330 | Ga0207682_10048298 | 3300025893 | Bacteria | 1754 |
| 331 | Ga0207682_10117592 | 3300025893 | Bacteria | 1176 |
| 332 | Ga0207692_10122221 | 3300025898 | Bacteria | 1459 |
| 333 | Ga0207688_10109065 | 3300025901 | Bacteria | 1605 |
| 334 | Ga0207680_10055355 | 3300025903 | Bacteria | 2390 |
| 335 | Ga0207680_10108269 | 3300025903 | Unclassified | 1798 |
| 336 | Ga0207680_10645517 | 3300025903 | Bacteria | 758 |
| 337 | Ga0207647_10009245 | 3300025904 | Bacteria | 7009 |
| 338 | Ga0207647_10056487 | 3300025904 | Bacteria | 2408 |
| 339 | Ga0207647_10113491 | 3300025904 | Bacteria | 1601 |
| 340 | Ga0207647_10276370 | 3300025904 | Unclassified | 959 |
| 341 | Ga0207645_10104835 | 3300025907 | Bacteria | 1826 |
| 342 | Ga0207645_10388657 | 3300025907 | Bacteria | 937 |
| 343 | Ga0207705_10000151 | 3300025909 | Bacteria | 74614 |
| 344 | Ga0207705_10000232 | 3300025909 | Bacteria | 55596 |
| 345 | Ga0207705_10020766 | 3300025909 | Bacteria | 4687 |
| 346 | Ga0207705_10083286 | 3300025909 | Bacteria | 2333 |
| 347 | Ga0207705_10085270 | 3300025909 | Bacteria | 2307 |
| 348 | Ga0207705_10474948 | 3300025909 | Bacteria | 970 |
| 349 | Ga0207654_10154736 | 3300025911 | Unclassified | 1475 |
| 350 | Ga0207707_10589459 | 3300025912 | Bacteria | 942 |
| 351 | Ga0207707_11467681 | 3300025912 | Unclassified | 542 |
| 352 | Ga0207695_10002502 | 3300025913 | Bacteria | 27010 |
| 353 | Ga0207695_10011732 | 3300025913 | Bacteria | 10583 |
| 354 | Ga0207695_10033176 | 3300025913 | Bacteria | 5638 |
| 355 | Ga0207695_10676261 | 3300025913 | Bacteria | 913 |
| 356 | Ga0207671_10229107 | 3300025914 | Bacteria | 1457 |
| 357 | Ga0207660_10058884 | 3300025917 | Bacteria | 2756 |
| 358 | Ga0207660_10769788 | 3300025917 | Unclassified | 786 |
| 359 | Ga0207660_11689117 | 3300025917 | Unclassified | 509 |
| 360 | Ga0207662_10498761 | 3300025918 | Unclassified | 838 |
| 361 | Ga0207657_10000026 | 3300025919 | Bacteria | 143118 |
| 362 | Ga0207657_10006968 | 3300025919 | Bacteria | 11641 |
| 363 | Ga0207657_10038269 | 3300025919 | Bacteria | 4272 |
| 364 | Ga0207657_10070275 | 3300025919 | Bacteria | 2968 |
| 365 | Ga0207657_10106702 | 3300025919 | Bacteria | 2317 |
| 366 | Ga0207657_10130785 | 3300025919 | Bacteria | 2057 |
| 367 | Ga0207657_10317571 | 3300025919 | Unclassified | 1232 |
| 368 | Ga0207657_10573858 | 3300025919 | Bacteria | 881 |
| 369 | Ga0207657_11296882 | 3300025919 | Unclassified | 550 |
| 370 | Ga0207649_10000318 | 3300025920 | Bacteria | 36532 |
| 371 | Ga0207649_10007523 | 3300025920 | Bacteria | 5920 |
| 372 | Ga0207649_10131760 | 3300025920 | Bacteria | 1699 |
| 373 | Ga0207649_10145758 | 3300025920 | Bacteria | 1625 |
| 374 | Ga0207649_10293073 | 3300025920 | Bacteria | 1187 |
| 375 | Ga0207649_10373544 | 3300025920 | Unclassified | 1061 |
| 376 | Ga0207649_11523809 | 3300025920 | Bacteria | 529 |
| 377 | Ga0207649_11618885 | 3300025920 | Bacteria | 513 |
| 378 | Ga0207652_10184328 | 3300025921 | Bacteria | 1877 |
| 379 | Ga0207652_10191918 | 3300025921 | Bacteria | 1837 |
| 380 | Ga0207652_10468183 | 3300025921 | Bacteria | 1135 |
| 381 | Ga0207652_11240644 | 3300025921 | Bacteria | 648 |
| 382 | Ga0207652_11768891 | 3300025921 | Unclassified | 523 |
| 383 | Ga0207681_10007671 | 3300025923 | Bacteria | 6609 |
| 384 | Ga0207681_10643801 | 3300025923 | Bacteria | 878 |
| 385 | Ga0207694_10048486 | 3300025924 | Bacteria | 3287 |
| 386 | Ga0207694_10227060 | 3300025924 | Bacteria | 1524 |
| 387 | Ga0207694_10833312 | 3300025924 | Bacteria | 779 |
| 388 | Ga0207694_10836312 | 3300025924 | Unclassified | 778 |
| 389 | Ga0207650_10123515 | 3300025925 | Bacteria | 2018 |
| 390 | Ga0207650_10155088 | 3300025925 | Bacteria | 1810 |
| 391 | Ga0207650_10178476 | 3300025925 | Bacteria | 1691 |
| 392 | Ga0207650_10263363 | 3300025925 | Bacteria | 1399 |
| 393 | Ga0207650_10281919 | 3300025925 | Unclassified | 1353 |
| 394 | Ga0207650_10360217 | 3300025925 | Bacteria | 1198 |
| 395 | Ga0207659_10357002 | 3300025926 | Bacteria | 1214 |
| 396 | Ga0207659_10814320 | 3300025926 | Unclassified | 802 |
| 397 | Ga0207659_11499326 | 3300025926 | Unclassified | 577 |
| 398 | Ga0207687_11016132 | 3300025927 | Unclassified | 711 |
| 399 | Ga0207664_10099358 | 3300025929 | Bacteria | 2401 |
| 400 | Ga0207644_10012166 | 3300025931 | Bacteria | 5710 |
| 401 | Ga0207644_10089752 | 3300025931 | Bacteria | 2288 |
| 402 | Ga0207644_10090695 | 3300025931 | Bacteria | 2278 |
| 403 | Ga0207644_10158528 | 3300025931 | Bacteria | 1757 |
| 404 | Ga0207644_10448841 | 3300025931 | Bacteria | 1059 |
| 405 | Ga0207644_10638638 | 3300025931 | Unclassified | 885 |
| 406 | Ga0207644_10853834 | 3300025931 | Bacteria | 762 |
| 407 | Ga0207644_11061178 | 3300025931 | Unclassified | 680 |
| 408 | Ga0207690_10001417 | 3300025932 | Bacteria | 15079 |
| 409 | Ga0207690_10011217 | 3300025932 | Bacteria | 5351 |
| 410 | Ga0207690_10031421 | 3300025932 | Bacteria | 3397 |
| 411 | Ga0207690_10258140 | 3300025932 | Bacteria | 1349 |
| 412 | Ga0207690_10453909 | 3300025932 | Unclassified | 1031 |
| 413 | Ga0207690_10636128 | 3300025932 | Unclassified | 873 |
| 414 | Ga0207690_10874299 | 3300025932 | Unclassified | 745 |
| 415 | Ga0207690_11053827 | 3300025932 | Unclassified | 677 |
| 416 | Ga0207690_11244770 | 3300025932 | Bacteria | 622 |
| 417 | Ga0207706_10000031 | 3300025933 | Bacteria | 143109 |
| 418 | Ga0207706_10001098 | 3300025933 | Bacteria | 27522 |
| 419 | Ga0207706_10008288 | 3300025933 | Bacteria | 9585 |
| 420 | Ga0207706_10065467 | 3300025933 | Bacteria | 3200 |
| 421 | Ga0207706_10081080 | 3300025933 | Bacteria | 2852 |
| 422 | Ga0207706_10096106 | 3300025933 | Bacteria | 2605 |
| 423 | Ga0207706_10169165 | 3300025933 | Bacteria | 1921 |
| 424 | Ga0207706_10772839 | 3300025933 | Bacteria | 817 |
| 425 | Ga0207706_10810623 | 3300025933 | Unclassified | 795 |
| 426 | Ga0207706_11151605 | 3300025933 | Bacteria | 646 |
| 427 | Ga0207686_10746922 | 3300025934 | Bacteria | 781 |
| 428 | Ga0207709_10505670 | 3300025935 | Bacteria | 944 |
| 429 | Ga0207669_11586502 | 3300025937 | Unclassified | 558 |
| 430 | Ga0207691_10045726 | 3300025940 | Bacteria | 4023 |
| 431 | Ga0207691_10147407 | 3300025940 | Bacteria | 2071 |
| 432 | Ga0207691_10397696 | 3300025940 | Bacteria | 1175 |
| 433 | Ga0207691_10646391 | 3300025940 | Bacteria | 894 |
| 434 | Ga0207691_10932353 | 3300025940 | Unclassified | 726 |
| 435 | Ga0207711_10003583 | 3300025941 | Bacteria | 13431 |
| 436 | Ga0207711_10030300 | 3300025941 | Bacteria | 4563 |
| 437 | Ga0207711_10136228 | 3300025941 | Bacteria | 2206 |
| 438 | Ga0207711_10190060 | 3300025941 | Unclassified | 1871 |
| 439 | Ga0207711_10729288 | 3300025941 | Bacteria | 924 |
| 440 | Ga0207689_10153965 | 3300025942 | Bacteria | 1895 |
| 441 | Ga0207661_10002291 | 3300025944 | Bacteria | 13179 |
| 442 | Ga0207661_10122260 | 3300025944 | Bacteria | 2218 |
| 443 | Ga0207661_11065571 | 3300025944 | Bacteria | 744 |
| 444 | Ga0207679_10000572 | 3300025945 | Bacteria | 24759 |
| 445 | Ga0207679_10239097 | 3300025945 | Unclassified | 1538 |
| 446 | Ga0207679_10349117 | 3300025945 | Bacteria | 1289 |
| 447 | Ga0207679_10362464 | 3300025945 | Bacteria | 1266 |
| 448 | Ga0207667_10037667 | 3300025949 | Bacteria | 5169 |
| 449 | Ga0207667_10069864 | 3300025949 | Bacteria | 3656 |
| 450 | Ga0207667_10090761 | 3300025949 | Bacteria | 3157 |
| 451 | Ga0207667_10179975 | 3300025949 | Bacteria | 2171 |
| 452 | Ga0207667_10239222 | 3300025949 | Bacteria | 1858 |
| 453 | Ga0207667_11064600 | 3300025949 | Unclassified | 793 |
| 454 | Ga0207667_11982982 | 3300025949 | Bacteria | 543 |
| 455 | Ga0207651_10016342 | 3300025960 | Bacteria | 4344 |
| 456 | Ga0207651_10151990 | 3300025960 | Bacteria | 1803 |
| 457 | Ga0207651_10302143 | 3300025960 | Bacteria | 1331 |
| 458 | Ga0207651_10559394 | 3300025960 | Unclassified | 995 |
| 459 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 460 | Ga0207640_10007063 | 3300025981 | Bacteria | 6185 |
| 461 | Ga0207640_10013046 | 3300025981 | Bacteria | 4753 |
| 462 | Ga0207640_10035455 | 3300025981 | Bacteria | 3123 |
| 463 | Ga0207640_10299579 | 3300025981 | Bacteria | 1271 |
| 464 | Ga0207640_10301244 | 3300025981 | Bacteria | 1268 |
| 465 | Ga0207640_10507068 | 3300025981 | Bacteria | 1006 |
| 466 | Ga0207640_11414187 | 3300025981 | Unclassified | 623 |
| 467 | Ga0207658_10004019 | 3300025986 | Bacteria | 10294 |
| 468 | Ga0207658_10076645 | 3300025986 | Bacteria | 2548 |
| 469 | Ga0207658_10080552 | 3300025986 | Bacteria | 2494 |
| 470 | Ga0207658_11492494 | 3300025986 | Bacteria | 618 |
| 471 | Ga0207658_11723607 | 3300025986 | Unclassified | 572 |
| 472 | Ga0207677_10220964 | 3300026023 | Bacteria | 1519 |
| 473 | Ga0207677_10417306 | 3300026023 | Unclassified | 1142 |
| 474 | Ga0207677_11050871 | 3300026023 | Unclassified | 740 |
| 475 | Ga0207703_10138525 | 3300026035 | Bacteria | 2110 |
| 476 | Ga0207639_10001178 | 3300026041 | Bacteria | 17759 |
| 477 | Ga0207639_10147410 | 3300026041 | Bacteria | 1967 |
| 478 | Ga0207639_10287572 | 3300026041 | Bacteria | 1448 |
| 479 | Ga0207639_10292679 | 3300026041 | Bacteria | 1436 |
| 480 | Ga0207639_10496425 | 3300026041 | Unclassified | 1114 |
| 481 | Ga0207639_10917284 | 3300026041 | Bacteria | 819 |
| 482 | Ga0207678_10000989 | 3300026067 | Bacteria | 25886 |
| 483 | Ga0207678_10005287 | 3300026067 | Bacteria | 11558 |
| 484 | Ga0207678_10080669 | 3300026067 | Bacteria | 2785 |
| 485 | Ga0207678_10153784 | 3300026067 | Unclassified | 1964 |
| 486 | Ga0207678_10162116 | 3300026067 | Bacteria | 1909 |
| 487 | Ga0207678_10223810 | 3300026067 | Bacteria | 1611 |
| 488 | Ga0207678_10469474 | 3300026067 | Bacteria | 1095 |
| 489 | Ga0207702_10000891 | 3300026078 | Bacteria | 30976 |
| 490 | Ga0207702_10005655 | 3300026078 | Bacteria | 10902 |
| 491 | Ga0207702_10010126 | 3300026078 | Bacteria | 7897 |
| 492 | Ga0207702_10030457 | 3300026078 | Bacteria | 4497 |
| 493 | Ga0207702_10163764 | 3300026078 | Bacteria | 2033 |
| 494 | Ga0207702_11330153 | 3300026078 | Bacteria | 712 |
| 495 | Ga0207702_12110681 | 3300026078 | Archaea | 553 |
| 496 | Ga0207641_10017148 | 3300026088 | Bacteria | 5924 |
| 497 | Ga0207648_10023086 | 3300026089 | Bacteria | 5579 |
| 498 | Ga0207676_10008133 | 3300026095 | Bacteria | 7455 |
| 499 | Ga0207676_10078555 | 3300026095 | Bacteria | 2673 |
| 500 | Ga0207676_11390684 | 3300026095 | Unclassified | 698 |
| 501 | Ga0207676_11942477 | 3300026095 | Unclassified | 587 |
| 502 | Ga0207674_10035328 | 3300026116 | Bacteria | 5217 |
| 503 | Ga0207674_10096380 | 3300026116 | Bacteria | 2943 |
| 504 | Ga0207674_10514666 | 3300026116 | Bacteria | 1156 |
| 505 | Ga0207683_10014692 | 3300026121 | Bacteria | 6667 |
| 506 | Ga0207683_10110332 | 3300026121 | Bacteria | 2463 |
| 507 | Ga0207683_10989646 | 3300026121 | Unclassified | 781 |
| 508 | Ga0207698_10002956 | 3300026142 | Bacteria | 10171 |
| 509 | Ga0207698_10009609 | 3300026142 | Bacteria | 6174 |
| 510 | Ga0207698_10016415 | 3300026142 | Bacteria | 4989 |
| 511 | Ga0207698_10074672 | 3300026142 | Bacteria | 2706 |
| 512 | Ga0207698_10225009 | 3300026142 | Bacteria | 1699 |
| 513 | Ga0207698_10305848 | 3300026142 | Bacteria | 1482 |
| 514 | Ga0207698_10624213 | 3300026142 | Unclassified | 1065 |
| 515 | Ga0207698_10699054 | 3300026142 | Unclassified | 1009 |
| 516 | Ga0207698_10714343 | 3300026142 | Bacteria | 998 |
| 517 | Ga0207698_10896726 | 3300026142 | Bacteria | 894 |
| 518 | Ga0207698_11294445 | 3300026142 | Unclassified | 744 |
| 519 | Ga0209281_1063974 | 3300027111 | Bacteria | 554 |
| 520 | Ga0209981_1015381 | 3300027378 | Bacteria | 1072 |
| 521 | Ga0209970_1049701 | 3300027614 | Bacteria | 757 |
| 522 | Ga0209983_1089699 | 3300027665 | Unclassified | 692 |
| 523 | Ga0268266_10001182 | 3300028379 | Bacteria | 32222 |
| 524 | Ga0268266_10007451 | 3300028379 | Bacteria | 9872 |
| 525 | Ga0268266_10077345 | 3300028379 | Bacteria | 2893 |
| 526 | Ga0268266_10183778 | 3300028379 | Bacteria | 1905 |
| 527 | Ga0268266_11836538 | 3300028379 | Unclassified | 580 |
| 528 | Ga0268265_10009628 | 3300028380 | Bacteria | 6525 |
| 529 | Ga0307408_100021515 | 3300031548 | Bacteria | 4365 |
| 530 | Ga0307408_100055059 | 3300031548 | Bacteria | 2878 |
| 531 | Ga0307408_100316481 | 3300031548 | Unclassified | 1313 |
| 532 | Ga0307408_100632649 | 3300031548 | Unclassified | 954 |
| 533 | Ga0307405_10076710 | 3300031731 | Bacteria | 2169 |
| 534 | Ga0307405_10189910 | 3300031731 | Bacteria | 1483 |
| 535 | Ga0307405_10209212 | 3300031731 | Bacteria | 1423 |
| 536 | Ga0307405_10233033 | 3300031731 | Bacteria | 1358 |
| 537 | Ga0307405_10686767 | 3300031731 | Bacteria | 846 |
| 538 | Ga0307405_11688891 | 3300031731 | Bacteria | 561 |
| 539 | Ga0307413_10071038 | 3300031824 | Bacteria | 2192 |
| 540 | Ga0307413_10164336 | 3300031824 | Bacteria | 1563 |
| 541 | Ga0307413_10301444 | 3300031824 | Bacteria | 1215 |
| 542 | Ga0307413_10679535 | 3300031824 | Unclassified | 853 |
| 543 | Ga0307413_10876323 | 3300031824 | Unclassified | 760 |
| 544 | Ga0307413_10980425 | 3300031824 | Unclassified | 723 |
| 545 | Ga0307410_10005912 | 3300031852 | Bacteria | 6539 |
| 546 | Ga0307410_10241895 | 3300031852 | Bacteria | 1399 |
| 547 | Ga0307410_10269873 | 3300031852 | Bacteria | 1330 |
| 548 | Ga0307410_10373925 | 3300031852 | Bacteria | 1145 |
| 549 | Ga0307410_10387373 | 3300031852 | Bacteria | 1126 |
| 550 | Ga0307410_10410416 | 3300031852 | Bacteria | 1096 |
| 551 | Ga0307406_10032078 | 3300031901 | Bacteria | 3204 |
| 552 | Ga0307406_10168493 | 3300031901 | Bacteria | 1582 |
| 553 | Ga0307406_10692311 | 3300031901 | Unclassified | 850 |
| 554 | Ga0307407_10084958 | 3300031903 | Bacteria | 1924 |
| 555 | Ga0307407_10102953 | 3300031903 | Bacteria | 1776 |
| 556 | Ga0307407_10278640 | 3300031903 | Bacteria | 1157 |
| 557 | Ga0307407_10487270 | 3300031903 | Unclassified | 901 |
| 558 | Ga0307407_10782182 | 3300031903 | Bacteria | 725 |
| 559 | Ga0307412_10031102 | 3300031911 | Bacteria | 3367 |
| 560 | Ga0307412_10048386 | 3300031911 | Bacteria | 2796 |
| 561 | Ga0307412_10163739 | 3300031911 | Bacteria | 1656 |
| 562 | Ga0307412_11187192 | 3300031911 | Bacteria | 683 |
| 563 | Ga0307412_11496371 | 3300031911 | Unclassified | 613 |
| 564 | Ga0307412_11711862 | 3300031911 | Unclassified | 576 |
| 565 | Ga0307412_11847745 | 3300031911 | Unclassified | 556 |
| 566 | Ga0307412_12151644 | 3300031911 | Unclassified | 519 |
| 567 | Ga0307409_100019126 | 3300031995 | Bacteria | 4627 |
| 568 | Ga0307409_100117826 | 3300031995 | Bacteria | 2241 |
| 569 | Ga0307409_100135292 | 3300031995 | Bacteria | 2114 |
| 570 | Ga0307409_100201397 | 3300031995 | Bacteria | 1781 |
| 571 | Ga0307409_100314662 | 3300031995 | Bacteria | 1462 |
| 572 | Ga0307409_100367523 | 3300031995 | Bacteria | 1363 |
| 573 | Ga0307409_101510266 | 3300031995 | Bacteria | 699 |
| 574 | Ga0307409_101939014 | 3300031995 | Bacteria | 618 |
| 575 | Ga0307416_100274432 | 3300032002 | Bacteria | 1658 |
| 576 | Ga0307416_100325149 | 3300032002 | Bacteria | 1542 |
| 577 | Ga0307416_100411372 | 3300032002 | Bacteria | 1393 |
| 578 | Ga0307416_101282301 | 3300032002 | Bacteria | 838 |
| 579 | Ga0307416_103459952 | 3300032002 | Unclassified | 528 |
| 580 | Ga0307416_103514236 | 3300032002 | Unclassified | 524 |
| 581 | Ga0307414_10000536 | 3300032004 | Bacteria | 19786 |
| 582 | Ga0307414_10002526 | 3300032004 | Bacteria | 9602 |
| 583 | Ga0307414_10224282 | 3300032004 | Bacteria | 1545 |
| 584 | Ga0307414_10266169 | 3300032004 | Bacteria | 1433 |
| 585 | Ga0307414_11413227 | 3300032004 | Bacteria | 647 |
| 586 | Ga0307411_10013558 | 3300032005 | Bacteria | 4501 |
| 587 | Ga0307411_10032212 | 3300032005 | Bacteria | 3236 |
| 588 | Ga0307411_10079151 | 3300032005 | Bacteria | 2256 |
| 589 | Ga0307411_10084871 | 3300032005 | Bacteria | 2191 |
| 590 | Ga0307411_10138656 | 3300032005 | Bacteria | 1790 |
| 591 | Ga0307411_10424126 | 3300032005 | Bacteria | 1106 |
| 592 | Ga0307411_10723194 | 3300032005 | Bacteria | 869 |
| 593 | Ga0307415_100153682 | 3300032126 | Bacteria | 1774 |
| 594 | Ga0307415_100230747 | 3300032126 | Bacteria | 1490 |
| 595 | Ga0307415_100256486 | 3300032126 | Bacteria | 1424 |
| 596 | Ga0307415_100572265 | 3300032126 | Bacteria | 1000 |
| 597 | Ga0307415_100814170 | 3300032126 | Bacteria | 854 |
| 598 | Ga0307415_101258758 | 3300032126 | Bacteria | 699 |
| 599 | Ga0307415_101420232 | 3300032126 | Bacteria | 661 |
| 600 | Ga0373930_0057921 | 3300034816 | Unclassified | 859 |
| 601 | Ga0373959_0087205 | 3300034820 | Unclassified | 727 |
| 602 | Ga0373952_0092297 | 3300035092 | Unclassified | 788 |
| 603 | Ga0373954_0634977 | 3300035118 | Unclassified | 529 |
| 604 | Ga0373956_0244655 | 3300035119 | Bacteria | 853 |
| 605 | Ga0373956_0606019 | 3300035119 | Unclassified | 523 |
| 606 | Ga0373960_0051867 | 3300035121 | Unclassified | 1220 |
| 607 | Ga0373955_0407706 | 3300035172 | Unclassified | 826 |
| 608 | Ga0373933_0088697 | 3300035724 | Bacteria | 1906 |
| 609 | Ga0373933_0786815 | 3300035724 | Bacteria | 626 |
| 610 | Ga0373937_0002021 | 3300036401 | Bacteria | 16928 |
| 611 | Ga0373937_0106446 | 3300036401 | Unclassified | 2607 |
| 612 | Ga0373937_1327239 | 3300036401 | Bacteria | 667 |
| 613 | Ga0373937_1658272 | 3300036401 | Bacteria | 586 |
| 614 | Ga0373925_1220972 | 3300037068 | Unclassified | 618 |
| 615 | Ga0395899_0034393 | 3300037312 | Bacteria | 3805 |
| 616 | Ga0395899_0037068 | 3300037312 | Bacteria | 3656 |
| 617 | Ga0395899_0050080 | 3300037312 | Bacteria | 3102 |
| 618 | Ga0395899_0061730 | 3300037312 | Bacteria | 2760 |
| 619 | Ga0395899_0063340 | 3300037312 | Bacteria | 2720 |
| 620 | Ga0395899_0079490 | 3300037312 | Bacteria | 2388 |
| 621 | Ga0395899_0082928 | 3300037312 | Bacteria | 2331 |
| 622 | Ga0395899_0094335 | 3300037312 | Bacteria | 2165 |
| 623 | Ga0395899_0114907 | 3300037312 | Bacteria | 1932 |
| 624 | Ga0395899_0146065 | 3300037312 | Bacteria | 1679 |
| 625 | Ga0395899_0156903 | 3300037312 | Bacteria | 1610 |
| 626 | Ga0395899_0227995 | 3300037312 | Bacteria | 1288 |
| 627 | Ga0395899_0238139 | 3300037312 | Bacteria | 1253 |
| 628 | Ga0395899_0512819 | 3300037312 | Unclassified | 776 |
| 629 | Ga0395900_0001394 | 3300037418 | Bacteria | 28915 |
| 630 | Ga0395900_0026006 | 3300037418 | Bacteria | 5993 |
| 631 | Ga0395900_0033844 | 3300037418 | Bacteria | 5258 |
| 632 | Ga0395900_0047139 | 3300037418 | Bacteria | 4437 |
| 633 | Ga0395900_0057719 | 3300037418 | Bacteria | 3996 |
| 634 | Ga0395900_0098145 | 3300037418 | Bacteria | 3010 |
| 635 | Ga0395900_0120394 | 3300037418 | Bacteria | 2693 |
| 636 | Ga0395900_0180659 | 3300037418 | Bacteria | 2144 |
| 637 | Ga0395900_0214138 | 3300037418 | Bacteria | 1944 |
| 638 | Ga0395900_0264197 | 3300037418 | Bacteria | 1717 |
| 639 | Ga0395900_0419465 | 3300037418 | Unclassified | 1299 |
| 640 | Ga0395900_0437241 | 3300037418 | Bacteria | 1266 |
| 641 | Ga0395900_0450727 | 3300037418 | Bacteria | 1243 |
| 642 | Ga0395900_0499748 | 3300037418 | Bacteria | 1166 |
| 643 | Ga0395900_0565194 | 3300037418 | Bacteria | 1080 |
| 644 | Ga0395900_0573773 | 3300037418 | Bacteria | 1070 |
| 645 | Ga0395900_0611480 | 3300037418 | Unclassified | 1029 |
| 646 | Ga0395900_0639264 | 3300037418 | Bacteria | 1001 |
| 647 | Ga0395900_1052900 | 3300037418 | Unclassified | 732 |
| 648 | Ga0395900_1084293 | 3300037418 | Bacteria | 718 |
| 649 | Ga0395900_1392037 | 3300037418 | Bacteria | 614 |
| 650 | Ga0395900_1483584 | 3300037418 | Unclassified | 590 |
| 651 | Ga0395898_0024517 | 3300037466 | Bacteria | 6083 |
| 652 | Ga0395898_0049701 | 3300037466 | Unclassified | 4108 |
| 653 | Ga0395898_0064883 | 3300037466 | Bacteria | 3541 |
| 654 | Ga0395898_0076467 | 3300037466 | Bacteria | 3233 |
| 655 | Ga0395898_0106743 | 3300037466 | Bacteria | 2686 |
| 656 | Ga0395898_0116659 | 3300037466 | Bacteria | 2558 |
| 657 | Ga0395898_0133757 | 3300037466 | Bacteria | 2374 |
| 658 | Ga0395898_0133848 | 3300037466 | Bacteria | 2373 |
| 659 | Ga0395898_0165002 | 3300037466 | Bacteria | 2118 |
| 660 | Ga0395898_0264782 | 3300037466 | Bacteria | 1639 |
| 661 | Ga0395898_0331733 | 3300037466 | Bacteria | 1450 |
| 662 | Ga0395898_0517435 | 3300037466 | Bacteria | 1134 |
| 663 | Ga0395898_0695901 | 3300037466 | Bacteria | 958 |
| 664 | Ga0395898_1366445 | 3300037466 | Bacteria | 636 |
| 665 | Ga0395905_0001106 | 3300037471 | Bacteria | 33891 |
| 666 | Ga0395905_0022646 | 3300037471 | Bacteria | 5939 |
| 667 | Ga0395905_0032485 | 3300037471 | Bacteria | 4909 |
| 668 | Ga0395905_0037636 | 3300037471 | Unclassified | 4541 |
| 669 | Ga0395905_0049175 | 3300037471 | Bacteria | 3951 |
| 670 | Ga0395905_0054282 | 3300037471 | Bacteria | 3750 |
| 671 | Ga0395905_0054640 | 3300037471 | Bacteria | 3737 |
| 672 | Ga0395905_0057256 | 3300037471 | Bacteria | 3646 |
| 673 | Ga0395905_0058650 | 3300037471 | Bacteria | 3599 |
| 674 | Ga0395905_0107873 | 3300037471 | Bacteria | 2614 |
| 675 | Ga0395905_0116181 | 3300037471 | Bacteria | 2515 |
| 676 | Ga0395905_0491054 | 3300037471 | Bacteria | 1127 |
| 677 | Ga0395905_0521312 | 3300037471 | Bacteria | 1089 |
| 678 | Ga0395905_0562541 | 3300037471 | Bacteria | 1041 |
| 679 | Ga0395905_0845200 | 3300037471 | Bacteria | 818 |
| 680 | Ga0395905_1149910 | 3300037471 | Bacteria | 679 |
| 681 | Ga0395905_1391864 | 3300037471 | Bacteria | 605 |
| 682 | Ga0395905_1508981 | 3300037471 | Unclassified | 576 |
| 683 | Ga0436364_0279375 | 3300037853 | Bacteria | 1060 |
| 684 | Ga0436364_0544140 | 3300037853 | Bacteria | 2277 |
| 685 | Ga0395901_0024874 | 3300038443 | Bacteria | 6146 |
| 686 | Ga0395901_0057025 | 3300038443 | Bacteria | 4063 |
| 687 | Ga0395901_0083360 | 3300038443 | Bacteria | 3341 |
| 688 | Ga0395901_0083426 | 3300038443 | Bacteria | 3340 |
| 689 | Ga0395901_0158555 | 3300038443 | Bacteria | 2376 |
| 690 | Ga0395901_0187206 | 3300038443 | Bacteria | 2171 |
| 691 | Ga0395901_0282145 | 3300038443 | Bacteria | 1725 |
| 692 | Ga0395901_0366533 | 3300038443 | Bacteria | 1484 |
| 693 | Ga0395901_0368050 | 3300038443 | Bacteria | 1481 |
| 694 | Ga0395901_0514020 | 3300038443 | Bacteria | 1217 |
| 695 | Ga0395901_0626808 | 3300038443 | Bacteria | 1081 |
| 696 | Ga0395901_0901023 | 3300038443 | Bacteria | 866 |
| 697 | Ga0395901_1169261 | 3300038443 | Bacteria | 736 |
| 698 | Ga0395901_1517650 | 3300038443 | Bacteria | 625 |
| 699 | Ga0395901_1541995 | 3300038443 | Unclassified | 619 |
| 700 | Ga0436365_1573894 | 3300039437 | Bacteria | 40649 |
| 701 | Ga0436363_0981132 | 3300039450 | Bacteria | 4088 |
| 702 | Ga0436363_1083017 | 3300039450 | Bacteria | 519 |
| 703 | Ga0451791_1088308 | 3300041451 | Bacteria | 561 |
| 704 | Ga0451807_1979107 | 3300041486 | Unclassified | 625 |
| 705 | Ga0451853_2615642 | 3300041512 | Unclassified | 531 |
| 706 | Ga0439445_0008474 | 3300042004 | Bacteria | 2405 |
| 707 | Ga0439432_010454 | 3300042006 | Bacteria | 3211 |
| 708 | Ga0466969_0003975 | 3300044656 | Bacteria | 7850 |
| 709 | Ga0466972_0060729 | 3300044658 | Bacteria | 1813 |
| 710 | Ga0466972_0169829 | 3300044658 | Unclassified | 1024 |
| 711 | Ga0466972_0468196 | 3300044658 | Bacteria | 592 |
| 712 | Ga0466965_0151320 | 3300044683 | Bacteria | 1213 |
| 713 | Ga0466966_0001822 | 3300044684 | Bacteria | 13822 |
| 714 | Ga0466966_0041887 | 3300044684 | Bacteria | 2941 |
| 715 | Ga0466966_0400081 | 3300044684 | Unclassified | 825 |
| 716 | Ga0466966_0478893 | 3300044684 | Bacteria | 748 |
| 717 | Ga0466961_0029516 | 3300044693 | Bacteria | 3524 |
| 718 | Ga0466961_0177851 | 3300044693 | Bacteria | 1322 |
| 719 | Ga0466963_0013039 | 3300044694 | Bacteria | 5096 |
| 720 | Ga0466963_0030059 | 3300044694 | Bacteria | 3502 |
| 721 | Ga0466963_0033198 | 3300044694 | Bacteria | 3348 |
| 722 | Ga0466963_0401227 | 3300044694 | Bacteria | 967 |
| 723 | Ga0466963_1244149 | 3300044694 | Unclassified | 523 |
| 724 | Ga0466964_0028821 | 3300044706 | Bacteria | 2189 |
| 725 | Ga0466964_0527626 | 3300044706 | Unclassified | 638 |
| 726 | Ga0466964_0794791 | 3300044706 | Unclassified | 534 |
| 727 | Ga0466971_0018868 | 3300044719 | Bacteria | 3058 |
| 728 | Ga0466971_0222631 | 3300044719 | Unclassified | 895 |
| 729 | Ga0466968_0043339 | 3300044735 | Bacteria | 1904 |
| 730 | Ga0466968_0252339 | 3300044735 | Unclassified | 838 |
| 731 | Ga0466968_0460538 | 3300044735 | Unclassified | 630 |
| 732 | Ga0466970_0009359 | 3300044765 | Bacteria | 4949 |
| 733 | Ga0466970_0012994 | 3300044765 | Bacteria | 4265 |
| 734 | Ga0466970_0137718 | 3300044765 | Unclassified | 1343 |
| 735 | Ga0466970_0190738 | 3300044765 | Bacteria | 1139 |
| 736 | Ga0466970_0694615 | 3300044765 | Bacteria | 593 |
| 737 | Ga0466957_0005294 | 3300044842 | Bacteria | 7230 |
| 738 | Ga0466957_0111514 | 3300044842 | Bacteria | 1735 |
| 739 | Ga0466957_0162775 | 3300044842 | Unclassified | 1450 |
| 740 | Ga0466960_0007103 | 3300044901 | Bacteria | 4528 |
| 741 | Ga0466960_0156275 | 3300044901 | Bacteria | 1222 |
| 742 | Ga0466960_0672063 | 3300044901 | Unclassified | 619 |
| 743 | Ga0466959_0031205 | 3300045049 | Bacteria | 3943 |
| 744 | Ga0466959_0087402 | 3300045049 | Bacteria | 2242 |
| 745 | Ga0466959_0447866 | 3300045049 | Bacteria | 875 |
| 746 | Ga0466959_0760979 | 3300045049 | Unclassified | 648 |
| 747 | Ga0466958_0008311 | 3300045836 | Bacteria | 5747 |
| 748 | Ga0466958_0066608 | 3300045836 | Bacteria | 2199 |
| 749 | Ga0466958_0804440 | 3300045836 | Bacteria | 613 |
| 750 | Ga0466967_0058604 | 3300045976 | Bacteria | 3404 |
| 751 | Ga0466967_0210372 | 3300045976 | Bacteria | 1844 |
| 752 | Ga0466967_0263853 | 3300045976 | Bacteria | 1648 |
| 753 | Ga0466967_0289552 | 3300045976 | Bacteria | 1573 |
| 754 | Ga0466967_0472157 | 3300045976 | Bacteria | 1228 |
| 755 | Ga0466967_0816901 | 3300045976 | Bacteria | 926 |
| 756 | Ga0466967_0876677 | 3300045976 | Bacteria | 892 |
| 757 | Ga0495642_0372244 | 3300046528 | Unclassified | 629 |
| 758 | Ga0495587_0372038 | 3300046536 | Unclassified | 795 |
| 759 | Ga0495621_0019365 | 3300046539 | Bacteria | 2222 |
| 760 | Ga0495667_0375645 | 3300046559 | Unclassified | 897 |
| 761 | Ga0495667_0377669 | 3300046559 | Unclassified | 894 |
| 762 | Ga0495668_0621981 | 3300046616 | Bacteria | 597 |
| 763 | Ga0495599_0803156 | 3300046678 | Unclassified | 537 |
| 764 | Ga0495669_0063753 | 3300046684 | Bacteria | 1672 |
| 765 | Ga0495669_0550405 | 3300046684 | Unclassified | 561 |
| 766 | Ga0495670_0262392 | 3300046691 | Bacteria | 922 |
| 767 | Ga0495675_0181879 | 3300047444 | Unclassified | 1287 |
| 768 | Ga0495677_0213325 | 3300047445 | Bacteria | 751 |
| 769 | Ga0496100_1656223 | 3300048903 | Unclassified | 506 |
| 770 | Ga0496102_0111311 | 3300048905 | Bacteria | 2553 |
| 771 | Ga0496103_0034177 | 3300048906 | Bacteria | 3109 |
| 772 | Ga0496106_0625856 | 3300048909 | Bacteria | 861 |
| 773 | Ga0496106_0799005 | 3300048909 | Unclassified | 748 |
| 774 | Ga0496107_0046892 | 3300048910 | Bacteria | 3111 |
| 775 | Ga0496107_0351342 | 3300048910 | Bacteria | 1097 |
| 776 | Ga0496107_0713653 | 3300048910 | Unclassified | 737 |
| 777 | Ga0496107_1027817 | 3300048910 | Unclassified | 597 |
| 778 | Ga0496107_1133145 | 3300048910 | Unclassified | 564 |
| 779 | Ga0496108_0035706 | 3300048911 | Bacteria | 4133 |
| 780 | Ga0496108_0745366 | 3300048911 | Bacteria | 847 |
| 781 | Ga0496108_0936326 | 3300048911 | Bacteria | 742 |
| 782 | Ga0496109_0004188 | 3300048912 | Bacteria | 12033 |
| 783 | Ga0496109_0055116 | 3300048912 | Bacteria | 3627 |
| 784 | Ga0496109_0244208 | 3300048912 | Unclassified | 1690 |
| 785 | Ga0496110_0026346 | 3300048913 | Bacteria | 4974 |
| 786 | Ga0496110_0317165 | 3300048913 | Bacteria | 1420 |
| 787 | Ga0496110_0596932 | 3300048913 | Unclassified | 1002 |
| 788 | Ga0496110_1110834 | 3300048913 | Unclassified | 699 |
| 789 | Ga0496111_0089167 | 3300048914 | Bacteria | 2259 |
| 790 | Ga0496111_0199170 | 3300048914 | Bacteria | 1489 |
| 791 | Ga0496111_0250037 | 3300048914 | Bacteria | 1316 |
| 792 | Ga0496112_0030806 | 3300048915 | Bacteria | 5196 |
| 793 | Ga0496112_0036909 | 3300048915 | Bacteria | 4768 |
| 794 | Ga0496112_0058370 | 3300048915 | Bacteria | 3800 |
| 795 | Ga0496113_0110084 | 3300048916 | Bacteria | 2143 |
| 796 | Ga0496113_0182481 | 3300048916 | Bacteria | 1664 |
| 797 | Ga0501293_005423 | 3300049516 | Bacteria | 1024 |
| 798 | Ga0501068_0167668 | 3300049584 | Bacteria | 1385 |
| 799 | Ga0501216_088814 | 3300049660 | Bacteria | 665 |
| 800 | Ga0501217_340245 | 3300049661 | Unclassified | 503 |
| 801 | Ga0501242_039379 | 3300049674 | Unclassified | 664 |
| 802 | Ga0501080_1247613 | 3300049742 | Unclassified | 638 |
| 803 | Ga0501269_051370 | 3300049766 | Bacteria | 568 |
| 804 | Ga0501204_028731 | 3300049850 | Unclassified | 763 |
| 805 | Ga0495619_0377285 | 3300053085 | Bacteria | 980 |
| 806 | Ga0501082_0203467 | 3300060353 | Unclassified | 1723 |
| 807 | Ga0466962_0012689 | 3300061719 | Bacteria | 4053 |
| 808 | Ga0466962_0598700 | 3300061719 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10100250 | Ga0105240_101002506 | 75 |
| 2 | 3300025913 | Ga0207695_10011732 | Ga0207695_100117327 | 75 |
| 3 | 3300005834 | Ga0068851_10800478 | Ga0068851_108004782 | 77 |
| 4 | 3300009094 | Ga0111539_12712655 | Ga0111539_127126552 | 78 |
| 5 | 3300049766 | Ga0501269_051370 | Ga0501269_051370_11_250 | 79 |
| 6 | 3300014326 | Ga0157380_10869011 | Ga0157380_108690113 | 80 |
| 7 | 3300046684 | Ga0495669_0063753 | Ga0495669_0063753_11_256 | 81 |
| 8 | iso_pu_bacteria | 8056967851 | 8056975693 | 81 |
| 9 | 3300049584 | Ga0501068_0167668 | Ga0501068_0167668_743_1021 | 83 |
| 10 | 3300003323 | rootH1_10157953 | rootH1_101579534 | 85 |
| 11 | 3300031548 | Ga0307408_100316481 | Ga0307408_1003164813 | 85 |
| 12 | 3300031731 | Ga0307405_10189910 | Ga0307405_101899102 | 85 |
| 13 | 3300031731 | Ga0307405_11688891 | Ga0307405_116888912 | 85 |
| 14 | 3300032002 | Ga0307416_101282301 | Ga0307416_1012823012 | 85 |
| 15 | 3300044842 | Ga0466957_0111514 | Ga0466957_0111514_1378_1635 | 85 |
| 16 | 3300005335 | Ga0070666_10105056 | Ga0070666_101050564 | 87 |
| 17 | 3300021377 | Ga0213874_10011211 | Ga0213874_100112112 | 87 |
| 18 | 3300021384 | Ga0213876_10000252 | Ga0213876_1000025223 | 87 |
| 19 | 3300025903 | Ga0207680_10108269 | Ga0207680_101082694 | 87 |
| 20 | 3300025924 | Ga0207694_10836312 | Ga0207694_108363122 | 87 |
| 21 | 3300025941 | Ga0207711_10190060 | Ga0207711_101900604 | 87 |
| 22 | 3300028379 | Ga0268266_11836538 | Ga0268266_118365382 | 87 |
| 23 | 3300037853 | Ga0436364_0279375 | Ga0436364_0279375_387_650 | 87 |
| 24 | 3300037853 | Ga0436364_0544140 | Ga0436364_0544140_14_277 | 87 |
| 25 | 3300039437 | Ga0436365_1573894 | Ga0436365_1573894_27982_28245 | 87 |
| 26 | 3300039450 | Ga0436363_0981132 | Ga0436363_0981132_2350_2613 | 87 |
| 27 | 3300039450 | Ga0436363_1083017 | Ga0436363_1083017_63_326 | 87 |
| 28 | 3300005436 | Ga0070713_100462693 | Ga0070713_1004626934 | 88 |
| 29 | 3300005563 | Ga0068855_100465585 | Ga0068855_1004655853 | 88 |
| 30 | 3300006846 | Ga0075430_100671514 | Ga0075430_1006715143 | 88 |
| 31 | 3300009093 | Ga0105240_10095158 | Ga0105240_100951582 | 88 |
| 32 | 3300009545 | Ga0105237_12196328 | Ga0105237_121963282 | 88 |
| 33 | 3300009551 | Ga0105238_10001904 | Ga0105238_1000190425 | 88 |
| 34 | 3300013307 | Ga0157372_10672971 | Ga0157372_106729711 | 88 |
| 35 | 3300025898 | Ga0207692_10122221 | Ga0207692_101222212 | 88 |
| 36 | 3300025914 | Ga0207671_10229107 | Ga0207671_102291073 | 88 |
| 37 | 3300025924 | Ga0207694_10048486 | Ga0207694_100484865 | 88 |
| 38 | 3300035118 | Ga0373954_0634977 | Ga0373954_0634977_222_488 | 88 |
| 39 | 3300035119 | Ga0373956_0244655 | Ga0373956_0244655_456_722 | 88 |
| 40 | 3300035119 | Ga0373956_0606019 | Ga0373956_0606019_98_364 | 88 |
| 41 | 3300035172 | Ga0373955_0407706 | Ga0373955_0407706_536_802 | 88 |
| 42 | 3300035724 | Ga0373933_0088697 | Ga0373933_0088697_673_939 | 88 |
| 43 | 3300036401 | Ga0373937_0002021 | Ga0373937_0002021_10083_10349 | 88 |
| 44 | 3300036401 | Ga0373937_0106446 | Ga0373937_0106446_508_774 | 88 |
| 45 | 3300037068 | Ga0373925_1220972 | Ga0373925_1220972_31_297 | 88 |
| 46 | 3300046536 | Ga0495587_0372038 | Ga0495587_0372038_291_557 | 88 |
| 47 | 3300046559 | Ga0495667_0375645 | Ga0495667_0375645_250_516 | 88 |
| 48 | 3300046559 | Ga0495667_0377669 | Ga0495667_0377669_246_512 | 88 |
| 49 | 3300046678 | Ga0495599_0803156 | Ga0495599_0803156_197_463 | 88 |
| 50 | 3300047444 | Ga0495675_0181879 | Ga0495675_0181879_205_471 | 88 |
| 51 | 3300053085 | Ga0495619_0377285 | Ga0495619_0377285_632_898 | 88 |
| 52 | 3300035724 | Ga0373933_0786815 | Ga0373933_0786815_229_501 | 89 |
| 53 | 3300036401 | Ga0373937_1327239 | Ga0373937_1327239_261_533 | 89 |
| 54 | 3300036401 | Ga0373937_1658272 | Ga0373937_1658272_83_355 | 89 |
| 55 | 3300044901 | Ga0466960_0156275 | Ga0466960_0156275_531_800 | 89 |
| 56 | 3300049742 | Ga0501080_1247613 | Ga0501080_1247613_90_359 | 89 |
| 57 | 3300060353 | Ga0501082_0203467 | Ga0501082_0203467_480_749 | 89 |
| 58 | 3300005327 | Ga0070658_10024710 | Ga0070658_100247102 | 90 |
| 59 | 3300005347 | Ga0070668_100236045 | Ga0070668_1002360453 | 90 |
| 60 | 3300005366 | Ga0070659_100713677 | Ga0070659_1007136772 | 90 |
| 61 | 3300005367 | Ga0070667_100002368 | Ga0070667_10000236813 | 90 |
| 62 | 3300005530 | Ga0070679_100588432 | Ga0070679_1005884322 | 90 |
| 63 | 3300005530 | Ga0070679_101311004 | Ga0070679_1013110041 | 90 |
| 64 | 3300005535 | Ga0070684_100821632 | Ga0070684_1008216322 | 90 |
| 65 | 3300005548 | Ga0070665_100002076 | Ga0070665_10000207618 | 90 |
| 66 | 3300005548 | Ga0070665_100556726 | Ga0070665_1005567264 | 90 |
| 67 | 3300005578 | Ga0068854_100316408 | Ga0068854_1003164082 | 90 |
| 68 | 3300005614 | Ga0068856_102433070 | Ga0068856_1024330702 | 90 |
| 69 | 3300005616 | Ga0068852_100789884 | Ga0068852_1007898843 | 90 |
| 70 | 3300005719 | Ga0068861_102683897 | Ga0068861_1026838972 | 90 |
| 71 | 3300005844 | Ga0068862_100020659 | Ga0068862_1000206597 | 90 |
| 72 | 3300006946 | Ga0079104_1048787 | Ga0079104_10487872 | 90 |
| 73 | 3300009101 | Ga0105247_10889170 | Ga0105247_108891702 | 90 |
| 74 | 3300009177 | Ga0105248_10205694 | Ga0105248_102056943 | 90 |
| 75 | 3300009551 | Ga0105238_10286464 | Ga0105238_102864643 | 90 |
| 76 | 3300013100 | Ga0157373_10625052 | Ga0157373_106250522 | 90 |
| 77 | 3300014325 | Ga0163163_10855137 | Ga0163163_108551371 | 90 |
| 78 | 3300025909 | Ga0207705_10020766 | Ga0207705_100207663 | 90 |
| 79 | 3300025912 | Ga0207707_10589459 | Ga0207707_105894592 | 90 |
| 80 | 3300025920 | Ga0207649_11618885 | Ga0207649_116188852 | 90 |
| 81 | 3300025921 | Ga0207652_11240644 | Ga0207652_112406442 | 90 |
| 82 | 3300025924 | Ga0207694_10227060 | Ga0207694_102270603 | 90 |
| 83 | 3300025932 | Ga0207690_11244770 | Ga0207690_112447701 | 90 |
| 84 | 3300025933 | Ga0207706_10081080 | Ga0207706_100810805 | 90 |
| 85 | 3300025941 | Ga0207711_10136228 | Ga0207711_101362283 | 90 |
| 86 | 3300025972 | Ga0207668_10000010 | Ga0207668_10000010171 | 90 |
| 87 | 3300025986 | Ga0207658_10004019 | Ga0207658_100040192 | 90 |
| 88 | 3300026142 | Ga0207698_10624213 | Ga0207698_106242132 | 90 |
| 89 | 3300027111 | Ga0209281_1063974 | Ga0209281_10639741 | 90 |
| 90 | 3300027378 | Ga0209981_1015381 | Ga0209981_10153812 | 90 |
| 91 | 3300027614 | Ga0209970_1049701 | Ga0209970_10497011 | 90 |
| 92 | 3300027665 | Ga0209983_1089699 | Ga0209983_10896992 | 90 |
| 93 | 3300028379 | Ga0268266_10001182 | Ga0268266_1000118229 | 90 |
| 94 | 3300028379 | Ga0268266_10077345 | Ga0268266_100773454 | 90 |
| 95 | 3300028380 | Ga0268265_10009628 | Ga0268265_100096285 | 90 |
| 96 | 3300031548 | Ga0307408_100055059 | Ga0307408_1000550593 | 90 |
| 97 | 3300031731 | Ga0307405_10076710 | Ga0307405_100767104 | 90 |
| 98 | 3300031824 | Ga0307413_10301444 | Ga0307413_103014443 | 90 |
| 99 | 3300031852 | Ga0307410_10241895 | Ga0307410_102418953 | 90 |
| 100 | 3300031901 | Ga0307406_10032078 | Ga0307406_100320783 | 90 |
| 101 | 3300031903 | Ga0307407_10278640 | Ga0307407_102786403 | 90 |
| 102 | 3300031911 | Ga0307412_10048386 | Ga0307412_100483863 | 90 |
| 103 | 3300031995 | Ga0307409_100367523 | Ga0307409_1003675233 | 90 |
| 104 | 3300032002 | Ga0307416_100411372 | Ga0307416_1004113724 | 90 |
| 105 | 3300032004 | Ga0307414_10224282 | Ga0307414_102242822 | 90 |
| 106 | 3300032005 | Ga0307411_10138656 | Ga0307411_101386561 | 90 |
| 107 | 3300032126 | Ga0307415_100153682 | Ga0307415_1001536823 | 90 |
| 108 | 3300037312 | Ga0395899_0079490 | Ga0395899_0079490_193_465 | 90 |
| 109 | 3300037312 | Ga0395899_0094335 | Ga0395899_0094335_1365_1637 | 90 |
| 110 | 3300037312 | Ga0395899_0238139 | Ga0395899_0238139_301_573 | 90 |
| 111 | 3300037418 | Ga0395900_0026006 | Ga0395900_0026006_5033_5305 | 90 |
| 112 | 3300037418 | Ga0395900_0573773 | Ga0395900_0573773_734_1006 | 90 |
| 113 | 3300037466 | Ga0395898_0064883 | Ga0395898_0064883_2969_3241 | 90 |
| 114 | 3300037466 | Ga0395898_0165002 | Ga0395898_0165002_403_675 | 90 |
| 115 | 3300037466 | Ga0395898_1366445 | Ga0395898_1366445_62_334 | 90 |
| 116 | 3300037471 | Ga0395905_0022646 | Ga0395905_0022646_3626_3898 | 90 |
| 117 | 3300037471 | Ga0395905_0032485 | Ga0395905_0032485_776_1048 | 90 |
| 118 | 3300037471 | Ga0395905_0049175 | Ga0395905_0049175_2361_2633 | 90 |
| 119 | 3300037471 | Ga0395905_0057256 | Ga0395905_0057256_2288_2560 | 90 |
| 120 | 3300038443 | Ga0395901_0187206 | Ga0395901_0187206_426_698 | 90 |
| 121 | 3300038443 | Ga0395901_0514020 | Ga0395901_0514020_551_823 | 90 |
| 122 | 3300038443 | Ga0395901_1169261 | Ga0395901_1169261_70_342 | 90 |
| 123 | 3300044735 | Ga0466968_0252339 | Ga0466968_0252339_459_731 | 90 |
| 124 | 3300044765 | Ga0466970_0190738 | Ga0466970_0190738_509_781 | 90 |
| 125 | 3300001904 | JGI24736J21556_1000382 | JGI24736J21556_10003824 | 91 |
| 126 | 3300001915 | JGI24741J21665_1049254 | JGI24741J21665_10492541 | 91 |
| 127 | 3300001979 | JGI24740J21852_10006215 | JGI24740J21852_100062154 | 91 |
| 128 | 3300001989 | JGI24739J22299_10006988 | JGI24739J22299_100069883 | 91 |
| 129 | 3300001990 | JGI24737J22298_10044515 | JGI24737J22298_100445154 | 91 |
| 130 | 3300001990 | JGI24737J22298_10085416 | JGI24737J22298_100854162 | 91 |
| 131 | 3300001991 | JGI24743J22301_10007929 | JGI24743J22301_100079293 | 91 |
| 132 | 3300002075 | JGI24738J21930_10100948 | JGI24738J21930_101009481 | 91 |
| 133 | 3300003323 | rootH1_10152419 | rootH1_101524193 | 91 |
| 134 | 3300005293 | Ga0065715_10650600 | Ga0065715_106506002 | 91 |
| 135 | 3300005327 | Ga0070658_10394351 | Ga0070658_103943511 | 91 |
| 136 | 3300005327 | Ga0070658_10406753 | Ga0070658_104067532 | 91 |
| 137 | 3300005327 | Ga0070658_11274764 | Ga0070658_112747641 | 91 |
| 138 | 3300005328 | Ga0070676_10207660 | Ga0070676_102076602 | 91 |
| 139 | 3300005329 | Ga0070683_100349142 | Ga0070683_1003491422 | 91 |
| 140 | 3300005329 | Ga0070683_101015834 | Ga0070683_1010158342 | 91 |
| 141 | 3300005330 | Ga0070690_101717688 | Ga0070690_1017176882 | 91 |
| 142 | 3300005331 | Ga0070670_100158275 | Ga0070670_1001582753 | 91 |
| 143 | 3300005335 | Ga0070666_10104009 | Ga0070666_101040093 | 91 |
| 144 | 3300005335 | Ga0070666_10248030 | Ga0070666_102480303 | 91 |
| 145 | 3300005336 | Ga0070680_100850939 | Ga0070680_1008509392 | 91 |
| 146 | 3300005336 | Ga0070680_100948711 | Ga0070680_1009487111 | 91 |
| 147 | 3300005337 | Ga0070682_100196997 | Ga0070682_1001969974 | 91 |
| 148 | 3300005338 | Ga0068868_101362035 | Ga0068868_1013620351 | 91 |
| 149 | 3300005339 | Ga0070660_100018065 | Ga0070660_1000180653 | 91 |
| 150 | 3300005339 | Ga0070660_100067006 | Ga0070660_1000670065 | 91 |
| 151 | 3300005339 | Ga0070660_100327635 | Ga0070660_1003276352 | 91 |
| 152 | 3300005339 | Ga0070660_100681345 | Ga0070660_1006813453 | 91 |
| 153 | 3300005344 | Ga0070661_100027889 | Ga0070661_1000278892 | 91 |
| 154 | 3300005344 | Ga0070661_100113884 | Ga0070661_1001138843 | 91 |
| 155 | 3300005344 | Ga0070661_100287256 | Ga0070661_1002872562 | 91 |
| 156 | 3300005344 | Ga0070661_100660041 | Ga0070661_1006600412 | 91 |
| 157 | 3300005355 | Ga0070671_100087676 | Ga0070671_1000876765 | 91 |
| 158 | 3300005355 | Ga0070671_100726234 | Ga0070671_1007262342 | 91 |
| 159 | 3300005364 | Ga0070673_100023615 | Ga0070673_1000236153 | 91 |
| 160 | 3300005366 | Ga0070659_100007212 | Ga0070659_1000072123 | 91 |
| 161 | 3300005366 | Ga0070659_100724465 | Ga0070659_1007244652 | 91 |
| 162 | 3300005367 | Ga0070667_100000842 | Ga0070667_10000084238 | 91 |
| 163 | 3300005455 | Ga0070663_100030813 | Ga0070663_1000308135 | 91 |
| 164 | 3300005455 | Ga0070663_100357834 | Ga0070663_1003578341 | 91 |
| 165 | 3300005455 | Ga0070663_101704488 | Ga0070663_1017044881 | 91 |
| 166 | 3300005457 | Ga0070662_100006841 | Ga0070662_1000068416 | 91 |
| 167 | 3300005457 | Ga0070662_100445387 | Ga0070662_1004453872 | 91 |
| 168 | 3300005530 | Ga0070679_100250873 | Ga0070679_1002508734 | 91 |
| 169 | 3300005535 | Ga0070684_100189185 | Ga0070684_1001891851 | 91 |
| 170 | 3300005535 | Ga0070684_101647831 | Ga0070684_1016478311 | 91 |
| 171 | 3300005539 | Ga0068853_100227657 | Ga0068853_1002276573 | 91 |
| 172 | 3300005539 | Ga0068853_100612475 | Ga0068853_1006124751 | 91 |
| 173 | 3300005548 | Ga0070665_100009746 | Ga0070665_1000097464 | 91 |
| 174 | 3300005563 | Ga0068855_100060863 | Ga0068855_1000608632 | 91 |
| 175 | 3300005563 | Ga0068855_100204771 | Ga0068855_1002047712 | 91 |
| 176 | 3300005563 | Ga0068855_100741020 | Ga0068855_1007410203 | 91 |
| 177 | 3300005563 | Ga0068855_101404228 | Ga0068855_1014042282 | 91 |
| 178 | 3300005564 | Ga0070664_100138010 | Ga0070664_1001380103 | 91 |
| 179 | 3300005577 | Ga0068857_100188969 | Ga0068857_1001889695 | 91 |
| 180 | 3300005578 | Ga0068854_100008303 | Ga0068854_1000083031 | 91 |
| 181 | 3300005578 | Ga0068854_100011084 | Ga0068854_1000110849 | 91 |
| 182 | 3300005578 | Ga0068854_100337153 | Ga0068854_1003371532 | 91 |
| 183 | 3300005578 | Ga0068854_100470361 | Ga0068854_1004703614 | 91 |
| 184 | 3300005614 | Ga0068856_100011210 | Ga0068856_10001121011 | 91 |
| 185 | 3300005614 | Ga0068856_100301739 | Ga0068856_1003017392 | 91 |
| 186 | 3300005614 | Ga0068856_100771310 | Ga0068856_1007713102 | 91 |
| 187 | 3300005614 | Ga0068856_100978710 | Ga0068856_1009787103 | 91 |
| 188 | 3300005616 | Ga0068852_100004297 | Ga0068852_1000042972 | 91 |
| 189 | 3300005616 | Ga0068852_100232084 | Ga0068852_1002320844 | 91 |
| 190 | 3300005616 | Ga0068852_100257478 | Ga0068852_1002574783 | 91 |
| 191 | 3300005616 | Ga0068852_100822797 | Ga0068852_1008227974 | 91 |
| 192 | 3300006358 | Ga0068871_101688605 | Ga0068871_1016886052 | 91 |
| 193 | 3300009093 | Ga0105240_10127198 | Ga0105240_101271982 | 91 |
| 194 | 3300009093 | Ga0105240_10334650 | Ga0105240_103346505 | 91 |
| 195 | 3300009093 | Ga0105240_11219910 | Ga0105240_112199102 | 91 |
| 196 | 3300009093 | Ga0105240_12069201 | Ga0105240_120692011 | 91 |
| 197 | 3300009174 | Ga0105241_10472204 | Ga0105241_104722044 | 91 |
| 198 | 3300009177 | Ga0105248_10064040 | Ga0105248_100640404 | 91 |
| 199 | 3300009545 | Ga0105237_10134559 | Ga0105237_101345596 | 91 |
| 200 | 3300009551 | Ga0105238_10096544 | Ga0105238_100965445 | 91 |
| 201 | 3300010375 | Ga0105239_10776122 | Ga0105239_107761221 | 91 |
| 202 | 3300010375 | Ga0105239_11470741 | Ga0105239_114707411 | 91 |
| 203 | 3300013100 | Ga0157373_10090777 | Ga0157373_100907774 | 91 |
| 204 | 3300013100 | Ga0157373_10213658 | Ga0157373_102136584 | 91 |
| 205 | 3300013100 | Ga0157373_10298860 | Ga0157373_102988602 | 91 |
| 206 | 3300013100 | Ga0157373_11544602 | Ga0157373_115446022 | 91 |
| 207 | 3300013102 | Ga0157371_10102338 | Ga0157371_101023384 | 91 |
| 208 | 3300013102 | Ga0157371_10436944 | Ga0157371_104369441 | 91 |
| 209 | 3300013102 | Ga0157371_11267875 | Ga0157371_112678752 | 91 |
| 210 | 3300013104 | Ga0157370_10725281 | Ga0157370_107252812 | 91 |
| 211 | 3300013104 | Ga0157370_11053957 | Ga0157370_110539572 | 91 |
| 212 | 3300013105 | Ga0157369_10000106 | Ga0157369_1000010665 | 91 |
| 213 | 3300013105 | Ga0157369_10049843 | Ga0157369_100498432 | 91 |
| 214 | 3300013105 | Ga0157369_10203373 | Ga0157369_102033735 | 91 |
| 215 | 3300013105 | Ga0157369_10996497 | Ga0157369_109964973 | 91 |
| 216 | 3300013296 | Ga0157374_10055319 | Ga0157374_100553193 | 91 |
| 217 | 3300013307 | Ga0157372_10712592 | Ga0157372_107125924 | 91 |
| 218 | 3300013307 | Ga0157372_10965571 | Ga0157372_109655711 | 91 |
| 219 | 3300013307 | Ga0157372_12602767 | Ga0157372_126027672 | 91 |
| 220 | 3300025903 | Ga0207680_10055355 | Ga0207680_100553553 | 91 |
| 221 | 3300025904 | Ga0207647_10056487 | Ga0207647_100564876 | 91 |
| 222 | 3300025904 | Ga0207647_10113491 | Ga0207647_101134913 | 91 |
| 223 | 3300025904 | Ga0207647_10276370 | Ga0207647_102763702 | 91 |
| 224 | 3300025907 | Ga0207645_10388657 | Ga0207645_103886572 | 91 |
| 225 | 3300025909 | Ga0207705_10000151 | Ga0207705_1000015125 | 91 |
| 226 | 3300025909 | Ga0207705_10474948 | Ga0207705_104749482 | 91 |
| 227 | 3300025913 | Ga0207695_10002502 | Ga0207695_1000250218 | 91 |
| 228 | 3300025913 | Ga0207695_10033176 | Ga0207695_100331763 | 91 |
| 229 | 3300025913 | Ga0207695_10676261 | Ga0207695_106762614 | 91 |
| 230 | 3300025917 | Ga0207660_10769788 | Ga0207660_107697882 | 91 |
| 231 | 3300025919 | Ga0207657_10006968 | Ga0207657_100069687 | 91 |
| 232 | 3300025919 | Ga0207657_10106702 | Ga0207657_101067023 | 91 |
| 233 | 3300025919 | Ga0207657_10573858 | Ga0207657_105738582 | 91 |
| 234 | 3300025920 | Ga0207649_10007523 | Ga0207649_100075232 | 91 |
| 235 | 3300025920 | Ga0207649_10131760 | Ga0207649_101317605 | 91 |
| 236 | 3300025920 | Ga0207649_10293073 | Ga0207649_102930734 | 91 |
| 237 | 3300025920 | Ga0207649_11523809 | Ga0207649_115238092 | 91 |
| 238 | 3300025921 | Ga0207652_10191918 | Ga0207652_101919182 | 91 |
| 239 | 3300025931 | Ga0207644_10638638 | Ga0207644_106386383 | 91 |
| 240 | 3300025931 | Ga0207644_10853834 | Ga0207644_108538342 | 91 |
| 241 | 3300025932 | Ga0207690_10011217 | Ga0207690_100112173 | 91 |
| 242 | 3300025933 | Ga0207706_10169165 | Ga0207706_101691653 | 91 |
| 243 | 3300025941 | Ga0207711_10729288 | Ga0207711_107292883 | 91 |
| 244 | 3300025944 | Ga0207661_10122260 | Ga0207661_101222605 | 91 |
| 245 | 3300025944 | Ga0207661_11065571 | Ga0207661_110655712 | 91 |
| 246 | 3300025945 | Ga0207679_10362464 | Ga0207679_103624643 | 91 |
| 247 | 3300025949 | Ga0207667_10037667 | Ga0207667_100376672 | 91 |
| 248 | 3300025949 | Ga0207667_10179975 | Ga0207667_101799755 | 91 |
| 249 | 3300025949 | Ga0207667_10239222 | Ga0207667_102392222 | 91 |
| 250 | 3300025960 | Ga0207651_10151990 | Ga0207651_101519903 | 91 |
| 251 | 3300025981 | Ga0207640_10007063 | Ga0207640_100070633 | 91 |
| 252 | 3300025981 | Ga0207640_10013046 | Ga0207640_100130463 | 91 |
| 253 | 3300025981 | Ga0207640_10299579 | Ga0207640_102995792 | 91 |
| 254 | 3300025981 | Ga0207640_10507068 | Ga0207640_105070684 | 91 |
| 255 | 3300025986 | Ga0207658_10076645 | Ga0207658_100766453 | 91 |
| 256 | 3300025986 | Ga0207658_11492494 | Ga0207658_114924942 | 91 |
| 257 | 3300026023 | Ga0207677_10220964 | Ga0207677_102209643 | 91 |
| 258 | 3300026041 | Ga0207639_10496425 | Ga0207639_104964252 | 91 |
| 259 | 3300026041 | Ga0207639_10917284 | Ga0207639_109172842 | 91 |
| 260 | 3300026067 | Ga0207678_10000989 | Ga0207678_1000098923 | 91 |
| 261 | 3300026067 | Ga0207678_10080669 | Ga0207678_100806693 | 91 |
| 262 | 3300026078 | Ga0207702_10005655 | Ga0207702_100056554 | 91 |
| 263 | 3300026078 | Ga0207702_10010126 | Ga0207702_100101263 | 91 |
| 264 | 3300026078 | Ga0207702_10030457 | Ga0207702_100304578 | 91 |
| 265 | 3300026078 | Ga0207702_11330153 | Ga0207702_113301532 | 91 |
| 266 | 3300026116 | Ga0207674_10514666 | Ga0207674_105146663 | 91 |
| 267 | 3300026121 | Ga0207683_10989646 | Ga0207683_109896462 | 91 |
| 268 | 3300026142 | Ga0207698_10002956 | Ga0207698_100029565 | 91 |
| 269 | 3300026142 | Ga0207698_10016415 | Ga0207698_100164158 | 91 |
| 270 | 3300026142 | Ga0207698_10305848 | Ga0207698_103058483 | 91 |
| 271 | 3300026142 | Ga0207698_11294445 | Ga0207698_112944451 | 91 |
| 272 | 3300028379 | Ga0268266_10183778 | Ga0268266_101837785 | 91 |
| 273 | 3300031548 | Ga0307408_100021515 | Ga0307408_1000215156 | 91 |
| 274 | 3300031548 | Ga0307408_100632649 | Ga0307408_1006326492 | 91 |
| 275 | 3300031731 | Ga0307405_10233033 | Ga0307405_102330333 | 91 |
| 276 | 3300031824 | Ga0307413_10876323 | Ga0307413_108763232 | 91 |
| 277 | 3300031824 | Ga0307413_10980425 | Ga0307413_109804252 | 91 |
| 278 | 3300031852 | Ga0307410_10005912 | Ga0307410_100059122 | 91 |
| 279 | 3300031852 | Ga0307410_10373925 | Ga0307410_103739253 | 91 |
| 280 | 3300031852 | Ga0307410_10387373 | Ga0307410_103873733 | 91 |
| 281 | 3300031852 | Ga0307410_10410416 | Ga0307410_104104162 | 91 |
| 282 | 3300031901 | Ga0307406_10168493 | Ga0307406_101684932 | 91 |
| 283 | 3300031901 | Ga0307406_10692311 | Ga0307406_106923112 | 91 |
| 284 | 3300031903 | Ga0307407_10084958 | Ga0307407_100849583 | 91 |
| 285 | 3300031903 | Ga0307407_10487270 | Ga0307407_104872701 | 91 |
| 286 | 3300031903 | Ga0307407_10782182 | Ga0307407_107821822 | 91 |
| 287 | 3300031911 | Ga0307412_10031102 | Ga0307412_100311023 | 91 |
| 288 | 3300031911 | Ga0307412_11496371 | Ga0307412_114963712 | 91 |
| 289 | 3300031911 | Ga0307412_11711862 | Ga0307412_117118622 | 91 |
| 290 | 3300031911 | Ga0307412_11847745 | Ga0307412_118477451 | 91 |
| 291 | 3300031911 | Ga0307412_12151644 | Ga0307412_121516442 | 91 |
| 292 | 3300031995 | Ga0307409_100019126 | Ga0307409_1000191262 | 91 |
| 293 | 3300031995 | Ga0307409_100117826 | Ga0307409_1001178263 | 91 |
| 294 | 3300031995 | Ga0307409_100201397 | Ga0307409_1002013973 | 91 |
| 295 | 3300031995 | Ga0307409_101510266 | Ga0307409_1015102662 | 91 |
| 296 | 3300032002 | Ga0307416_100325149 | Ga0307416_1003251493 | 91 |
| 297 | 3300032002 | Ga0307416_103459952 | Ga0307416_1034599522 | 91 |
| 298 | 3300032004 | Ga0307414_10000536 | Ga0307414_1000053619 | 91 |
| 299 | 3300032004 | Ga0307414_10002526 | Ga0307414_100025263 | 91 |
| 300 | 3300032004 | Ga0307414_10266169 | Ga0307414_102661693 | 91 |
| 301 | 3300032005 | Ga0307411_10032212 | Ga0307411_100322124 | 91 |
| 302 | 3300032005 | Ga0307411_10079151 | Ga0307411_100791513 | 91 |
| 303 | 3300032005 | Ga0307411_10084871 | Ga0307411_100848713 | 91 |
| 304 | 3300032005 | Ga0307411_10723194 | Ga0307411_107231943 | 91 |
| 305 | 3300032126 | Ga0307415_100230747 | Ga0307415_1002307472 | 91 |
| 306 | 3300032126 | Ga0307415_100572265 | Ga0307415_1005722653 | 91 |
| 307 | 3300032126 | Ga0307415_101258758 | Ga0307415_1012587582 | 91 |
| 308 | 3300037312 | Ga0395899_0034393 | Ga0395899_0034393_3474_3749 | 91 |
| 309 | 3300037312 | Ga0395899_0037068 | Ga0395899_0037068_2314_2589 | 91 |
| 310 | 3300037312 | Ga0395899_0061730 | Ga0395899_0061730_1311_1586 | 91 |
| 311 | 3300037418 | Ga0395900_0001394 | Ga0395900_0001394_4408_4683 | 91 |
| 312 | 3300037418 | Ga0395900_0057719 | Ga0395900_0057719_1658_1933 | 91 |
| 313 | 3300037418 | Ga0395900_0098145 | Ga0395900_0098145_1154_1429 | 91 |
| 314 | 3300037418 | Ga0395900_0120394 | Ga0395900_0120394_1725_2000 | 91 |
| 315 | 3300037418 | Ga0395900_0419465 | Ga0395900_0419465_392_667 | 91 |
| 316 | 3300037418 | Ga0395900_0499748 | Ga0395900_0499748_198_473 | 91 |
| 317 | 3300037418 | Ga0395900_0565194 | Ga0395900_0565194_506_781 | 91 |
| 318 | 3300037418 | Ga0395900_0611480 | Ga0395900_0611480_249_524 | 91 |
| 319 | 3300037418 | Ga0395900_1052900 | Ga0395900_1052900_206_481 | 91 |
| 320 | 3300037418 | Ga0395900_1483584 | Ga0395900_1483584_229_504 | 91 |
| 321 | 3300037466 | Ga0395898_0024517 | Ga0395898_0024517_5624_5899 | 91 |
| 322 | 3300037466 | Ga0395898_0106743 | Ga0395898_0106743_697_972 | 91 |
| 323 | 3300037466 | Ga0395898_0133757 | Ga0395898_0133757_537_812 | 91 |
| 324 | 3300037466 | Ga0395898_0331733 | Ga0395898_0331733_625_900 | 91 |
| 325 | 3300037466 | Ga0395898_0695901 | Ga0395898_0695901_403_678 | 91 |
| 326 | 3300037471 | Ga0395905_0001106 | Ga0395905_0001106_24151_24426 | 91 |
| 327 | 3300037471 | Ga0395905_0058650 | Ga0395905_0058650_1822_2097 | 91 |
| 328 | 3300037471 | Ga0395905_0116181 | Ga0395905_0116181_1439_1714 | 91 |
| 329 | 3300037471 | Ga0395905_1508981 | Ga0395905_1508981_75_350 | 91 |
| 330 | 3300038443 | Ga0395901_0083426 | Ga0395901_0083426_1944_2219 | 91 |
| 331 | 3300038443 | Ga0395901_0368050 | Ga0395901_0368050_603_878 | 91 |
| 332 | 3300038443 | Ga0395901_0626808 | Ga0395901_0626808_500_775 | 91 |
| 333 | 3300044656 | Ga0466969_0003975 | Ga0466969_0003975_6245_6520 | 91 |
| 334 | 3300044684 | Ga0466966_0001822 | Ga0466966_0001822_1550_1825 | 91 |
| 335 | 3300044693 | Ga0466961_0029516 | Ga0466961_0029516_1452_1727 | 91 |
| 336 | 3300044694 | Ga0466963_0013039 | Ga0466963_0013039_4210_4485 | 91 |
| 337 | 3300044694 | Ga0466963_0030059 | Ga0466963_0030059_2755_3030 | 91 |
| 338 | 3300044694 | Ga0466963_1244149 | Ga0466963_1244149_101_376 | 91 |
| 339 | 3300044706 | Ga0466964_0527626 | Ga0466964_0527626_234_509 | 91 |
| 340 | 3300044719 | Ga0466971_0018868 | Ga0466971_0018868_2186_2461 | 91 |
| 341 | 3300044765 | Ga0466970_0009359 | Ga0466970_0009359_1962_2237 | 91 |
| 342 | 3300044842 | Ga0466957_0005294 | Ga0466957_0005294_6446_6721 | 91 |
| 343 | 3300045049 | Ga0466959_0031205 | Ga0466959_0031205_1236_1511 | 91 |
| 344 | 3300045049 | Ga0466959_0760979 | Ga0466959_0760979_226_501 | 91 |
| 345 | 3300045836 | Ga0466958_0008311 | Ga0466958_0008311_4238_4513 | 91 |
| 346 | 3300045976 | Ga0466967_0472157 | Ga0466967_0472157_384_659 | 91 |
| 347 | 3300048910 | Ga0496107_1133145 | Ga0496107_1133145_271_546 | 91 |
| 348 | 3300048911 | Ga0496108_0745366 | Ga0496108_0745366_442_717 | 91 |
| 349 | 3300048912 | Ga0496109_0244208 | Ga0496109_0244208_958_1233 | 91 |
| 350 | 3300048913 | Ga0496110_1110834 | Ga0496110_1110834_180_455 | 91 |
| 351 | 3300048915 | Ga0496112_0036909 | Ga0496112_0036909_3851_4126 | 91 |
| 352 | 3300048916 | Ga0496113_0110084 | Ga0496113_0110084_358_633 | 91 |
| 353 | 3300049516 | Ga0501293_005423 | Ga0501293_005423_135_413 | 91 |
| 354 | 3300049660 | Ga0501216_088814 | Ga0501216_088814_170_448 | 91 |
| 355 | 3300049661 | Ga0501217_340245 | Ga0501217_340245_173_457 | 91 |
| 356 | 3300049674 | Ga0501242_039379 | Ga0501242_039379_245_526 | 91 |
| 357 | 3300049850 | Ga0501204_028731 | Ga0501204_028731_198_479 | 91 |
| 358 | 3300061719 | Ga0466962_0012689 | Ga0466962_0012689_61_336 | 91 |
| 359 | 2162886012 | MBSR1b_contig_2102004 | MBSR1b_0166.00001860 | 92 |
| 360 | 3300001989 | JGI24739J22299_10001003 | JGI24739J22299_100010034 | 92 |
| 361 | 3300001989 | JGI24739J22299_10079134 | JGI24739J22299_100791342 | 92 |
| 362 | 3300001990 | JGI24737J22298_10000223 | JGI24737J22298_1000022311 | 92 |
| 363 | 3300001990 | JGI24737J22298_10090169 | JGI24737J22298_100901693 | 92 |
| 364 | 3300001990 | JGI24737J22298_10128654 | JGI24737J22298_101286543 | 92 |
| 365 | 3300002075 | JGI24738J21930_10000303 | JGI24738J21930_100003034 | 92 |
| 366 | 3300002075 | JGI24738J21930_10088973 | JGI24738J21930_100889732 | 92 |
| 367 | 3300002077 | JGI24744J21845_10007277 | JGI24744J21845_100072773 | 92 |
| 368 | 3300003320 | rootH2_10095655 | rootH2_100956554 | 92 |
| 369 | 3300005290 | Ga0065712_10077019 | Ga0065712_100770193 | 92 |
| 370 | 3300005290 | Ga0065712_10149958 | Ga0065712_101499583 | 92 |
| 371 | 3300005293 | Ga0065715_10187416 | Ga0065715_101874162 | 92 |
| 372 | 3300005293 | Ga0065715_10191064 | Ga0065715_101910643 | 92 |
| 373 | 3300005327 | Ga0070658_10001899 | Ga0070658_1000189911 | 92 |
| 374 | 3300005327 | Ga0070658_10064279 | Ga0070658_100642795 | 92 |
| 375 | 3300005327 | Ga0070658_10301679 | Ga0070658_103016793 | 92 |
| 376 | 3300005327 | Ga0070658_10954974 | Ga0070658_109549741 | 92 |
| 377 | 3300005327 | Ga0070658_11053300 | Ga0070658_110533001 | 92 |
| 378 | 3300005328 | Ga0070676_10043617 | Ga0070676_100436173 | 92 |
| 379 | 3300005328 | Ga0070676_10652297 | Ga0070676_106522972 | 92 |
| 380 | 3300005329 | Ga0070683_100000257 | Ga0070683_10000025732 | 92 |
| 381 | 3300005331 | Ga0070670_100063911 | Ga0070670_1000639114 | 92 |
| 382 | 3300005331 | Ga0070670_100214979 | Ga0070670_1002149791 | 92 |
| 383 | 3300005331 | Ga0070670_100281742 | Ga0070670_1002817424 | 92 |
| 384 | 3300005331 | Ga0070670_100399333 | Ga0070670_1003993332 | 92 |
| 385 | 3300005331 | Ga0070670_100455929 | Ga0070670_1004559294 | 92 |
| 386 | 3300005333 | Ga0070677_10009276 | Ga0070677_100092765 | 92 |
| 387 | 3300005333 | Ga0070677_10014989 | Ga0070677_100149895 | 92 |
| 388 | 3300005333 | Ga0070677_10027653 | Ga0070677_100276533 | 92 |
| 389 | 3300005333 | Ga0070677_10272529 | Ga0070677_102725291 | 92 |
| 390 | 3300005334 | Ga0068869_100377927 | Ga0068869_1003779272 | 92 |
| 391 | 3300005335 | Ga0070666_10006073 | Ga0070666_100060733 | 92 |
| 392 | 3300005335 | Ga0070666_10109982 | Ga0070666_101099823 | 92 |
| 393 | 3300005335 | Ga0070666_10172968 | Ga0070666_101729683 | 92 |
| 394 | 3300005335 | Ga0070666_10442880 | Ga0070666_104428802 | 92 |
| 395 | 3300005336 | Ga0070680_100028527 | Ga0070680_1000285273 | 92 |
| 396 | 3300005336 | Ga0070680_100499085 | Ga0070680_1004990853 | 92 |
| 397 | 3300005337 | Ga0070682_100199921 | Ga0070682_1001999213 | 92 |
| 398 | 3300005338 | Ga0068868_100132688 | Ga0068868_1001326884 | 92 |
| 399 | 3300005338 | Ga0068868_100682380 | Ga0068868_1006823802 | 92 |
| 400 | 3300005339 | Ga0070660_100005816 | Ga0070660_1000058162 | 92 |
| 401 | 3300005339 | Ga0070660_100026498 | Ga0070660_1000264984 | 92 |
| 402 | 3300005339 | Ga0070660_100090322 | Ga0070660_1000903223 | 92 |
| 403 | 3300005339 | Ga0070660_100147056 | Ga0070660_1001470563 | 92 |
| 404 | 3300005339 | Ga0070660_100152111 | Ga0070660_1001521113 | 92 |
| 405 | 3300005339 | Ga0070660_100583485 | Ga0070660_1005834851 | 92 |
| 406 | 3300005339 | Ga0070660_100779492 | Ga0070660_1007794921 | 92 |
| 407 | 3300005339 | Ga0070660_101212589 | Ga0070660_1012125891 | 92 |
| 408 | 3300005343 | Ga0070687_100664857 | Ga0070687_1006648572 | 92 |
| 409 | 3300005344 | Ga0070661_100000125 | Ga0070661_10000012537 | 92 |
| 410 | 3300005344 | Ga0070661_100028675 | Ga0070661_1000286754 | 92 |
| 411 | 3300005344 | Ga0070661_100071178 | Ga0070661_1000711785 | 92 |
| 412 | 3300005344 | Ga0070661_100418173 | Ga0070661_1004181732 | 92 |
| 413 | 3300005344 | Ga0070661_100683390 | Ga0070661_1006833902 | 92 |
| 414 | 3300005344 | Ga0070661_100803880 | Ga0070661_1008038802 | 92 |
| 415 | 3300005345 | Ga0070692_10450594 | Ga0070692_104505942 | 92 |
| 416 | 3300005347 | Ga0070668_100152130 | Ga0070668_1001521304 | 92 |
| 417 | 3300005353 | Ga0070669_100011961 | Ga0070669_1000119613 | 92 |
| 418 | 3300005353 | Ga0070669_100052346 | Ga0070669_1000523464 | 92 |
| 419 | 3300005353 | Ga0070669_100182366 | Ga0070669_1001823661 | 92 |
| 420 | 3300005353 | Ga0070669_101410519 | Ga0070669_1014105191 | 92 |
| 421 | 3300005354 | Ga0070675_100075980 | Ga0070675_1000759803 | 92 |
| 422 | 3300005354 | Ga0070675_100135338 | Ga0070675_1001353383 | 92 |
| 423 | 3300005354 | Ga0070675_100597647 | Ga0070675_1005976472 | 92 |
| 424 | 3300005354 | Ga0070675_100625660 | Ga0070675_1006256603 | 92 |
| 425 | 3300005354 | Ga0070675_101880954 | Ga0070675_1018809541 | 92 |
| 426 | 3300005355 | Ga0070671_100007875 | Ga0070671_1000078755 | 92 |
| 427 | 3300005355 | Ga0070671_100044630 | Ga0070671_1000446303 | 92 |
| 428 | 3300005355 | Ga0070671_100229044 | Ga0070671_1002290443 | 92 |
| 429 | 3300005355 | Ga0070671_100652246 | Ga0070671_1006522462 | 92 |
| 430 | 3300005356 | Ga0070674_100069469 | Ga0070674_1000694693 | 92 |
| 431 | 3300005356 | Ga0070674_101005025 | Ga0070674_1010050252 | 92 |
| 432 | 3300005364 | Ga0070673_100029392 | Ga0070673_1000293923 | 92 |
| 433 | 3300005364 | Ga0070673_100116633 | Ga0070673_1001166333 | 92 |
| 434 | 3300005364 | Ga0070673_100139071 | Ga0070673_1001390711 | 92 |
| 435 | 3300005364 | Ga0070673_100176106 | Ga0070673_1001761063 | 92 |
| 436 | 3300005364 | Ga0070673_100267164 | Ga0070673_1002671643 | 92 |
| 437 | 3300005366 | Ga0070659_100003922 | Ga0070659_1000039222 | 92 |
| 438 | 3300005366 | Ga0070659_100042839 | Ga0070659_1000428393 | 92 |
| 439 | 3300005366 | Ga0070659_100057553 | Ga0070659_1000575533 | 92 |
| 440 | 3300005366 | Ga0070659_100084231 | Ga0070659_1000842313 | 92 |
| 441 | 3300005366 | Ga0070659_100164859 | Ga0070659_1001648592 | 92 |
| 442 | 3300005366 | Ga0070659_100320488 | Ga0070659_1003204883 | 92 |
| 443 | 3300005366 | Ga0070659_100893336 | Ga0070659_1008933362 | 92 |
| 444 | 3300005367 | Ga0070667_100097434 | Ga0070667_1000974343 | 92 |
| 445 | 3300005367 | Ga0070667_100337612 | Ga0070667_1003376122 | 92 |
| 446 | 3300005455 | Ga0070663_100000234 | Ga0070663_1000002346 | 92 |
| 447 | 3300005455 | Ga0070663_100041985 | Ga0070663_1000419855 | 92 |
| 448 | 3300005455 | Ga0070663_100150922 | Ga0070663_1001509223 | 92 |
| 449 | 3300005455 | Ga0070663_100167182 | Ga0070663_1001671822 | 92 |
| 450 | 3300005455 | Ga0070663_100996109 | Ga0070663_1009961092 | 92 |
| 451 | 3300005455 | Ga0070663_101212781 | Ga0070663_1012127811 | 92 |
| 452 | 3300005456 | Ga0070678_100064422 | Ga0070678_1000644224 | 92 |
| 453 | 3300005456 | Ga0070678_100078428 | Ga0070678_1000784282 | 92 |
| 454 | 3300005456 | Ga0070678_100938109 | Ga0070678_1009381091 | 92 |
| 455 | 3300005457 | Ga0070662_100000010 | Ga0070662_10000001016 | 92 |
| 456 | 3300005457 | Ga0070662_100011566 | Ga0070662_1000115663 | 92 |
| 457 | 3300005457 | Ga0070662_100068657 | Ga0070662_1000686573 | 92 |
| 458 | 3300005457 | Ga0070662_100127922 | Ga0070662_1001279223 | 92 |
| 459 | 3300005457 | Ga0070662_100880328 | Ga0070662_1008803282 | 92 |
| 460 | 3300005459 | Ga0068867_100066654 | Ga0068867_1000666543 | 92 |
| 461 | 3300005530 | Ga0070679_100120675 | Ga0070679_1001206753 | 92 |
| 462 | 3300005530 | Ga0070679_100532960 | Ga0070679_1005329603 | 92 |
| 463 | 3300005530 | Ga0070679_101490132 | Ga0070679_1014901322 | 92 |
| 464 | 3300005535 | Ga0070684_100060078 | Ga0070684_1000600783 | 92 |
| 465 | 3300005539 | Ga0068853_100000715 | Ga0068853_10000071513 | 92 |
| 466 | 3300005539 | Ga0068853_100151679 | Ga0068853_1001516792 | 92 |
| 467 | 3300005539 | Ga0068853_100161067 | Ga0068853_1001610673 | 92 |
| 468 | 3300005539 | Ga0068853_100227344 | Ga0068853_1002273443 | 92 |
| 469 | 3300005539 | Ga0068853_100624565 | Ga0068853_1006245652 | 92 |
| 470 | 3300005543 | Ga0070672_100167415 | Ga0070672_1001674153 | 92 |
| 471 | 3300005543 | Ga0070672_100227542 | Ga0070672_1002275424 | 92 |
| 472 | 3300005543 | Ga0070672_100612275 | Ga0070672_1006122752 | 92 |
| 473 | 3300005547 | Ga0070693_100001081 | Ga0070693_1000010814 | 92 |
| 474 | 3300005547 | Ga0070693_100158693 | Ga0070693_1001586932 | 92 |
| 475 | 3300005547 | Ga0070693_100588207 | Ga0070693_1005882072 | 92 |
| 476 | 3300005548 | Ga0070665_100009733 | Ga0070665_1000097339 | 92 |
| 477 | 3300005548 | Ga0070665_100012827 | Ga0070665_1000128274 | 92 |
| 478 | 3300005563 | Ga0068855_100001909 | Ga0068855_1000019094 | 92 |
| 479 | 3300005563 | Ga0068855_100469011 | Ga0068855_1004690112 | 92 |
| 480 | 3300005563 | Ga0068855_100503908 | Ga0068855_1005039082 | 92 |
| 481 | 3300005563 | Ga0068855_100930176 | Ga0068855_1009301763 | 92 |
| 482 | 3300005563 | Ga0068855_101249986 | Ga0068855_1012499862 | 92 |
| 483 | 3300005564 | Ga0070664_100000615 | Ga0070664_10000061518 | 92 |
| 484 | 3300005564 | Ga0070664_100021951 | Ga0070664_1000219514 | 92 |
| 485 | 3300005564 | Ga0070664_100033988 | Ga0070664_1000339884 | 92 |
| 486 | 3300005564 | Ga0070664_100099139 | Ga0070664_1000991395 | 92 |
| 487 | 3300005564 | Ga0070664_100737675 | Ga0070664_1007376752 | 92 |
| 488 | 3300005577 | Ga0068857_100041588 | Ga0068857_1000415885 | 92 |
| 489 | 3300005577 | Ga0068857_100191465 | Ga0068857_1001914653 | 92 |
| 490 | 3300005577 | Ga0068857_100942769 | Ga0068857_1009427692 | 92 |
| 491 | 3300005578 | Ga0068854_100118372 | Ga0068854_1001183723 | 92 |
| 492 | 3300005578 | Ga0068854_100323774 | Ga0068854_1003237743 | 92 |
| 493 | 3300005578 | Ga0068854_100451458 | Ga0068854_1004514583 | 92 |
| 494 | 3300005578 | Ga0068854_100954862 | Ga0068854_1009548622 | 92 |
| 495 | 3300005614 | Ga0068856_100000442 | Ga0068856_10000044233 | 92 |
| 496 | 3300005614 | Ga0068856_101475468 | Ga0068856_1014754681 | 92 |
| 497 | 3300005616 | Ga0068852_100000241 | Ga0068852_10000024131 | 92 |
| 498 | 3300005616 | Ga0068852_100018676 | Ga0068852_1000186763 | 92 |
| 499 | 3300005616 | Ga0068852_100056875 | Ga0068852_1000568753 | 92 |
| 500 | 3300005616 | Ga0068852_100879920 | Ga0068852_1008799201 | 92 |
| 501 | 3300005616 | Ga0068852_101777194 | Ga0068852_1017771942 | 92 |
| 502 | 3300005617 | Ga0068859_100642322 | Ga0068859_1006423222 | 92 |
| 503 | 3300005618 | Ga0068864_100004493 | Ga0068864_1000044935 | 92 |
| 504 | 3300005618 | Ga0068864_100519821 | Ga0068864_1005198213 | 92 |
| 505 | 3300005618 | Ga0068864_101739356 | Ga0068864_1017393562 | 92 |
| 506 | 3300005834 | Ga0068851_10004973 | Ga0068851_100049734 | 92 |
| 507 | 3300005834 | Ga0068851_10144655 | Ga0068851_101446553 | 92 |
| 508 | 3300005841 | Ga0068863_100014278 | Ga0068863_1000142787 | 92 |
| 509 | 3300006237 | Ga0097621_100246041 | Ga0097621_1002460412 | 92 |
| 510 | 3300006358 | Ga0068871_100064545 | Ga0068871_1000645453 | 92 |
| 511 | 3300006358 | Ga0068871_100573619 | Ga0068871_1005736193 | 92 |
| 512 | 3300006931 | Ga0097620_100642319 | Ga0097620_1006423193 | 92 |
| 513 | 3300009098 | Ga0105245_10172523 | Ga0105245_101725234 | 92 |
| 514 | 3300009101 | Ga0105247_10288163 | Ga0105247_102881632 | 92 |
| 515 | 3300009148 | Ga0105243_10523408 | Ga0105243_105234083 | 92 |
| 516 | 3300009174 | Ga0105241_10046707 | Ga0105241_100467074 | 92 |
| 517 | 3300009174 | Ga0105241_10640445 | Ga0105241_106404452 | 92 |
| 518 | 3300009176 | Ga0105242_10362671 | Ga0105242_103626712 | 92 |
| 519 | 3300009176 | Ga0105242_12655807 | Ga0105242_126558072 | 92 |
| 520 | 3300009177 | Ga0105248_10001127 | Ga0105248_100011275 | 92 |
| 521 | 3300009177 | Ga0105248_10001586 | Ga0105248_1000158610 | 92 |
| 522 | 3300009551 | Ga0105238_10072019 | Ga0105238_100720193 | 92 |
| 523 | 3300012508 | Ga0157315_1007917 | Ga0157315_10079172 | 92 |
| 524 | 3300013100 | Ga0157373_10021351 | Ga0157373_100213513 | 92 |
| 525 | 3300013100 | Ga0157373_10021899 | Ga0157373_100218996 | 92 |
| 526 | 3300013100 | Ga0157373_10058801 | Ga0157373_100588013 | 92 |
| 527 | 3300013100 | Ga0157373_10059996 | Ga0157373_100599964 | 92 |
| 528 | 3300013100 | Ga0157373_10263662 | Ga0157373_102636622 | 92 |
| 529 | 3300013102 | Ga0157371_10002401 | Ga0157371_1000240113 | 92 |
| 530 | 3300013102 | Ga0157371_10407381 | Ga0157371_104073812 | 92 |
| 531 | 3300013102 | Ga0157371_10597310 | Ga0157371_105973102 | 92 |
| 532 | 3300013102 | Ga0157371_11617954 | Ga0157371_116179542 | 92 |
| 533 | 3300013104 | Ga0157370_10003954 | Ga0157370_1000395411 | 92 |
| 534 | 3300013104 | Ga0157370_10192136 | Ga0157370_101921362 | 92 |
| 535 | 3300013104 | Ga0157370_10473729 | Ga0157370_104737292 | 92 |
| 536 | 3300013105 | Ga0157369_10250557 | Ga0157369_102505574 | 92 |
| 537 | 3300013296 | Ga0157374_10035871 | Ga0157374_100358714 | 92 |
| 538 | 3300013296 | Ga0157374_10460715 | Ga0157374_104607153 | 92 |
| 539 | 3300013297 | Ga0157378_10142820 | Ga0157378_101428203 | 92 |
| 540 | 3300013306 | Ga0163162_10075213 | Ga0163162_100752133 | 92 |
| 541 | 3300013306 | Ga0163162_10782407 | Ga0163162_107824071 | 92 |
| 542 | 3300013306 | Ga0163162_11042640 | Ga0163162_110426402 | 92 |
| 543 | 3300013307 | Ga0157372_10431317 | Ga0157372_104313171 | 92 |
| 544 | 3300013307 | Ga0157372_11066021 | Ga0157372_110660212 | 92 |
| 545 | 3300013307 | Ga0157372_11555876 | Ga0157372_115558762 | 92 |
| 546 | 3300013308 | Ga0157375_10228490 | Ga0157375_102284905 | 92 |
| 547 | 3300013308 | Ga0157375_10974483 | Ga0157375_109744832 | 92 |
| 548 | 3300014325 | Ga0163163_10001016 | Ga0163163_100010162 | 92 |
| 549 | 3300014326 | Ga0157380_11429228 | Ga0157380_114292282 | 92 |
| 550 | 3300014968 | Ga0157379_10092035 | Ga0157379_100920353 | 92 |
| 551 | 3300017792 | Ga0163161_10096122 | Ga0163161_100961224 | 92 |
| 552 | 3300025271 | Ga0207666_1033351 | Ga0207666_10333512 | 92 |
| 553 | 3300025315 | Ga0207697_10018686 | Ga0207697_100186863 | 92 |
| 554 | 3300025315 | Ga0207697_10471545 | Ga0207697_104715452 | 92 |
| 555 | 3300025321 | Ga0207656_10018003 | Ga0207656_100180034 | 92 |
| 556 | 3300025321 | Ga0207656_10095685 | Ga0207656_100956852 | 92 |
| 557 | 3300025893 | Ga0207682_10025160 | Ga0207682_100251604 | 92 |
| 558 | 3300025893 | Ga0207682_10048298 | Ga0207682_100482983 | 92 |
| 559 | 3300025893 | Ga0207682_10117592 | Ga0207682_101175922 | 92 |
| 560 | 3300025901 | Ga0207688_10109065 | Ga0207688_101090652 | 92 |
| 561 | 3300025903 | Ga0207680_10645517 | Ga0207680_106455172 | 92 |
| 562 | 3300025904 | Ga0207647_10009245 | Ga0207647_100092453 | 92 |
| 563 | 3300025907 | Ga0207645_10104835 | Ga0207645_101048354 | 92 |
| 564 | 3300025909 | Ga0207705_10000232 | Ga0207705_1000023236 | 92 |
| 565 | 3300025909 | Ga0207705_10083286 | Ga0207705_100832864 | 92 |
| 566 | 3300025909 | Ga0207705_10085270 | Ga0207705_100852703 | 92 |
| 567 | 3300025911 | Ga0207654_10154736 | Ga0207654_101547362 | 92 |
| 568 | 3300025912 | Ga0207707_11467681 | Ga0207707_114676811 | 92 |
| 569 | 3300025917 | Ga0207660_10058884 | Ga0207660_100588843 | 92 |
| 570 | 3300025917 | Ga0207660_11689117 | Ga0207660_116891172 | 92 |
| 571 | 3300025918 | Ga0207662_10498761 | Ga0207662_104987613 | 92 |
| 572 | 3300025919 | Ga0207657_10000026 | Ga0207657_10000026118 | 92 |
| 573 | 3300025919 | Ga0207657_10038269 | Ga0207657_100382693 | 92 |
| 574 | 3300025919 | Ga0207657_10070275 | Ga0207657_100702754 | 92 |
| 575 | 3300025919 | Ga0207657_10130785 | Ga0207657_101307853 | 92 |
| 576 | 3300025919 | Ga0207657_10317571 | Ga0207657_103175713 | 92 |
| 577 | 3300025919 | Ga0207657_11296882 | Ga0207657_112968822 | 92 |
| 578 | 3300025920 | Ga0207649_10000318 | Ga0207649_1000031810 | 92 |
| 579 | 3300025920 | Ga0207649_10145758 | Ga0207649_101457582 | 92 |
| 580 | 3300025920 | Ga0207649_10373544 | Ga0207649_103735442 | 92 |
| 581 | 3300025921 | Ga0207652_10184328 | Ga0207652_101843283 | 92 |
| 582 | 3300025921 | Ga0207652_10468183 | Ga0207652_104681833 | 92 |
| 583 | 3300025921 | Ga0207652_11768891 | Ga0207652_117688911 | 92 |
| 584 | 3300025923 | Ga0207681_10007671 | Ga0207681_100076715 | 92 |
| 585 | 3300025923 | Ga0207681_10643801 | Ga0207681_106438012 | 92 |
| 586 | 3300025924 | Ga0207694_10833312 | Ga0207694_108333122 | 92 |
| 587 | 3300025925 | Ga0207650_10123515 | Ga0207650_101235153 | 92 |
| 588 | 3300025925 | Ga0207650_10155088 | Ga0207650_101550884 | 92 |
| 589 | 3300025925 | Ga0207650_10178476 | Ga0207650_101784763 | 92 |
| 590 | 3300025925 | Ga0207650_10263363 | Ga0207650_102633633 | 92 |
| 591 | 3300025925 | Ga0207650_10281919 | Ga0207650_102819193 | 92 |
| 592 | 3300025925 | Ga0207650_10360217 | Ga0207650_103602172 | 92 |
| 593 | 3300025926 | Ga0207659_10357002 | Ga0207659_103570024 | 92 |
| 594 | 3300025926 | Ga0207659_10814320 | Ga0207659_108143202 | 92 |
| 595 | 3300025926 | Ga0207659_11499326 | Ga0207659_114993261 | 92 |
| 596 | 3300025927 | Ga0207687_11016132 | Ga0207687_110161322 | 92 |
| 597 | 3300025929 | Ga0207664_10099358 | Ga0207664_100993583 | 92 |
| 598 | 3300025931 | Ga0207644_10012166 | Ga0207644_100121664 | 92 |
| 599 | 3300025931 | Ga0207644_10089752 | Ga0207644_100897523 | 92 |
| 600 | 3300025931 | Ga0207644_10090695 | Ga0207644_100906953 | 92 |
| 601 | 3300025931 | Ga0207644_10158528 | Ga0207644_101585284 | 92 |
| 602 | 3300025931 | Ga0207644_10448841 | Ga0207644_104488413 | 92 |
| 603 | 3300025931 | Ga0207644_11061178 | Ga0207644_110611782 | 92 |
| 604 | 3300025932 | Ga0207690_10001417 | Ga0207690_100014172 | 92 |
| 605 | 3300025932 | Ga0207690_10031421 | Ga0207690_100314213 | 92 |
| 606 | 3300025932 | Ga0207690_10258140 | Ga0207690_102581402 | 92 |
| 607 | 3300025932 | Ga0207690_10453909 | Ga0207690_104539092 | 92 |
| 608 | 3300025932 | Ga0207690_10636128 | Ga0207690_106361282 | 92 |
| 609 | 3300025932 | Ga0207690_10874299 | Ga0207690_108742992 | 92 |
| 610 | 3300025932 | Ga0207690_11053827 | Ga0207690_110538272 | 92 |
| 611 | 3300025933 | Ga0207706_10000031 | Ga0207706_1000003117 | 92 |
| 612 | 3300025933 | Ga0207706_10001098 | Ga0207706_100010983 | 92 |
| 613 | 3300025933 | Ga0207706_10008288 | Ga0207706_100082887 | 92 |
| 614 | 3300025933 | Ga0207706_10065467 | Ga0207706_100654673 | 92 |
| 615 | 3300025933 | Ga0207706_10096106 | Ga0207706_100961063 | 92 |
| 616 | 3300025933 | Ga0207706_10772839 | Ga0207706_107728391 | 92 |
| 617 | 3300025933 | Ga0207706_10810623 | Ga0207706_108106231 | 92 |
| 618 | 3300025933 | Ga0207706_11151605 | Ga0207706_111516052 | 92 |
| 619 | 3300025934 | Ga0207686_10746922 | Ga0207686_107469223 | 92 |
| 620 | 3300025935 | Ga0207709_10505670 | Ga0207709_105056702 | 92 |
| 621 | 3300025937 | Ga0207669_11586502 | Ga0207669_115865022 | 92 |
| 622 | 3300025940 | Ga0207691_10045726 | Ga0207691_100457265 | 92 |
| 623 | 3300025940 | Ga0207691_10147407 | Ga0207691_101474074 | 92 |
| 624 | 3300025940 | Ga0207691_10397696 | Ga0207691_103976962 | 92 |
| 625 | 3300025940 | Ga0207691_10646391 | Ga0207691_106463912 | 92 |
| 626 | 3300025940 | Ga0207691_10932353 | Ga0207691_109323532 | 92 |
| 627 | 3300025941 | Ga0207711_10003583 | Ga0207711_100035834 | 92 |
| 628 | 3300025941 | Ga0207711_10030300 | Ga0207711_100303004 | 92 |
| 629 | 3300025942 | Ga0207689_10153965 | Ga0207689_101539653 | 92 |
| 630 | 3300025944 | Ga0207661_10002291 | Ga0207661_100022917 | 92 |
| 631 | 3300025945 | Ga0207679_10000572 | Ga0207679_1000057216 | 92 |
| 632 | 3300025945 | Ga0207679_10239097 | Ga0207679_102390974 | 92 |
| 633 | 3300025945 | Ga0207679_10349117 | Ga0207679_103491172 | 92 |
| 634 | 3300025949 | Ga0207667_10069864 | Ga0207667_100698642 | 92 |
| 635 | 3300025949 | Ga0207667_10090761 | Ga0207667_100907611 | 92 |
| 636 | 3300025949 | Ga0207667_11064600 | Ga0207667_110646002 | 92 |
| 637 | 3300025949 | Ga0207667_11982982 | Ga0207667_119829821 | 92 |
| 638 | 3300025960 | Ga0207651_10016342 | Ga0207651_100163424 | 92 |
| 639 | 3300025960 | Ga0207651_10302143 | Ga0207651_103021432 | 92 |
| 640 | 3300025960 | Ga0207651_10559394 | Ga0207651_105593943 | 92 |
| 641 | 3300025981 | Ga0207640_10035455 | Ga0207640_100354554 | 92 |
| 642 | 3300025981 | Ga0207640_10301244 | Ga0207640_103012442 | 92 |
| 643 | 3300025981 | Ga0207640_11414187 | Ga0207640_114141872 | 92 |
| 644 | 3300025986 | Ga0207658_10080552 | Ga0207658_100805523 | 92 |
| 645 | 3300025986 | Ga0207658_11723607 | Ga0207658_117236072 | 92 |
| 646 | 3300026023 | Ga0207677_10417306 | Ga0207677_104173062 | 92 |
| 647 | 3300026023 | Ga0207677_11050871 | Ga0207677_110508712 | 92 |
| 648 | 3300026035 | Ga0207703_10138525 | Ga0207703_101385252 | 92 |
| 649 | 3300026041 | Ga0207639_10001178 | Ga0207639_1000117813 | 92 |
| 650 | 3300026041 | Ga0207639_10147410 | Ga0207639_101474102 | 92 |
| 651 | 3300026041 | Ga0207639_10287572 | Ga0207639_102875722 | 92 |
| 652 | 3300026041 | Ga0207639_10292679 | Ga0207639_102926793 | 92 |
| 653 | 3300026067 | Ga0207678_10005287 | Ga0207678_100052875 | 92 |
| 654 | 3300026067 | Ga0207678_10153784 | Ga0207678_101537843 | 92 |
| 655 | 3300026067 | Ga0207678_10162116 | Ga0207678_101621164 | 92 |
| 656 | 3300026067 | Ga0207678_10223810 | Ga0207678_102238103 | 92 |
| 657 | 3300026067 | Ga0207678_10469474 | Ga0207678_104694743 | 92 |
| 658 | 3300026078 | Ga0207702_10000891 | Ga0207702_1000089114 | 92 |
| 659 | 3300026078 | Ga0207702_10163764 | Ga0207702_101637643 | 92 |
| 660 | 3300026078 | Ga0207702_12110681 | Ga0207702_121106812 | 92 |
| 661 | 3300026088 | Ga0207641_10017148 | Ga0207641_100171482 | 92 |
| 662 | 3300026089 | Ga0207648_10023086 | Ga0207648_100230865 | 92 |
| 663 | 3300026095 | Ga0207676_10008133 | Ga0207676_100081335 | 92 |
| 664 | 3300026095 | Ga0207676_10078555 | Ga0207676_100785553 | 92 |
| 665 | 3300026095 | Ga0207676_11390684 | Ga0207676_113906842 | 92 |
| 666 | 3300026095 | Ga0207676_11942477 | Ga0207676_119424772 | 92 |
| 667 | 3300026116 | Ga0207674_10035328 | Ga0207674_100353286 | 92 |
| 668 | 3300026116 | Ga0207674_10096380 | Ga0207674_100963804 | 92 |
| 669 | 3300026121 | Ga0207683_10014692 | Ga0207683_100146928 | 92 |
| 670 | 3300026121 | Ga0207683_10110332 | Ga0207683_101103324 | 92 |
| 671 | 3300026142 | Ga0207698_10009609 | Ga0207698_100096093 | 92 |
| 672 | 3300026142 | Ga0207698_10074672 | Ga0207698_100746723 | 92 |
| 673 | 3300026142 | Ga0207698_10225009 | Ga0207698_102250094 | 92 |
| 674 | 3300026142 | Ga0207698_10699054 | Ga0207698_106990541 | 92 |
| 675 | 3300026142 | Ga0207698_10714343 | Ga0207698_107143433 | 92 |
| 676 | 3300026142 | Ga0207698_10896726 | Ga0207698_108967263 | 92 |
| 677 | 3300028379 | Ga0268266_10007451 | Ga0268266_100074514 | 92 |
| 678 | 3300031731 | Ga0307405_10209212 | Ga0307405_102092123 | 92 |
| 679 | 3300031731 | Ga0307405_10686767 | Ga0307405_106867672 | 92 |
| 680 | 3300031824 | Ga0307413_10071038 | Ga0307413_100710383 | 92 |
| 681 | 3300031824 | Ga0307413_10164336 | Ga0307413_101643363 | 92 |
| 682 | 3300031824 | Ga0307413_10679535 | Ga0307413_106795351 | 92 |
| 683 | 3300031852 | Ga0307410_10269873 | Ga0307410_102698733 | 92 |
| 684 | 3300031903 | Ga0307407_10102953 | Ga0307407_101029533 | 92 |
| 685 | 3300031911 | Ga0307412_10163739 | Ga0307412_101637393 | 92 |
| 686 | 3300031911 | Ga0307412_11187192 | Ga0307412_111871922 | 92 |
| 687 | 3300031995 | Ga0307409_100135292 | Ga0307409_1001352923 | 92 |
| 688 | 3300031995 | Ga0307409_100314662 | Ga0307409_1003146622 | 92 |
| 689 | 3300031995 | Ga0307409_101939014 | Ga0307409_1019390142 | 92 |
| 690 | 3300032002 | Ga0307416_100274432 | Ga0307416_1002744322 | 92 |
| 691 | 3300032002 | Ga0307416_103514236 | Ga0307416_1035142362 | 92 |
| 692 | 3300032004 | Ga0307414_11413227 | Ga0307414_114132272 | 92 |
| 693 | 3300032005 | Ga0307411_10013558 | Ga0307411_100135585 | 92 |
| 694 | 3300032005 | Ga0307411_10424126 | Ga0307411_104241262 | 92 |
| 695 | 3300032126 | Ga0307415_100256486 | Ga0307415_1002564863 | 92 |
| 696 | 3300032126 | Ga0307415_100814170 | Ga0307415_1008141702 | 92 |
| 697 | 3300032126 | Ga0307415_101420232 | Ga0307415_1014202322 | 92 |
| 698 | 3300034816 | Ga0373930_0057921 | Ga0373930_0057921_454_735 | 92 |
| 699 | 3300034820 | Ga0373959_0087205 | Ga0373959_0087205_377_658 | 92 |
| 700 | 3300035092 | Ga0373952_0092297 | Ga0373952_0092297_86_367 | 92 |
| 701 | 3300035121 | Ga0373960_0051867 | Ga0373960_0051867_304_585 | 92 |
| 702 | 3300037312 | Ga0395899_0050080 | Ga0395899_0050080_257_535 | 92 |
| 703 | 3300037312 | Ga0395899_0063340 | Ga0395899_0063340_959_1237 | 92 |
| 704 | 3300037312 | Ga0395899_0082928 | Ga0395899_0082928_961_1239 | 92 |
| 705 | 3300037312 | Ga0395899_0114907 | Ga0395899_0114907_1608_1886 | 92 |
| 706 | 3300037312 | Ga0395899_0146065 | Ga0395899_0146065_1167_1445 | 92 |
| 707 | 3300037312 | Ga0395899_0156903 | Ga0395899_0156903_389_667 | 92 |
| 708 | 3300037312 | Ga0395899_0227995 | Ga0395899_0227995_728_1006 | 92 |
| 709 | 3300037312 | Ga0395899_0512819 | Ga0395899_0512819_232_513 | 92 |
| 710 | 3300037418 | Ga0395900_0033844 | Ga0395900_0033844_805_1083 | 92 |
| 711 | 3300037418 | Ga0395900_0047139 | Ga0395900_0047139_3190_3471 | 92 |
| 712 | 3300037418 | Ga0395900_0180659 | Ga0395900_0180659_1631_1909 | 92 |
| 713 | 3300037418 | Ga0395900_0214138 | Ga0395900_0214138_39_344 | 92 |
| 714 | 3300037418 | Ga0395900_0264197 | Ga0395900_0264197_691_969 | 92 |
| 715 | 3300037418 | Ga0395900_0437241 | Ga0395900_0437241_421_699 | 92 |
| 716 | 3300037418 | Ga0395900_0450727 | Ga0395900_0450727_458_742 | 92 |
| 717 | 3300037418 | Ga0395900_0639264 | Ga0395900_0639264_39_344 | 92 |
| 718 | 3300037418 | Ga0395900_1084293 | Ga0395900_1084293_26_304 | 92 |
| 719 | 3300037418 | Ga0395900_1392037 | Ga0395900_1392037_120_398 | 92 |
| 720 | 3300037466 | Ga0395898_0049701 | Ga0395898_0049701_2410_2691 | 92 |
| 721 | 3300037466 | Ga0395898_0076467 | Ga0395898_0076467_2814_3194 | 92 |
| 722 | 3300037466 | Ga0395898_0116659 | Ga0395898_0116659_557_835 | 92 |
| 723 | 3300037466 | Ga0395898_0133848 | Ga0395898_0133848_1178_1456 | 92 |
| 724 | 3300037466 | Ga0395898_0264782 | Ga0395898_0264782_444_722 | 92 |
| 725 | 3300037466 | Ga0395898_0517435 | Ga0395898_0517435_223_501 | 92 |
| 726 | 3300037471 | Ga0395905_0037636 | Ga0395905_0037636_1931_2212 | 92 |
| 727 | 3300037471 | Ga0395905_0054282 | Ga0395905_0054282_2188_2466 | 92 |
| 728 | 3300037471 | Ga0395905_0054640 | Ga0395905_0054640_926_1204 | 92 |
| 729 | 3300037471 | Ga0395905_0107873 | Ga0395905_0107873_886_1170 | 92 |
| 730 | 3300037471 | Ga0395905_0491054 | Ga0395905_0491054_12_290 | 92 |
| 731 | 3300037471 | Ga0395905_0521312 | Ga0395905_0521312_364_642 | 92 |
| 732 | 3300037471 | Ga0395905_0562541 | Ga0395905_0562541_415_693 | 92 |
| 733 | 3300037471 | Ga0395905_0845200 | Ga0395905_0845200_341_619 | 92 |
| 734 | 3300037471 | Ga0395905_1149910 | Ga0395905_1149910_167_445 | 92 |
| 735 | 3300037471 | Ga0395905_1391864 | Ga0395905_1391864_262_540 | 92 |
| 736 | 3300038443 | Ga0395901_0024874 | Ga0395901_0024874_5010_5291 | 92 |
| 737 | 3300038443 | Ga0395901_0057025 | Ga0395901_0057025_960_1238 | 92 |
| 738 | 3300038443 | Ga0395901_0083360 | Ga0395901_0083360_1770_2048 | 92 |
| 739 | 3300038443 | Ga0395901_0158555 | Ga0395901_0158555_1181_1459 | 92 |
| 740 | 3300038443 | Ga0395901_0282145 | Ga0395901_0282145_658_936 | 92 |
| 741 | 3300038443 | Ga0395901_0366533 | Ga0395901_0366533_960_1238 | 92 |
| 742 | 3300038443 | Ga0395901_0901023 | Ga0395901_0901023_505_783 | 92 |
| 743 | 3300038443 | Ga0395901_1517650 | Ga0395901_1517650_53_331 | 92 |
| 744 | 3300038443 | Ga0395901_1541995 | Ga0395901_1541995_148_432 | 92 |
| 745 | 3300041451 | Ga0451791_1088308 | Ga0451791_1088308_61_339 | 92 |
| 746 | 3300041486 | Ga0451807_1979107 | Ga0451807_1979107_65_352 | 92 |
| 747 | 3300041512 | Ga0451853_2615642 | Ga0451853_2615642_166_453 | 92 |
| 748 | 3300042004 | Ga0439445_0008474 | Ga0439445_0008474_1553_1834 | 92 |
| 749 | 3300042006 | Ga0439432_010454 | Ga0439432_010454_1253_1534 | 92 |
| 750 | 3300044658 | Ga0466972_0060729 | Ga0466972_0060729_734_1012 | 92 |
| 751 | 3300044658 | Ga0466972_0169829 | Ga0466972_0169829_325_603 | 92 |
| 752 | 3300044658 | Ga0466972_0468196 | Ga0466972_0468196_82_360 | 92 |
| 753 | 3300044683 | Ga0466965_0151320 | Ga0466965_0151320_897_1175 | 92 |
| 754 | 3300044684 | Ga0466966_0041887 | Ga0466966_0041887_472_750 | 92 |
| 755 | 3300044684 | Ga0466966_0400081 | Ga0466966_0400081_526_804 | 92 |
| 756 | 3300044684 | Ga0466966_0478893 | Ga0466966_0478893_307_585 | 92 |
| 757 | 3300044693 | Ga0466961_0177851 | Ga0466961_0177851_497_775 | 92 |
| 758 | 3300044694 | Ga0466963_0033198 | Ga0466963_0033198_1814_2095 | 92 |
| 759 | 3300044694 | Ga0466963_0401227 | Ga0466963_0401227_503_781 | 92 |
| 760 | 3300044706 | Ga0466964_0028821 | Ga0466964_0028821_811_1089 | 92 |
| 761 | 3300044706 | Ga0466964_0794791 | Ga0466964_0794791_26_304 | 92 |
| 762 | 3300044719 | Ga0466971_0222631 | Ga0466971_0222631_335_613 | 92 |
| 763 | 3300044735 | Ga0466968_0043339 | Ga0466968_0043339_69_347 | 92 |
| 764 | 3300044735 | Ga0466968_0460538 | Ga0466968_0460538_82_360 | 92 |
| 765 | 3300044765 | Ga0466970_0012994 | Ga0466970_0012994_1243_1521 | 92 |
| 766 | 3300044765 | Ga0466970_0137718 | Ga0466970_0137718_430_708 | 92 |
| 767 | 3300044765 | Ga0466970_0694615 | Ga0466970_0694615_197_475 | 92 |
| 768 | 3300044842 | Ga0466957_0162775 | Ga0466957_0162775_134_412 | 92 |
| 769 | 3300044901 | Ga0466960_0007103 | Ga0466960_0007103_556_834 | 92 |
| 770 | 3300044901 | Ga0466960_0672063 | Ga0466960_0672063_15_293 | 92 |
| 771 | 3300045049 | Ga0466959_0087402 | Ga0466959_0087402_1026_1304 | 92 |
| 772 | 3300045049 | Ga0466959_0447866 | Ga0466959_0447866_123_404 | 92 |
| 773 | 3300045836 | Ga0466958_0066608 | Ga0466958_0066608_796_1074 | 92 |
| 774 | 3300045836 | Ga0466958_0804440 | Ga0466958_0804440_157_435 | 92 |
| 775 | 3300045976 | Ga0466967_0058604 | Ga0466967_0058604_2143_2421 | 92 |
| 776 | 3300045976 | Ga0466967_0210372 | Ga0466967_0210372_1495_1773 | 92 |
| 777 | 3300045976 | Ga0466967_0263853 | Ga0466967_0263853_179_457 | 92 |
| 778 | 3300045976 | Ga0466967_0289552 | Ga0466967_0289552_583_861 | 92 |
| 779 | 3300045976 | Ga0466967_0816901 | Ga0466967_0816901_517_795 | 92 |
| 780 | 3300045976 | Ga0466967_0876677 | Ga0466967_0876677_512_790 | 92 |
| 781 | 3300046528 | Ga0495642_0372244 | Ga0495642_0372244_43_321 | 92 |
| 782 | 3300046539 | Ga0495621_0019365 | Ga0495621_0019365_1190_1468 | 92 |
| 783 | 3300046616 | Ga0495668_0621981 | Ga0495668_0621981_158_445 | 92 |
| 784 | 3300046684 | Ga0495669_0550405 | Ga0495669_0550405_228_509 | 92 |
| 785 | 3300046691 | Ga0495670_0262392 | Ga0495670_0262392_110_388 | 92 |
| 786 | 3300047445 | Ga0495677_0213325 | Ga0495677_0213325_436_714 | 92 |
| 787 | 3300048903 | Ga0496100_1656223 | Ga0496100_1656223_165_443 | 92 |
| 788 | 3300048905 | Ga0496102_0111311 | Ga0496102_0111311_1500_1778 | 92 |
| 789 | 3300048906 | Ga0496103_0034177 | Ga0496103_0034177_751_1029 | 92 |
| 790 | 3300048909 | Ga0496106_0625856 | Ga0496106_0625856_297_575 | 92 |
| 791 | 3300048909 | Ga0496106_0799005 | Ga0496106_0799005_223_504 | 92 |
| 792 | 3300048910 | Ga0496107_0046892 | Ga0496107_0046892_1341_1646 | 92 |
| 793 | 3300048910 | Ga0496107_0351342 | Ga0496107_0351342_67_345 | 92 |
| 794 | 3300048910 | Ga0496107_0713653 | Ga0496107_0713653_25_303 | 92 |
| 795 | 3300048910 | Ga0496107_1027817 | Ga0496107_1027817_223_504 | 92 |
| 796 | 3300048911 | Ga0496108_0035706 | Ga0496108_0035706_1605_1883 | 92 |
| 797 | 3300048911 | Ga0496108_0936326 | Ga0496108_0936326_409_687 | 92 |
| 798 | 3300048912 | Ga0496109_0004188 | Ga0496109_0004188_3289_3567 | 92 |
| 799 | 3300048912 | Ga0496109_0055116 | Ga0496109_0055116_3020_3298 | 92 |
| 800 | 3300048913 | Ga0496110_0026346 | Ga0496110_0026346_3155_3433 | 92 |
| 801 | 3300048913 | Ga0496110_0317165 | Ga0496110_0317165_486_764 | 92 |
| 802 | 3300048913 | Ga0496110_0596932 | Ga0496110_0596932_249_530 | 92 |
| 803 | 3300048914 | Ga0496111_0089167 | Ga0496111_0089167_30_335 | 92 |
| 804 | 3300048914 | Ga0496111_0199170 | Ga0496111_0199170_72_377 | 92 |
| 805 | 3300048914 | Ga0496111_0250037 | Ga0496111_0250037_452_730 | 92 |
| 806 | 3300048915 | Ga0496112_0030806 | Ga0496112_0030806_2699_2977 | 92 |
| 807 | 3300048915 | Ga0496112_0058370 | Ga0496112_0058370_2665_2943 | 92 |
| 808 | 3300048916 | Ga0496113_0182481 | Ga0496113_0182481_1110_1388 | 92 |
| 809 | 3300061719 | Ga0466962_0598700 | Ga0466962_0598700_118_396 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xna-assembly1.cif.gz_A | crystal structure of somatostatin receptor 2 (sstr2) with peptide antagonist cyn 154806 | 0.7823 | 1 | 58 |
| 5jsi-assembly1.cif.gz_A | structure of membrane protein | 0.7439 | 5 | 84 |
| 6li3-assembly1.cif.gz_R | cryo-em structure of gpr52-minigs-nb35 | 0.7421 | 4 | 65 |
| 6qzh-assembly1.cif.gz_A | structure of the human cc chemokine receptor 7 in complex with the intracellular allosteric antagonist cmp2105 and the insertion protein sialidase nana | 0.7348 | 5 | 84 |
| 6li1-assembly1.cif.gz_A | crystal structure of gpr52 ligand free form with flavodoxin fusion | 0.7221 | 4 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A096ST30_64_152_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8173 | 8 | 86 | 1.20.1280.290 |
| af_F4JMN0_99_187_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.7891 | 7 | 86 | 1.20.1280.290 |
| af_Q18826_258_405_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.7822 | 7 | 81 | 1.20.1410.10 |
| af_A0A0R4IVC9_32_339_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.7549 | 3 | 58 | 1.20.1070.10 |
| af_A0A096ST30_64_152_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.7301 | 8 | 86 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6FJP1-F1-model_v4 | GGDEF domain-containing protein | 0.9736 | 1 | 92 |
GO:0016020
|
| AF-A0A4P6FJP1-F1-model_v4 | GGDEF domain-containing protein | 0.9632 | 1 | 92 |
GO:0016020
|
| AF-A0A521YRM9-F1-model_v4 | GGDEF domain-containing protein | 0.9563 | 5 | 89 |
GO:0016020
|
| AF-A0A7Y5U9J7-F1-model_v4 | Uncharacterized protein | 0.9544 | 7 | 91 |
GO:0016020
|
| AF-A0A1F4FLY1-F1-model_v4 | GGDEF domain-containing protein | 0.953 | 5 | 89 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar