F481602

General Info

Members Datasets Scaffolds Average Seq Length
805 595 446 156

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1063119|Ga0209025_10631193
Length 163
Sequence MRFRAMRFIVVNLLLTLVWAFVTGSFTLHNLALGFAIGAMSLLLVREQLPASLNRVRPIKLLLLAGLFFKELTLSAIKVAFMVLRPNMRLRPGIFAYPLTITRDFEITLLANLITLTPGTLSVDVSDDRKMLYVHALSCHDPAAERRAISSGFERRIREAFPL

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
21 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
32 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
33 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
34 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
35 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
36 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
37 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
38 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
41 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
44 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
47 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
48 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
49 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
50 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
51 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
52 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
53 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
54 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
55 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
56 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
57 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
58 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
59 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
60 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
61 2643221558 Rhizobium sp. Root149 Isolate Unclassified
62 2643221568 Rhizobium sp. Root564 Isolate Unclassified
63 2643221599 Rhizobium sp. Root708 Isolate Unclassified
64 2643221607 Rhizobium sp. Root73 Isolate Unclassified
65 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
66 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
67 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
68 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
69 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
70 2643221688 Rhizobium sp. Root482 Isolate Unclassified
71 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
72 2643221718 Rhizobium sp. Root268 Isolate Unclassified
73 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
74 2718217927 Rhizobium sp. N324 Isolate Nodule
75 2718218423 Rhizobium sp. N941 Isolate Nodule
76 2721755809 Rhizobium sp. N541 Isolate Nodule
77 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
78 2738541293 Rhizobium sp. GV031 Isolate Unclassified
79 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
80 2738543024 Aminobacter sp. AP02 Isolate Unclassified
81 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
82 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
83 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
84 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
85 2791355256 Rhizobium sp. M10 Isolate Nodule
86 2791355261 Rhizobium sp. J15 Isolate Nodule
87 2791355262 Rhizobium sp. M1 Isolate Nodule
88 2791355263 Rhizobium chutanense C5 Isolate Nodule
89 2791355265 Rhizobium sp. H4 Isolate Nodule
90 2791355266 Rhizobium sp. L43 Isolate Nodule
91 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
92 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
93 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
94 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
95 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
96 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
97 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
98 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
99 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
100 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
101 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
102 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
103 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
104 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
105 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
106 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
107 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
108 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
109 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
110 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
111 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
112 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
113 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
114 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
115 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
116 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
117 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
118 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
119 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
120 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
121 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
122 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
123 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
124 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
125 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
126 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
127 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
128 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
129 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
130 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
131 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
132 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
133 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
134 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
135 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
136 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
137 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
138 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
139 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
140 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
141 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
142 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
143 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
144 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
145 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
146 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
147 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
148 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
149 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
150 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
151 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
152 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
153 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
154 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
155 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
156 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
157 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
158 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
159 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
160 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
161 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
162 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
163 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
164 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
165 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
166 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
167 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
168 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
169 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
170 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
171 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
172 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
173 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
174 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
175 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
176 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
177 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
178 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
179 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
180 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
181 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
182 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
183 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
184 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
185 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
186 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
187 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
188 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
189 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
190 2936381700 Rhizobium chutanense C16 Isolate Unclassified
191 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
192 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
193 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
194 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
195 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
196 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
197 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
198 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
199 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
200 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
201 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
202 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
203 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
204 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
205 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
206 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
207 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
208 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
209 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
210 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
211 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
212 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
213 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
214 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
215 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
216 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
217 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
218 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
219 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
220 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
221 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
222 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
223 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
224 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
225 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
226 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
227 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
228 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
229 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
230 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
231 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
232 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
233 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
234 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
235 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
236 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
237 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
238 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
239 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
240 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
241 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
242 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
243 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
244 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
245 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
246 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
247 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
248 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
249 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
250 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
251 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
252 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
253 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
254 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
255 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
256 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
257 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
258 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
259 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
260 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
261 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
262 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
263 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
264 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
265 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
266 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
267 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
268 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
269 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
270 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
271 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
272 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
273 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
274 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
275 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
276 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
277 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
278 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
279 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
280 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
281 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
282 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
283 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
284 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
285 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
286 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
287 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
288 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
289 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
290 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
291 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
292 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
293 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
294 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
295 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
296 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
297 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
298 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
299 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
300 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
301 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
302 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
303 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
304 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
305 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
306 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
307 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
308 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
309 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
310 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
311 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
312 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
313 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
314 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
315 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
316 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
317 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
318 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
319 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
320 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
321 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
322 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
323 2996887358 Rhizobium sp. R711 Isolate Nodule
324 2996893221 Rhizobium sp. R635 Isolate Nodule
325 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
326 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
327 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
328 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
329 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
330 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
331 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
332 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
333 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
334 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
335 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
336 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
337 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
338 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
339 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
340 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
341 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
342 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
343 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
344 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
345 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
346 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
347 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
348 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
349 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
350 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
351 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
352 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
353 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
354 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
355 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
356 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
357 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
358 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
359 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
360 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
361 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
362 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
363 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
364 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
365 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
366 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
367 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
368 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
369 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
370 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
371 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
372 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
373 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
374 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
375 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
376 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
377 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
378 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
379 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
380 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
381 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
382 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
383 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
384 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
385 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
386 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
387 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
388 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
389 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
390 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
391 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
393 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
394 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
395 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
396 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
398 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
399 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
400 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
401 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
402 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
404 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
405 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
406 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
408 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
409 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
423 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
424 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
426 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
427 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
428 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
429 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
430 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
431 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
432 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
433 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
434 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
435 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
436 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
437 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
438 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
439 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
440 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
441 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
442 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
443 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
444 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
445 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
446 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
447 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
448 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
449 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
450 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
451 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
452 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
453 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
454 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
455 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
456 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
457 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
458 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
459 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
460 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
461 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
462 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
465 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
466 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
467 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
468 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
469 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
470 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
471 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
472 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
473 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
474 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
475 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
476 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
477 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
478 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
481 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
482 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
483 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
484 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
485 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
486 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
487 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
488 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
489 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
490 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
491 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
492 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
493 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
494 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
495 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
496 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
497 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
498 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
499 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
500 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
501 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
502 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
503 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
504 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
505 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
506 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
507 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
508 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
509 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
510 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
511 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
512 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
513 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
514 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
515 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
516 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
517 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
518 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
529 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
530 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
531 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
532 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
536 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
537 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
538 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
539 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
540 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
541 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
542 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
543 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
544 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
545 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
546 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
547 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
548 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
549 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
550 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
551 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
552 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
553 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
554 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
555 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
556 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
557 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
558 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
559 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
560 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
561 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
562 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
563 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
564 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
565 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
566 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
567 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
568 8005258706 Rhizobium sp. R693 Isolate Nodule
569 8005275841 Rhizobium sp. N4311 Isolate Nodule
570 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
571 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
572 8005321885 Rhizobium sp. R72 Isolate Nodule
573 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
574 8005382845 Rhizobium sp. R634 Isolate Nodule
575 8005395548 Rhizobium sp. R339 Isolate Nodule
576 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
577 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
578 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
579 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
580 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
581 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
582 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
583 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
584 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
585 8018176218 Rhizobium sp. N122 Isolate Nodule
586 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
587 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
588 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
589 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
590 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
591 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
592 8056382006 Rhizobium croatiense 13T Isolate Nodule
593 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
594 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
595 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.4
Metatranscriptomes 0
Isolates 44.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 16.02
Nodule 36.4
Rhizoplane 3.23
Rhizosphere 25.71
Stem 0
Stem Tuber 0
Unclassified 18.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC66930_b1 2010549000 Bacteria 846
2 JGI24740J21852_10001010 3300001979 Bacteria 12579
3 JGI25155J39150_1000089 3300002704 Bacteria 51946
4 JGI25156J39149_1000147 3300002705 Bacteria 51946
5 JGI25162J39368_1000243 3300002737 Bacteria 54503
6 JGI25154J39366_1000160 3300002738 Bacteria 51946
7 JGI25157J39369_1000190 3300002741 Bacteria 51946
8 JGI25152J39213_1002089 3300002773 Bacteria 7849
9 JGI25152J39213_1004012 3300002773 Bacteria 4796
10 JGI25152J39213_1004601 3300002773 Bacteria 4295
11 JGI25150J39212_1000327 3300002774 Bacteria 23371
12 JGI25159J45721_1003582 3300002987 Bacteria 5436
13 JGI25151J46595_10000389 3300003187 Bacteria 45619
14 JGI25151J46595_10000900 3300003187 Bacteria 23371
15 JGI25151J46595_10004494 3300003187 Bacteria 7370
16 JGI25151J46595_10004666 3300003187 Bacteria 7208
17 JGI25151J46595_10016398 3300003187 Bacteria 3240
18 JGI25165J46597_1000318 3300003214 Bacteria 57977
19 JGI25153J46596_10019153 3300003215 Bacteria 2630
20 JGI25153J46596_10022060 3300003215 Bacteria 2359
21 JGI25153J46596_10028175 3300003215 Bacteria 1955
22 rootH1_10030544 3300003316 Bacteria 2780
23 rootH1_10108886 3300003316 Bacteria 1658
24 rootL2_10020846 3300003322 Bacteria 7936
25 rootH1_10055359 3300003323 Bacteria 1805
26 rootH1_10055994 3300003323 Bacteria 3609
27 rootH1_10055995 3300003323 Bacteria 4097
28 JGI25160J50197_1000047 3300003354 Bacteria 136499
29 JGI25160J50197_1016458 3300003354 Bacteria 2383
30 JGI25161J50226_1000033 3300003374 Bacteria 136499
31 Ga0055526_1013094 3300003771 Bacteria 3543
32 Ga0055526_1014952 3300003771 Bacteria 3151
33 Ga0055524_1008232 3300003775 Bacteria 4350
34 Ga0055524_1011719 3300003775 Bacteria 3408
35 Ga0055524_1031651 3300003775 Bacteria 1516
36 Ga0055536_1008469 3300003781 Bacteria 4411
37 Ga0055528_1000560 3300003790 Bacteria 28261
38 Ga0055528_1000659 3300003790 Bacteria 25113
39 Ga0055528_1004407 3300003790 Bacteria 6788
40 Ga0055528_1042227 3300003790 Bacteria 1007
41 Ga0055530_10010080 3300003791 Bacteria 3544
42 Ga0055540_1002220 3300003792 Bacteria 10537
43 Ga0055531_10002384 3300003794 Bacteria 12627
44 Ga0055543_1000075 3300004625 Bacteria 87163
45 Ga0065165_1000227 3300005262 Bacteria 98928
46 Ga0065165_1008323 3300005262 Bacteria 4881
47 Ga0070668_101230636 3300005347 Bacteria 679
48 Ga0070669_100196989 3300005353 Bacteria 1583
49 Ga0070671_100058464 3300005355 Bacteria 3209
50 Ga0070673_101478245 3300005364 Bacteria 640
51 Ga0070665_100021793 3300005548 Bacteria 6442
52 Ga0070665_100138823 3300005548 Bacteria 2434
53 Ga0070665_100531556 3300005548 Bacteria 1188
54 Ga0068855_101290010 3300005563 Bacteria 756
55 Ga0068857_101146699 3300005577 Bacteria 752
56 Ga0068856_100035333 3300005614 Bacteria 4897
57 Ga0068856_101100007 3300005614 Bacteria 812
58 Ga0068852_100123018 3300005616 Bacteria 2378
59 Ga0068861_101473906 3300005719 Bacteria 667
60 Ga0068862_101504860 3300005844 Bacteria 678
61 Ga0081539_10002544 3300005985 Bacteria 25336
62 Ga0075365_10003056 3300006038 Bacteria 8488
63 Ga0075365_10062309 3300006038 Bacteria 2494
64 Ga0075363_100112200 3300006048 Bacteria 1516
65 Ga0075363_100298677 3300006048 Bacteria 934
66 Ga0075367_10005582 3300006178 Bacteria 6265
67 Ga0075369_10005714 3300006186 Bacteria 4667
68 Ga0075369_10030477 3300006186 Bacteria 2272
69 Ga0075369_10562977 3300006186 Bacteria 544
70 Ga0075370_10192582 3300006353 Bacteria 1202
71 Ga0079104_1000010 3300006946 Bacteria 366021
72 Ga0105240_10000027 3300009093 Bacteria 348486
73 Ga0105243_10370678 3300009148 Bacteria 1321
74 Ga0105237_10001067 3300009545 Bacteria 36848
75 Ga0105238_10506478 3300009551 Bacteria 1209
76 Ga0105238_12463967 3300009551 Bacteria 556
77 Ga0123341_1078813 3300009765 Bacteria 1319
78 Ga0123342_1003979 3300009766 Bacteria 23134
79 Ga0105239_10013845 3300010375 Bacteria 8951
80 Ga0157373_10167226 3300013100 Bacteria 1548
81 Ga0157371_10006146 3300013102 Bacteria 9970
82 Ga0157370_10000223 3300013104 Bacteria 72025
83 Ga0157370_10484052 3300013104 Bacteria 1137
84 Ga0157369_10011799 3300013105 Bacteria 9922
85 Ga0157369_10169672 3300013105 Bacteria 2300
86 Ga0157369_10353922 3300013105 Bacteria 1525
87 Ga0157374_10820346 3300013296 Bacteria 946
88 Ga0163162_12500111 3300013306 Bacteria 594
89 Ga0163162_13179662 3300013306 Bacteria 527
90 Ga0182008_10138880 3300014497 Bacteria 1215
91 Ga0182005_1001567 3300015265 Bacteria 9037
92 Ga0228711_1000001 3300022739 Bacteria 357377
93 Ga0228710_1000001 3300022740 Bacteria 314328
94 Ga0209435_100036 3300025206 Bacteria 126970
95 Ga0209436_111200 3300025208 Bacteria 1590
96 Ga0209672_107279 3300025228 Bacteria 1714
97 Ga0209437_100036 3300025233 Bacteria 469153
98 Ga0207425_1000524 3300025245 Bacteria 23426
99 Ga0209646_1000132 3300025246 Bacteria 126859
100 Ga0209026_1000313 3300025250 Bacteria 52121
101 Ga0209026_1044895 3300025250 Bacteria 636
102 Ga0209677_100419 3300025253 Bacteria 25164
103 Ga0209759_1000417 3300025256 Bacteria 52121
104 Ga0209129_1000279 3300025258 Bacteria 48588
105 Ga0209129_1000640 3300025258 Bacteria 23426
106 Ga0209129_1000795 3300025258 Bacteria 19947
107 Ga0209233_1000056 3300025261 Bacteria 438104
108 Ga0209233_1000064 3300025261 Bacteria 392156
109 Ga0209673_1000015 3300025273 Bacteria 530618
110 Ga0209673_1000683 3300025273 Bacteria 48729
111 Ga0209673_1001072 3300025273 Bacteria 31048
112 Ga0209673_1009138 3300025273 Bacteria 4327
113 Ga0209673_1029080 3300025273 Bacteria 1765
114 Ga0209673_1031927 3300025273 Bacteria 1630
115 Ga0209130_1000038 3300025284 Bacteria 264226
116 Ga0209130_1011433 3300025284 Bacteria 2376
117 Ga0209130_1051955 3300025284 Bacteria 742
118 Ga0209676_1018816 3300025292 Bacteria 2397
119 Ga0209676_1039585 3300025292 Bacteria 1337
120 Ga0209025_1000165 3300025294 Bacteria 164692
121 Ga0209025_1001738 3300025294 Bacteria 26184
122 Ga0209025_1001991 3300025294 Bacteria 23426
123 Ga0209025_1008957 3300025294 Bacteria 7076
124 Ga0209025_1063119 3300025294 Bacteria 1369
125 Ga0209564_1001249 3300025295 Bacteria 28285
126 Ga0209564_1011603 3300025295 Bacteria 3930
127 Ga0209564_1027628 3300025295 Bacteria 1837
128 Ga0209758_1000121 3300025297 Bacteria 192028
129 Ga0209758_1001831 3300025297 Bacteria 23426
130 Ga0209758_1029120 3300025297 Bacteria 2317
131 Ga0209758_1030705 3300025297 Bacteria 2221
132 Ga0209758_1075507 3300025297 Bacteria 1041
133 Ga0209050_1003961 3300025298 Bacteria 10456
134 Ga0209256_1001279 3300025299 Bacteria 27254
135 Ga0209256_1002727 3300025299 Bacteria 13667
136 Ga0209256_1023535 3300025299 Bacteria 1835
137 Ga0209256_1048728 3300025299 Bacteria 1036
138 Ga0207426_1000081 3300025302 Bacteria 304502
139 Ga0207426_1001592 3300025302 Bacteria 18158
140 Ga0207426_1075231 3300025302 Bacteria 930
141 Ga0209051_1001973 3300025303 Bacteria 15769
142 Ga0209051_1012223 3300025303 Bacteria 4165
143 Ga0209051_1043633 3300025303 Bacteria 1571
144 Ga0209257_1009681 3300025304 Bacteria 5088
145 Ga0209257_1052777 3300025304 Bacteria 1140
146 Ga0209257_1064268 3300025304 Bacteria 988
147 Ga0207710_10122840 3300025900 Bacteria 1241
148 Ga0207695_10000024 3300025913 Bacteria 632311
149 Ga0207671_10001277 3300025914 Bacteria 29618
150 Ga0207681_10188540 3300025923 Bacteria 1576
151 Ga0207694_10767877 3300025924 Bacteria 814
152 Ga0207644_10162051 3300025931 Bacteria 1739
153 Ga0207667_11155606 3300025949 Bacteria 755
154 Ga0207639_10672058 3300026041 Bacteria 959
155 Ga0207678_10189856 3300026067 Bacteria 1755
156 Ga0207675_101049121 3300026118 Bacteria 834
157 Ga0207698_10088159 3300026142 Bacteria 2530
158 Ga0209281_1000078 3300027111 Bacteria 261622
159 Ga0209281_1000164 3300027111 Bacteria 157372
160 Ga0209281_1000377 3300027111 Bacteria 71243
161 Ga0209282_1000007 3300027666 Bacteria 254917
162 Ga0268266_10015136 3300028379 Bacteria 6624
163 Ga0268266_10097794 3300028379 Bacteria 2582
164 Ga0268266_10107898 3300028379 Bacteria 2463
165 Ga0307515_10018668 3300028794 Bacteria 12526
166 Ga0307513_10514385 3300031456 Bacteria 913
167 Ga0307408_100090670 3300031548 Bacteria 2307
168 Ga0307408_100357989 3300031548 Bacteria 1240
169 Ga0316579_10175491 3300031691 Bacteria 1036
170 Ga0307405_10000740 3300031731 Bacteria 12692
171 Ga0307405_10235838 3300031731 Bacteria 1352
172 Ga0307405_10513570 3300031731 Bacteria 963
173 Ga0307405_11765972 3300031731 Bacteria 549
174 Ga0307406_10768934 3300031901 Bacteria 810
175 Ga0307412_10001859 3300031911 Bacteria 11678
176 Ga0307412_10321732 3300031911 Bacteria 1231
177 Ga0307412_10360980 3300031911 Bacteria 1170
178 Ga0315914_1000006 3300031967 Bacteria 239817
179 Ga0307409_100078385 3300031995 Bacteria 2658
180 Ga0307409_100127570 3300031995 Bacteria 2167
181 Ga0307414_10299490 3300032004 Bacteria 1360
182 Ga0315913_1000002 3300033430 Bacteria 241452
183 Ga0315915_1000001 3300033464 Bacteria 481518
184 Ga0316584_0198769 3300036712 Bacteria 1480
185 Ga0439436_0006782 3300041404 Bacteria 3520
186 Ga0439438_027989 3300041405 Bacteria 1518
187 Ga0439439_0192418 3300041406 Bacteria 591
188 Ga0439465_0005740 3300041413 Bacteria 3949
189 Ga0439465_0017997 3300041413 Bacteria 2208
190 Ga0451798_0035870 3300041458 Bacteria 1842
191 Ga0451804_0526351 3300041463 Bacteria 534
192 Ga0451837_0625152 3300041494 Bacteria 1544
193 Ga0451841_1363145 3300041498 Bacteria 591
194 Ga0451843_0401528 3300041509 Bacteria 831
195 Ga0451855_1896387 3300041511 Bacteria 1931
196 Ga0451853_2544414 3300041512 Bacteria 1396
197 Ga0439462_0008191 3300042015 Bacteria 2631
198 Ga0450918_013425 3300042531 Bacteria 1425
199 Ga0466965_0089286 3300044683 Bacteria 1566
200 Ga0466966_0159380 3300044684 Bacteria 1374
201 Ga0466963_0111467 3300044694 Bacteria 1878
202 Ga0466968_0047658 3300044735 Bacteria 1823
203 Ga0466970_0024757 3300044765 Bacteria 3139
204 Ga0466970_0062628 3300044765 Bacteria 1994
205 Ga0451576_0422227 3300045051 Bacteria 1399
206 Ga0466958_0120906 3300045836 Bacteria 1639
207 Ga0495629_0055368 3300046459 Bacteria 2773
208 Ga0495638_0000281 3300046460 Bacteria 68208
209 Ga0495638_0023467 3300046460 Bacteria 4033
210 Ga0495651_0031665 3300046462 Bacteria 4124
211 Ga0495650_0076748 3300046471 Bacteria 1298
212 Ga0495605_0023765 3300046474 Bacteria 3217
213 Ga0495585_0011348 3300046492 Bacteria 5275
214 Ga0495585_0059601 3300046492 Bacteria 2103
215 Ga0495607_0065362 3300046501 Bacteria 2051
216 Ga0495607_0229539 3300046501 Bacteria 903
217 Ga0495583_0003262 3300046506 Bacteria 12610
218 Ga0495583_0042416 3300046506 Bacteria 2125
219 Ga0495606_0001601 3300046507 Bacteria 29530
220 Ga0495606_0019113 3300046507 Bacteria 5110
221 Ga0495606_0059492 3300046507 Bacteria 2451
222 Ga0495606_0124834 3300046507 Bacteria 1536
223 Ga0495606_0147413 3300046507 Bacteria 1384
224 Ga0495610_0000618 3300046512 Bacteria 35134
225 Ga0495610_0077235 3300046512 Bacteria 1538
226 Ga0495610_0131497 3300046512 Bacteria 1086
227 Ga0495616_0057407 3300046513 Bacteria 1919
228 Ga0495620_0012939 3300046515 Bacteria 4289
229 Ga0495620_0029299 3300046515 Bacteria 2549
230 Ga0495620_0062837 3300046515 Bacteria 1541
231 Ga0495628_0240282 3300046516 Bacteria 1355
232 Ga0495631_0000470 3300046518 Bacteria 27171
233 Ga0495632_0004597 3300046519 Bacteria 9351
234 Ga0495632_0051942 3300046519 Bacteria 2016
235 Ga0495643_0047251 3300046522 Bacteria 2332
236 Ga0495643_0088715 3300046522 Bacteria 1598
237 Ga0495652_0066370 3300046529 Bacteria 3029
238 Ga0495654_0000223 3300046530 Bacteria 52992
239 Ga0495622_0017205 3300046557 Bacteria 3365
240 Ga0495633_0149648 3300046558 Bacteria 1078
241 Ga0495656_0042294 3300046615 Bacteria 1907
242 Ga0495656_0043805 3300046615 Bacteria 1881
243 Ga0495668_0015641 3300046616 Bacteria 4426
244 Ga0495668_0179964 3300046616 Bacteria 1158
245 Ga0495625_0001926 3300046660 Bacteria 23464
246 Ga0495625_0017921 3300046660 Bacteria 5535
247 Ga0495625_0113468 3300046660 Bacteria 1851
248 Ga0495625_0137014 3300046660 Bacteria 1654
249 Ga0495625_0193495 3300046660 Bacteria 1346
250 Ga0495588_0134646 3300046674 Bacteria 1304
251 Ga0495657_0226735 3300046675 Bacteria 1131
252 Ga0495623_0347184 3300046679 Bacteria 809
253 Ga0495670_0039950 3300046691 Bacteria 2340
254 Ga0495600_0174017 3300046809 Bacteria 1388
255 Ga0495604_0110470 3300047317 Bacteria 2005
256 Ga0495676_0137757 3300047321 Bacteria 1753
257 Ga0495683_0076393 3300047323 Bacteria 1639
258 Ga0495673_0063121 3300047469 Bacteria 1580
259 Ga0495673_0108665 3300047469 Bacteria 1112
260 Ga0495681_0018565 3300047470 Bacteria 3829
261 Ga0495681_0050496 3300047470 Bacteria 1960
262 Ga0495686_0003970 3300047472 Bacteria 12401
263 Ga0495686_0163648 3300047472 Bacteria 1298
264 Ga0495686_0445035 3300047472 Bacteria 689
265 Ga0495626_0212973 3300048091 Bacteria 788
266 Ga0496100_0091210 3300048903 Bacteria 2079
267 Ga0496101_0059947 3300048904 Bacteria 2760
268 Ga0496101_0289318 3300048904 Bacteria 1282
269 Ga0496101_0608267 3300048904 Bacteria 864
270 Ga0496102_0002635 3300048905 Bacteria 15245
271 Ga0496102_0259416 3300048905 Bacteria 1639
272 Ga0496103_0014923 3300048906 Bacteria 4617
273 Ga0496104_0131776 3300048907 Bacteria 2401
274 Ga0496105_0089520 3300048908 Bacteria 2542
275 Ga0496106_0055735 3300048909 Bacteria 2988
276 Ga0496106_0294561 3300048909 Bacteria 1301
277 Ga0496106_0435337 3300048909 Bacteria 1054
278 Ga0496107_0266855 3300048910 Bacteria 1274
279 Ga0496110_0066020 3300048913 Bacteria 3199
280 Ga0496111_0000142 3300048914 Bacteria 32155
281 Ga0496111_0073876 3300048914 Bacteria 2483
282 Ga0496113_0077078 3300048916 Bacteria 2548
283 Ga0496113_0428825 3300048916 Bacteria 1062
284 Ga0496113_0436412 3300048916 Bacteria 1052
285 Ga0496114_0181684 3300048917 Bacteria 1837
286 Ga0496114_0340850 3300048917 Bacteria 1325
287 Ga0496115_0694802 3300048918 Bacteria 800
288 Ga0496116_0000036 3300048919 Bacteria 388508
289 Ga0496116_0007038 3300048919 Bacteria 10073
290 Ga0496116_0007612 3300048919 Bacteria 9565
291 Ga0496116_0008710 3300048919 Bacteria 8761
292 Ga0496116_0029748 3300048919 Bacteria 3932
293 Ga0496116_0048846 3300048919 Bacteria 2835
294 Ga0496116_0079875 3300048919 Bacteria 2033
295 Ga0496116_0129062 3300048919 Bacteria 1445
296 Ga0496116_0186522 3300048919 Bacteria 1103
297 Ga0496117_0000337 3300048920 Bacteria 82874
298 Ga0496117_0001371 3300048920 Bacteria 35494
299 Ga0496117_0007162 3300048920 Bacteria 11013
300 Ga0496117_0032567 3300048920 Bacteria 3958
301 Ga0496117_0308317 3300048920 Bacteria 835
302 Ga0496118_0000396 3300048921 Bacteria 73830
303 Ga0496118_0006030 3300048921 Bacteria 13500
304 Ga0496118_0058643 3300048921 Bacteria 2874
305 Ga0496118_0060522 3300048921 Bacteria 2811
306 Ga0496118_0152793 3300048921 Bacteria 1442
307 Ga0496119_0003866 3300048922 Bacteria 15292
308 Ga0496119_0033186 3300048922 Bacteria 3427
309 Ga0496119_0057298 3300048922 Bacteria 2355
310 Ga0496119_0121277 3300048922 Bacteria 1437
311 Ga0496119_0324567 3300048922 Bacteria 752
312 Ga0496120_0099286 3300048923 Bacteria 1541
313 Ga0496120_0107773 3300048923 Bacteria 1460
314 Ga0496120_0190862 3300048923 Bacteria 999
315 Ga0496120_0383329 3300048923 Bacteria 624
316 Ga0496121_0001010 3300048924 Bacteria 50285
317 Ga0496121_0052633 3300048924 Bacteria 3417
318 Ga0496121_0092896 3300048924 Bacteria 2351
319 Ga0496121_0113565 3300048924 Bacteria 2061
320 Ga0496121_0126337 3300048924 Bacteria 1921
321 Ga0496121_0132559 3300048924 Bacteria 1862
322 Ga0496121_0146053 3300048924 Bacteria 1747
323 Ga0496121_0147894 3300048924 Bacteria 1733
324 Ga0496121_0200756 3300048924 Bacteria 1421
325 Ga0496121_0208931 3300048924 Bacteria 1384
326 Ga0496121_0246865 3300048924 Bacteria 1240
327 Ga0496121_0830779 3300048924 Bacteria 539
328 Ga0496122_0000009 3300048925 Bacteria 584024
329 Ga0496122_0000205 3300048925 Bacteria 131755
330 Ga0496122_0005041 3300048925 Bacteria 15970
331 Ga0496122_0005051 3300048925 Bacteria 15946
332 Ga0496122_0006419 3300048925 Bacteria 13506
333 Ga0496122_0009595 3300048925 Bacteria 10140
334 Ga0496122_0018263 3300048925 Bacteria 6493
335 Ga0496122_0059110 3300048925 Bacteria 2831
336 Ga0496122_0119057 3300048925 Bacteria 1708
337 Ga0496122_0212369 3300048925 Bacteria 1119
338 Ga0496122_0220670 3300048925 Bacteria 1088
339 Ga0496123_0000103 3300048926 Bacteria 168232
340 Ga0496123_0000245 3300048926 Bacteria 109471
341 Ga0496123_0003144 3300048926 Bacteria 18930
342 Ga0496123_0012018 3300048926 Bacteria 7426
343 Ga0496123_0013827 3300048926 Bacteria 6734
344 Ga0496123_0028567 3300048926 Bacteria 4124
345 Ga0496123_0044728 3300048926 Bacteria 3025
346 Ga0496123_0045945 3300048926 Bacteria 2967
347 Ga0496123_0084594 3300048926 Bacteria 1912
348 Ga0496123_0128139 3300048926 Bacteria 1412
349 Ga0496124_0001609 3300048927 Bacteria 32380
350 Ga0496124_0002681 3300048927 Bacteria 22806
351 Ga0496124_0012882 3300048927 Bacteria 8211
352 Ga0496124_0013444 3300048927 Bacteria 7989
353 Ga0496124_0013991 3300048927 Bacteria 7786
354 Ga0496124_0017562 3300048927 Bacteria 6739
355 Ga0496124_0041714 3300048927 Bacteria 3957
356 Ga0496124_0076987 3300048927 Bacteria 2752
357 Ga0496124_0139589 3300048927 Bacteria 1914
358 Ga0496124_0299907 3300048927 Bacteria 1161
359 Ga0496124_0381099 3300048927 Unclassified 986
360 Ga0496125_0000879 3300048928 Bacteria 47630
361 Ga0496125_0006309 3300048928 Bacteria 12871
362 Ga0496125_0010798 3300048928 Bacteria 9196
363 Ga0496125_0292800 3300048928 Bacteria 1001
364 Ga0496125_0293282 3300048928 Bacteria 1000
365 Ga0496125_0338936 3300048928 Bacteria 903
366 Ga0496125_0489564 3300048928 Bacteria 695
367 Ga0496126_0001035 3300048929 Bacteria 47018
368 Ga0496126_0001111 3300048929 Bacteria 45099
369 Ga0496126_0043168 3300048929 Bacteria 4160
370 Ga0496126_0072797 3300048929 Bacteria 3056
371 Ga0496126_0096598 3300048929 Bacteria 2590
372 Ga0496126_0724828 3300048929 Bacteria 770
373 Ga0495678_011246 3300049459 Bacteria 4296
374 Ga0495678_253699 3300049459 Bacteria 522
375 Ga0501031_0016406 3300049568 Bacteria 4810
376 Ga0501032_0000082 3300049569 Bacteria 82284
377 Ga0501032_0060370 3300049569 Bacteria 2543
378 Ga0501033_0000038 3300049570 Bacteria 144438
379 Ga0501033_0000070 3300049570 Bacteria 97795
380 Ga0501033_0372388 3300049570 Bacteria 998
381 Ga0501034_0000087 3300049571 Bacteria 166714
382 Ga0501034_0016781 3300049571 Bacteria 7508
383 Ga0501034_0302992 3300049571 Bacteria 1534
384 Ga0501034_0548421 3300049571 Bacteria 1065
385 Ga0501036_0000256 3300049572 Bacteria 36120
386 Ga0501036_0116052 3300049572 Bacteria 2261
387 Ga0501037_0000014 3300049573 Bacteria 171015
388 Ga0501037_0049463 3300049573 Bacteria 3078
389 Ga0501038_0000023 3300049574 Bacteria 151469
390 Ga0501038_0039847 3300049574 Bacteria 4108
391 Ga0501039_0000044 3300049575 Bacteria 108828
392 Ga0501039_0950508 3300049575 Bacteria 668
393 Ga0501043_0000088 3300049579 Bacteria 82282
394 Ga0501043_0449830 3300049579 Bacteria 968
395 Ga0501046_0166057 3300049580 Bacteria 1658
396 Ga0501046_0231837 3300049580 Bacteria 1364
397 Ga0501073_0133012 3300049589 Bacteria 1724
398 Ga0501073_0286105 3300049589 Bacteria 1137
399 Ga0501076_1152725 3300049592 Bacteria 638
400 Ga0501080_0052025 3300049742 Bacteria 3812
401 Ga0501083_0115080 3300049744 Bacteria 1766
402 Ga0501241_005912 3300049758 Bacteria 2271
403 Ga0501035_0000047 3300049822 Bacteria 146497
404 Ga0501035_0000367 3300049822 Bacteria 52067
405 Ga0501035_0179658 3300049822 Bacteria 1824
406 Ga0501044_0001585 3300049823 Bacteria 26648
407 Ga0501044_0057807 3300049823 Bacteria 3979
408 Ga0501044_0606894 3300049823 Bacteria 987
409 nmdc:mga03683_604785_c1 3300050489 Bacteria 537
410 nmdc:mga03n38_254731_c1 3300050490 Bacteria 928
411 nmdc:mga0yw44_12538_c1 3300050492 Bacteria 4424
412 nmdc:mga0yw44_21512_c1 3300050492 Bacteria 3599
413 nmdc:mga06z11_39364_c1 3300050494 Bacteria 1742
414 nmdc:mga07m45_114917_c1 3300050496 Bacteria 1552
415 nmdc:mga07m45_370349_c1 3300050496 Bacteria 832
416 nmdc:mga0sz30_31097_c1 3300050516 Bacteria 2208
417 nmdc:mga0sz30_505309_c1 3300050516 Bacteria 544
418 Ga0500610_0078477 3300053079 Bacteria 1720
419 Ga0500578_0069739 3300053086 Bacteria 2241
420 Ga0500643_016910 3300053087 Bacteria 2457
421 Ga0500557_000806 3300053105 Bacteria 4537
422 Ga0500562_037489 3300053108 Bacteria 1287
423 Ga0500569_045351 3300053109 Bacteria 1305
424 Ga0500569_117122 3300053109 Bacteria 884
425 Ga0500572_009945 3300053111 Bacteria 2261
426 Ga0500594_0000728 3300053118 Bacteria 6997
427 Ga0500618_000007 3300053125 Bacteria 226268
428 Ga0500618_003278 3300053125 Bacteria 5623
429 Ga0500618_009376 3300053125 Bacteria 2674
430 Ga0500568_0001294 3300053139 Bacteria 16421
431 Ga0500577_0066683 3300053142 Bacteria 1401
432 Ga0500588_0021150 3300053146 Bacteria 1753
433 Ga0500590_003716 3300053148 Bacteria 7089
434 Ga0500604_0282266 3300053151 Bacteria 576
435 Ga0500616_0000328 3300053153 Bacteria 68215
436 Ga0500616_0000599 3300053153 Bacteria 43738
437 Ga0500622_0099703 3300053156 Bacteria 1432
438 Ga0500624_023380 3300053157 Bacteria 1013
439 Ga0500627_0165429 3300053158 Bacteria 997
440 Ga0500634_0007251 3300053161 Bacteria 5446
441 Ga0500634_0266767 3300053161 Bacteria 700
442 Ga0500636_0000004 3300053177 Bacteria 202392
443 Ga0500636_0004687 3300053177 Bacteria 7762
444 Ga0500636_0187692 3300053177 Bacteria 1104
445 Ga0500565_046521 3300053734 Bacteria 623
446 Ga0501082_0206276 3300060353 Bacteria 1710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_0526351 Ga0451804_0526351_21_452 118
2 3300048904 Ga0496101_0289318 Ga0496101_0289318_386_805 139
3 3300003323 rootH1_10055994 rootH1_100559945 144
4 3300046507 Ga0495606_0001601 Ga0495606_0001601_27378_27851 149
5 3300013306 Ga0163162_13179662 Ga0163162_131796621 150
6 3300048913 Ga0496110_0066020 Ga0496110_0066020_1627_2100 151
7 3300048914 Ga0496111_0000142 Ga0496111_0000142_16432_16905 151
8 3300048925 Ga0496122_0212369 Ga0496122_0212369_420_893 151
9 3300048926 Ga0496123_0012018 Ga0496123_0012018_3375_3848 151
10 3300005985 Ga0081539_10002544 Ga0081539_1000254423 152
11 iso_pu_bacteria 2738543024 2739306629 152
12 iso_pu_bacteria 2989771324 2989771863 152
13 iso_pu_bacteria 2996310559 2996313156 152
14 iso_pu_bacteria 8002285264 8002287970 152
15 3300005548 Ga0070665_100021793 Ga0070665_1000217935 153
16 3300028379 Ga0268266_10015136 Ga0268266_100151365 153
17 3300046460 Ga0495638_0023467 Ga0495638_0023467_1421_1894 153
18 3300047472 Ga0495686_0163648 Ga0495686_0163648_25_498 153
19 3300049571 Ga0501034_0016781 Ga0501034_0016781_6156_6629 153
20 3300053151 Ga0500604_0282266 Ga0500604_0282266_15_488 153
21 3300053158 Ga0500627_0165429 Ga0500627_0165429_17_490 153
22 iso_pu_bacteria 2510065019 2510132115 153
23 iso_pu_bacteria 2510065057 2510304505 153
24 iso_pu_bacteria 2510917022 2511136870 153
25 iso_pu_bacteria 2510917026 2511171308 153
26 iso_pu_bacteria 2510917028 2511186467 153
27 iso_pu_bacteria 2511231052 2511500877 153
28 iso_pu_bacteria 2512875026 2512972369 153
29 iso_pu_bacteria 2513237084 2513568949 153
30 iso_pu_bacteria 2513237086 2513583585 153
31 iso_pu_bacteria 2513237088 2513596096 153
32 iso_pu_bacteria 2513237089 2513603448 153
33 iso_pu_bacteria 2513237091 2513620864 153
34 iso_pu_bacteria 2513237093 2513635767 153
35 iso_pu_bacteria 2513237103 2513709395 153
36 iso_pu_bacteria 2513237138 2513865776 153
37 iso_pu_bacteria 2513237156 2513985399 153
38 iso_pu_bacteria 2513237160 2514004903 153
39 iso_pu_bacteria 2515075009 2515111095 153
40 iso_pu_bacteria 2516653046 2516892149 153
41 iso_pu_bacteria 2516653077 2517039739 153
42 iso_pu_bacteria 2517093000 2517093861 153
43 iso_pu_bacteria 2517287029 2517405683 153
44 iso_pu_bacteria 2517487022 2517568966 153
45 iso_pu_bacteria 2519899620 2520376540 153
46 iso_pu_bacteria 2524023207 2524450202 153
47 iso_pu_bacteria 2524023209 2524457877 153
48 iso_pu_bacteria 2529292951 2530644082 153
49 iso_pu_bacteria 2534681796 2535515543 153
50 iso_pu_bacteria 2551306084 2551676338 153
51 iso_pu_bacteria 2551306085 2551687445 153
52 iso_pu_bacteria 2551306087 2551702394 153
53 iso_pu_bacteria 2551306090 2551719010 153
54 iso_pu_bacteria 2551306091 2551731111 153
55 iso_pu_bacteria 2551306092 2551737494 153
56 iso_pu_bacteria 2582581283 2585165394 153
57 iso_pu_bacteria 2582581294 2585202902 153
58 iso_pu_bacteria 2582581299 2585230561 153
59 iso_pu_bacteria 2582581304 2585256780 153
60 iso_pu_bacteria 2582581306 2585266370 153
61 iso_pu_bacteria 2582581307 2585275788 153
62 iso_pu_bacteria 2582581308 2585278764 153
63 iso_pu_bacteria 2582581316 2585329776 153
64 iso_pu_bacteria 2582581865 2585387345 153
65 iso_pu_bacteria 2582581866 2585397829 153
66 iso_pu_bacteria 2582581867 2585400302 153
67 iso_pu_bacteria 2585427527 2585535874 153
68 iso_pu_bacteria 2585427530 2585554043 153
69 iso_pu_bacteria 2585427531 2585559293 153
70 iso_pu_bacteria 2585427590 2585823026 153
71 iso_pu_bacteria 2585427594 2585844219 153
72 iso_pu_bacteria 2585427608 2585901242 153
73 iso_pu_bacteria 2585427609 2585905331 153
74 iso_pu_bacteria 2585427634 2585999440 153
75 iso_pu_bacteria 2585428125 2587979553 153
76 iso_pu_bacteria 2599185236 2599719159 153
77 iso_pu_bacteria 2615840626 2616305962 153
78 iso_pu_bacteria 2615840698 2616553794 153
79 iso_pu_bacteria 2617270742 2617381959 153
80 iso_pu_bacteria 2643221558 2643810180 153
81 iso_pu_bacteria 2643221568 2643856019 153
82 iso_pu_bacteria 2643221599 2644007749 153
83 iso_pu_bacteria 2643221607 2644046738 153
84 iso_pu_bacteria 2643221634 2644191012 153
85 iso_pu_bacteria 2643221636 2644202445 153
86 iso_pu_bacteria 2643221637 2644206361 153
87 iso_pu_bacteria 2643221643 2644242721 153
88 iso_pu_bacteria 2643221686 2644479527 153
89 iso_pu_bacteria 2643221688 2644493540 153
90 iso_pu_bacteria 2643221689 2644500853 153
91 iso_pu_bacteria 2643221718 2644650008 153
92 iso_pu_bacteria 2667528174 2671112721 153
93 iso_pu_bacteria 2718217927 2719384684 153
94 iso_pu_bacteria 2718218423 2721398394 153
95 iso_pu_bacteria 2721755809 2724037207 153
96 iso_pu_bacteria 2724679232 2725950764 153
97 iso_pu_bacteria 2738541293 2738803568 153
98 iso_pu_bacteria 2738541317 2738948571 153
99 iso_pu_bacteria 2765235942 2766067796 153
100 iso_pu_bacteria 2775507266 2778177325 153
101 iso_pu_bacteria 2791355091 2792622158 153
102 iso_pu_bacteria 2791355092 2792628277 153
103 iso_pu_bacteria 2791355256 2793298819 153
104 iso_pu_bacteria 2791355261 2793329406 153
105 iso_pu_bacteria 2791355262 2793336078 153
106 iso_pu_bacteria 2791355263 2793339967 153
107 iso_pu_bacteria 2791355265 2793353400 153
108 iso_pu_bacteria 2791355266 2793358716 153
109 iso_pu_bacteria 2802428858 2802717609 153
110 iso_pu_bacteria 2802428859 2802723464 153
111 iso_pu_bacteria 2802428860 2802731086 153
112 iso_pu_bacteria 2802428861 2802736092 153
113 iso_pu_bacteria 2802428862 2802743697 153
114 iso_pu_bacteria 2802428863 2802750591 153
115 iso_pu_bacteria 2818991448 2819612532 153
116 iso_pu_bacteria 2818991453 2819639391 153
117 iso_pu_bacteria 2837651117 2837652531 153
118 iso_pu_bacteria 2837678835 2837681348 153
119 iso_pu_bacteria 2838029111 2838031273 153
120 iso_pu_bacteria 2838042994 2838047105 153
121 iso_pu_bacteria 2838680041 2838681122 153
122 iso_pu_bacteria 2838694306 2838694845 153
123 iso_pu_bacteria 2838707686 2838708221 153
124 iso_pu_bacteria 2838736955 2838738945 153
125 iso_pu_bacteria 2841840854 2841842843 153
126 iso_pu_bacteria 2842077413 2842080545 153
127 iso_pu_bacteria 2842110456 2842115918 153
128 iso_pu_bacteria 2842118031 2842121164 153
129 iso_pu_bacteria 2842140634 2842142624 153
130 iso_pu_bacteria 2842205361 2842207862 153
131 iso_pu_bacteria 2842217011 2842220776 153
132 iso_pu_bacteria 2842237096 2842237633 153
133 iso_pu_bacteria 2842278818 2842281343 153
134 iso_pu_bacteria 2842285085 2842287292 153
135 iso_pu_bacteria 2842291075 2842294204 153
136 iso_pu_bacteria 2842298080 2842300507 153
137 iso_pu_bacteria 2842357229 2842358375 153
138 iso_pu_bacteria 2842370503 2842371585 153
139 iso_pu_bacteria 2842377471 2842380601 153
140 iso_pu_bacteria 2842384541 2842387672 153
141 iso_pu_bacteria 2842395702 2842400910 153
142 iso_pu_bacteria 2842402390 2842404560 153
143 iso_pu_bacteria 2842409023 2842410755 153
144 iso_pu_bacteria 2842415677 2842417789 153
145 iso_pu_bacteria 2842475841 2842478132 153
146 iso_pu_bacteria 2842502639 2842504941 153
147 iso_pu_bacteria 2842509118 2842509581 153
148 iso_pu_bacteria 2842521101 2842525188 153
149 iso_pu_bacteria 2852387548 2852388920 153
150 iso_pu_bacteria 2854896431 2854898682 153
151 iso_pu_bacteria 2854916844 2854921714 153
152 iso_pu_bacteria 2855825444 2855832069 153
153 iso_pu_bacteria 2855839649 2855840353 153
154 iso_pu_bacteria 2857516855 2857520487 153
155 iso_pu_bacteria 2858800743 2858800884 153
156 iso_pu_bacteria 2889790730 2889793818 153
157 iso_pu_bacteria 2889914905 2889920125 153
158 iso_pu_bacteria 2891373044 2891376519 153
159 iso_pu_bacteria 2913308742 2913313531 153
160 iso_pu_bacteria 2915980308 2915986088 153
161 iso_pu_bacteria 2915986958 2915988199 153
162 iso_pu_bacteria 2915993759 2915997918 153
163 iso_pu_bacteria 2916000859 2916005688 153
164 iso_pu_bacteria 2916007675 2916012813 153
165 iso_pu_bacteria 2916014648 2916015393 153
166 iso_pu_bacteria 2916021584 2916027592 153
167 iso_pu_bacteria 2916028427 2916034577 153
168 iso_pu_bacteria 2916035215 2916035324 153
169 iso_pu_bacteria 2916041962 2916043308 153
170 iso_pu_bacteria 2916048683 2916052464 153
171 iso_pu_bacteria 2916055098 2916057624 153
172 iso_pu_bacteria 2916061851 2916067988 153
173 iso_pu_bacteria 2916068649 2916073718 153
174 iso_pu_bacteria 2916076590 2916076754 153
175 iso_pu_bacteria 2919166419 2919167215 153
176 iso_pu_bacteria 2919171160 2919171650 153
177 iso_pu_bacteria 2919408235 2919409160 153
178 iso_pu_bacteria 2921201388 2921207660 153
179 iso_pu_bacteria 2921208531 2921212480 153
180 iso_pu_bacteria 2921237296 2921243901 153
181 iso_pu_bacteria 2921244191 2921245938 153
182 iso_pu_bacteria 2921250672 2921250872 153
183 iso_pu_bacteria 2921257292 2921261043 153
184 iso_pu_bacteria 2921263974 2921269327 153
185 iso_pu_bacteria 2921282425 2921286437 153
186 iso_pu_bacteria 2921289301 2921294032 153
187 iso_pu_bacteria 2921296804 2921300355 153
188 iso_pu_bacteria 2923556063 2923557730 153
189 iso_pu_bacteria 2924144063 2924146950 153
190 iso_pu_bacteria 2924150972 2924156288 153
191 iso_pu_bacteria 2924158325 2924160478 153
192 iso_pu_bacteria 2924165586 2924172360 153
193 iso_pu_bacteria 2924172951 2924178577 153
194 iso_pu_bacteria 2924179722 2924181520 153
195 iso_pu_bacteria 2924186466 2924190263 153
196 iso_pu_bacteria 2924193448 2924195983 153
197 iso_pu_bacteria 2924200457 2924204417 153
198 iso_pu_bacteria 2924207177 2924207453 153
199 iso_pu_bacteria 2924214083 2924215681 153
200 iso_pu_bacteria 2924221636 2924223002 153
201 iso_pu_bacteria 2924228884 2924234843 153
202 iso_pu_bacteria 2933016740 2933018823 153
203 iso_pu_bacteria 2933586486 2933592123 153
204 iso_pu_bacteria 2935894831 2935895367 153
205 iso_pu_bacteria 2936367885 2936368318 153
206 iso_pu_bacteria 2936375103 2936376151 153
207 iso_pu_bacteria 2936381700 2936386880 153
208 iso_pu_bacteria 2937002841 2937003363 153
209 iso_pu_bacteria 2937009748 2937010666 153
210 iso_pu_bacteria 2937016420 2937020789 153
211 iso_pu_bacteria 2937023124 2937028019 153
212 iso_pu_bacteria 2937029754 2937029950 153
213 iso_pu_bacteria 2937036028 2937038056 153
214 iso_pu_bacteria 2937042894 2937044621 153
215 iso_pu_bacteria 2937049772 2937052672 153
216 iso_pu_bacteria 2937056579 2937061628 153
217 iso_pu_bacteria 2937063883 2937066506 153
218 iso_pu_bacteria 2937071275 2937073785 153
219 iso_pu_bacteria 2937078374 2937083151 153
220 iso_pu_bacteria 2937084907 2937085254 153
221 iso_pu_bacteria 2937091812 2937097930 153
222 iso_pu_bacteria 2937098957 2937103722 153
223 iso_pu_bacteria 2937106411 2937111564 153
224 iso_pu_bacteria 2937113482 2937118267 153
225 iso_pu_bacteria 2937119839 2937120872 153
226 iso_pu_bacteria 2937126314 2937130179 153
227 iso_pu_bacteria 2937843397 2937846633 153
228 iso_pu_bacteria 2957375807 2957380109 153
229 iso_pu_bacteria 2957382221 2957385163 153
230 iso_pu_bacteria 2957388812 2957389226 153
231 iso_pu_bacteria 2957395598 2957398611 153
232 iso_pu_bacteria 2957402308 2957402700 153
233 iso_pu_bacteria 2957408893 2957415187 153
234 iso_pu_bacteria 2957415311 2957417992 153
235 iso_pu_bacteria 2957422303 2957425628 153
236 iso_pu_bacteria 2957430029 2957433168 153
237 iso_pu_bacteria 2957437181 2957439894 153
238 iso_pu_bacteria 2957443900 2957449934 153
239 iso_pu_bacteria 2957450854 2957453534 153
240 iso_pu_bacteria 2957457609 2957457854 153
241 iso_pu_bacteria 2957464669 2957466422 153
242 iso_pu_bacteria 2957471148 2957474009 153
243 iso_pu_bacteria 2957478035 2957483757 153
244 iso_pu_bacteria 2957484790 2957485374 153
245 iso_pu_bacteria 2957491536 2957495901 153
246 iso_pu_bacteria 2957498199 2957499784 153
247 iso_pu_bacteria 2957505466 2957510328 153
248 iso_pu_bacteria 2960584000 2960587986 153
249 iso_pu_bacteria 2960591022 2960595488 153
250 iso_pu_bacteria 2960597568 2960600669 153
251 iso_pu_bacteria 2960603979 2960604643 153
252 iso_pu_bacteria 2960610863 2960613825 153
253 iso_pu_bacteria 2960617483 2960617613 153
254 iso_pu_bacteria 2960624210 2960624671 153
255 iso_pu_bacteria 2960631154 2960633312 153
256 iso_pu_bacteria 2960637947 2960642317 153
257 iso_pu_bacteria 2960645483 2960646520 153
258 iso_pu_bacteria 2960652885 2960656823 153
259 iso_pu_bacteria 2960660292 2960662290 153
260 iso_pu_bacteria 2960667422 2960668459 153
261 iso_pu_bacteria 2960674078 2960677545 153
262 iso_pu_bacteria 2960680706 2960684078 153
263 iso_pu_bacteria 2960687367 2960691098 153
264 iso_pu_bacteria 2960693952 2960696289 153
265 iso_pu_bacteria 2964607997 2964612068 153
266 iso_pu_bacteria 2964615318 2964617589 153
267 iso_pu_bacteria 2964621998 2964622901 153
268 iso_pu_bacteria 2964628898 2964633211 153
269 iso_pu_bacteria 2964636051 2964642088 153
270 iso_pu_bacteria 2964643177 2964644429 153
271 iso_pu_bacteria 2964649959 2964653009 153
272 iso_pu_bacteria 2964656573 2964661122 153
273 iso_pu_bacteria 2964663802 2964666067 153
274 iso_pu_bacteria 2964670856 2964671201 153
275 iso_pu_bacteria 2964678106 2964683652 153
276 iso_pu_bacteria 2964685014 2964689181 153
277 iso_pu_bacteria 2964691889 2964693564 153
278 iso_pu_bacteria 2964698721 2964701907 153
279 iso_pu_bacteria 2964705432 2964712416 153
280 iso_pu_bacteria 2964712639 2964713608 153
281 iso_pu_bacteria 2964719344 2964720354 153
282 iso_pu_bacteria 2967664464 2967669682 153
283 iso_pu_bacteria 2967671571 2967673729 153
284 iso_pu_bacteria 2967678726 2967678830 153
285 iso_pu_bacteria 2967686174 2967686331 153
286 iso_pu_bacteria 2967693043 2967693151 153
287 iso_pu_bacteria 2967699805 2967703414 153
288 iso_pu_bacteria 2967706974 2967709260 153
289 iso_pu_bacteria 2967714385 2967716624 153
290 iso_pu_bacteria 2967721400 2967724764 153
291 iso_pu_bacteria 2967728569 2967730650 153
292 iso_pu_bacteria 2967735183 2967740992 153
293 iso_pu_bacteria 2967742019 2967746038 153
294 iso_pu_bacteria 2967748971 2967752199 153
295 iso_pu_bacteria 2967755722 2967757641 153
296 iso_pu_bacteria 2967762386 2967763726 153
297 iso_pu_bacteria 2967769361 2967773149 153
298 iso_pu_bacteria 2967775926 2967777221 153
299 iso_pu_bacteria 2970019648 2970020175 153
300 iso_pu_bacteria 2970026789 2970030405 153
301 iso_pu_bacteria 2970033650 2970039171 153
302 iso_pu_bacteria 2970040964 2970043006 153
303 iso_pu_bacteria 2970047711 2970050013 153
304 iso_pu_bacteria 2970054988 2970059701 153
305 iso_pu_bacteria 2970061556 2970067832 153
306 iso_pu_bacteria 2970068827 2970074927 153
307 iso_pu_bacteria 2970076120 2970076458 153
308 iso_pu_bacteria 2970082768 2970086594 153
309 iso_pu_bacteria 2970088815 2970093497 153
310 iso_pu_bacteria 2970095765 2970102279 153
311 iso_pu_bacteria 2970102677 2970108471 153
312 iso_pu_bacteria 2970109326 2970109912 153
313 iso_pu_bacteria 2970116247 2970118061 153
314 iso_pu_bacteria 2970122695 2970128263 153
315 iso_pu_bacteria 2970129317 2970129424 153
316 iso_pu_bacteria 2970136068 2970136934 153
317 iso_pu_bacteria 2970143518 2970149059 153
318 iso_pu_bacteria 2970149975 2970153908 153
319 iso_pu_bacteria 2970156795 2970164015 153
320 iso_pu_bacteria 2970164137 2970167410 153
321 iso_pu_bacteria 2970170962 2970171511 153
322 iso_pu_bacteria 2970177841 2970182229 153
323 iso_pu_bacteria 2970184632 2970189450 153
324 iso_pu_bacteria 2970191845 2970198418 153
325 iso_pu_bacteria 2977516862 2977518611 153
326 iso_pu_bacteria 2977523885 2977527182 153
327 iso_pu_bacteria 2977530762 2977533334 153
328 iso_pu_bacteria 2977537788 2977537896 153
329 iso_pu_bacteria 2977544691 2977544847 153
330 iso_pu_bacteria 2977551784 2977551892 153
331 iso_pu_bacteria 2977558990 2977563106 153
332 iso_pu_bacteria 2977565890 2977568937 153
333 iso_pu_bacteria 2977572785 2977579054 153
334 iso_pu_bacteria 2977579622 2977581588 153
335 iso_pu_bacteria 2978969890 2978973641 153
336 iso_pu_bacteria 2984587000 2984591915 153
337 iso_pu_bacteria 2989349275 2989354347 153
338 iso_pu_bacteria 2996887358 2996889474 153
339 iso_pu_bacteria 2996893221 2996895341 153
340 iso_pu_bacteria 3005409236 3005412207 153
341 iso_pu_bacteria 3005416602 3005417705 153
342 iso_pu_bacteria 3005452660 3005453265 153
343 iso_pu_bacteria 639633055 639647254 153
344 iso_pu_bacteria 648276728 648737766 153
345 iso_pu_bacteria 8003992118 8003992768 153
346 iso_pu_bacteria 8003999396 8004000098 153
347 iso_pu_bacteria 8005258706 8005260819 153
348 iso_pu_bacteria 8005275841 8005279401 153
349 iso_pu_bacteria 8005289223 8005292629 153
350 iso_pu_bacteria 8005314921 8005315060 153
351 iso_pu_bacteria 8005321885 8005324001 153
352 iso_pu_bacteria 8005376324 8005376807 153
353 iso_pu_bacteria 8005382845 8005386169 153
354 iso_pu_bacteria 8005395548 8005397434 153
355 iso_pu_bacteria 8005460587 8005461736 153
356 iso_pu_bacteria 8005484373 8005485768 153
357 iso_pu_bacteria 8005542996 8005544169 153
358 iso_pu_bacteria 8005556819 8005562942 153
359 iso_pu_bacteria 8005563573 8005570242 153
360 iso_pu_bacteria 8005645114 8005645736 153
361 iso_pu_bacteria 8005682033 8005684742 153
362 iso_pu_bacteria 8005695170 8005698969 153
363 iso_pu_bacteria 8018163183 8018168373 153
364 iso_pu_bacteria 8018176218 8018178089 153
365 iso_pu_bacteria 8024479707 8024480910 153
366 iso_pu_bacteria 8024486573 8024489925 153
367 iso_pu_bacteria 8054460903 8054461699 153
368 iso_pu_bacteria 8054558443 8054560130 153
369 iso_pu_bacteria 8055431914 8055434012 153
370 iso_pu_bacteria 8056375014 8056379386 153
371 iso_pu_bacteria 8056382006 8056384928 153
372 iso_pu_bacteria 8056875544 8056879942 153
373 iso_pu_bacteria 8057575449 8057581774 153
374 iso_pu_bacteria 8057874678 8057881791 153
375 iso_pu_bacteria 2917554339 2917558468 154
376 3300049571 Ga0501034_0302992 Ga0501034_0302992_716_1186 155
377 3300049823 Ga0501044_0606894 Ga0501044_0606894_37_507 155
378 3300002773 JGI25152J39213_1004012 JGI25152J39213_10040125 156
379 3300003187 JGI25151J46595_10004494 JGI25151J46595_100044949 156
380 3300003187 JGI25151J46595_10004666 JGI25151J46595_100046664 156
381 3300003316 rootH1_10108886 rootH1_101088862 156
382 3300005262 Ga0065165_1008323 Ga0065165_10083235 156
383 3300025258 Ga0209129_1000279 Ga0209129_10002792 156
384 3300025284 Ga0209130_1011433 Ga0209130_10114334 156
385 3300025294 Ga0209025_1001738 Ga0209025_100173827 156
386 3300025297 Ga0209758_1029120 Ga0209758_10291202 156
387 3300025303 Ga0209051_1043633 Ga0209051_10436333 156
388 3300031911 Ga0307412_10360980 Ga0307412_103609802 156
389 3300049589 Ga0501073_0133012 Ga0501073_0133012_361_837 156
390 3300053087 Ga0500643_016910 Ga0500643_016910_597_1070 156
391 2010549000 RicEn_FSXC66930_b1 RicEn_521390 157
392 3300001979 JGI24740J21852_10001010 JGI24740J21852_1000101016 157
393 3300002704 JGI25155J39150_1000089 JGI25155J39150_100008925 157
394 3300002705 JGI25156J39149_1000147 JGI25156J39149_100014724 157
395 3300002737 JGI25162J39368_1000243 JGI25162J39368_100024335 157
396 3300002738 JGI25154J39366_1000160 JGI25154J39366_100016040 157
397 3300002741 JGI25157J39369_1000190 JGI25157J39369_100019024 157
398 3300002773 JGI25152J39213_1002089 JGI25152J39213_10020892 157
399 3300002773 JGI25152J39213_1004601 JGI25152J39213_10046014 157
400 3300002774 JGI25150J39212_1000327 JGI25150J39212_100032713 157
401 3300002987 JGI25159J45721_1003582 JGI25159J45721_10035827 157
402 3300003187 JGI25151J46595_10000389 JGI25151J46595_1000038915 157
403 3300003187 JGI25151J46595_10000900 JGI25151J46595_1000090013 157
404 3300003187 JGI25151J46595_10016398 JGI25151J46595_100163984 157
405 3300003214 JGI25165J46597_1000318 JGI25165J46597_100031832 157
406 3300003215 JGI25153J46596_10019153 JGI25153J46596_100191535 157
407 3300003215 JGI25153J46596_10022060 JGI25153J46596_100220602 157
408 3300003215 JGI25153J46596_10028175 JGI25153J46596_100281752 157
409 3300003316 rootH1_10030544 rootH1_100305444 157
410 3300003322 rootL2_10020846 rootL2_100208466 157
411 3300003323 rootH1_10055359 rootH1_100553592 157
412 3300003323 rootH1_10055995 rootH1_100559954 157
413 3300003354 JGI25160J50197_1000047 JGI25160J50197_1000047132 157
414 3300003354 JGI25160J50197_1016458 JGI25160J50197_10164583 157
415 3300003374 JGI25161J50226_1000033 JGI25161J50226_1000033132 157
416 3300003771 Ga0055526_1013094 Ga0055526_10130942 157
417 3300003771 Ga0055526_1014952 Ga0055526_10149526 157
418 3300003775 Ga0055524_1008232 Ga0055524_10082322 157
419 3300003775 Ga0055524_1011719 Ga0055524_10117192 157
420 3300003775 Ga0055524_1031651 Ga0055524_10316512 157
421 3300003781 Ga0055536_1008469 Ga0055536_10084695 157
422 3300003790 Ga0055528_1000560 Ga0055528_100056027 157
423 3300003790 Ga0055528_1000659 Ga0055528_100065925 157
424 3300003790 Ga0055528_1004407 Ga0055528_10044077 157
425 3300003790 Ga0055528_1042227 Ga0055528_10422272 157
426 3300003791 Ga0055530_10010080 Ga0055530_100100802 157
427 3300003792 Ga0055540_1002220 Ga0055540_100222015 157
428 3300003794 Ga0055531_10002384 Ga0055531_1000238410 157
429 3300004625 Ga0055543_1000075 Ga0055543_100007525 157
430 3300005262 Ga0065165_1000227 Ga0065165_100022789 157
431 3300005347 Ga0070668_101230636 Ga0070668_1012306361 157
432 3300005353 Ga0070669_100196989 Ga0070669_1001969892 157
433 3300005355 Ga0070671_100058464 Ga0070671_1000584644 157
434 3300005364 Ga0070673_101478245 Ga0070673_1014782451 157
435 3300005548 Ga0070665_100138823 Ga0070665_1001388234 157
436 3300005548 Ga0070665_100531556 Ga0070665_1005315562 157
437 3300005563 Ga0068855_101290010 Ga0068855_1012900101 157
438 3300005577 Ga0068857_101146699 Ga0068857_1011466992 157
439 3300005614 Ga0068856_100035333 Ga0068856_1000353332 157
440 3300005614 Ga0068856_101100007 Ga0068856_1011000072 157
441 3300005616 Ga0068852_100123018 Ga0068852_1001230184 157
442 3300005719 Ga0068861_101473906 Ga0068861_1014739061 157
443 3300005844 Ga0068862_101504860 Ga0068862_1015048602 157
444 3300006038 Ga0075365_10003056 Ga0075365_100030563 157
445 3300006038 Ga0075365_10062309 Ga0075365_100623092 157
446 3300006048 Ga0075363_100112200 Ga0075363_1001122003 157
447 3300006048 Ga0075363_100298677 Ga0075363_1002986772 157
448 3300006178 Ga0075367_10005582 Ga0075367_100055824 157
449 3300006186 Ga0075369_10005714 Ga0075369_100057142 157
450 3300006186 Ga0075369_10030477 Ga0075369_100304771 157
451 3300006186 Ga0075369_10562977 Ga0075369_105629771 157
452 3300006353 Ga0075370_10192582 Ga0075370_101925822 157
453 3300006946 Ga0079104_1000010 Ga0079104_1000010200 157
454 3300009093 Ga0105240_10000027 Ga0105240_10000027271 157
455 3300009148 Ga0105243_10370678 Ga0105243_103706782 157
456 3300009545 Ga0105237_10001067 Ga0105237_1000106728 157
457 3300009551 Ga0105238_10506478 Ga0105238_105064782 157
458 3300009551 Ga0105238_12463967 Ga0105238_124639671 157
459 3300009765 Ga0123341_1078813 Ga0123341_10788132 157
460 3300009766 Ga0123342_1003979 Ga0123342_10039794 157
461 3300010375 Ga0105239_10013845 Ga0105239_100138459 157
462 3300013100 Ga0157373_10167226 Ga0157373_101672263 157
463 3300013102 Ga0157371_10006146 Ga0157371_100061465 157
464 3300013104 Ga0157370_10000223 Ga0157370_1000022340 157
465 3300013104 Ga0157370_10484052 Ga0157370_104840521 157
466 3300013105 Ga0157369_10011799 Ga0157369_100117992 157
467 3300013105 Ga0157369_10169672 Ga0157369_101696722 157
468 3300013105 Ga0157369_10353922 Ga0157369_103539222 157
469 3300013296 Ga0157374_10820346 Ga0157374_108203462 157
470 3300013306 Ga0163162_12500111 Ga0163162_125001112 157
471 3300014497 Ga0182008_10138880 Ga0182008_101388802 157
472 3300015265 Ga0182005_1001567 Ga0182005_10015676 157
473 3300022739 Ga0228711_1000001 Ga0228711_1000001200 157
474 3300022740 Ga0228710_1000001 Ga0228710_1000001124 157
475 3300025206 Ga0209435_100036 Ga0209435_10003640 157
476 3300025208 Ga0209436_111200 Ga0209436_1112002 157
477 3300025228 Ga0209672_107279 Ga0209672_1072792 157
478 3300025233 Ga0209437_100036 Ga0209437_100036388 157
479 3300025245 Ga0207425_1000524 Ga0207425_100052416 157
480 3300025246 Ga0209646_1000132 Ga0209646_100013240 157
481 3300025250 Ga0209026_1000313 Ga0209026_100031323 157
482 3300025250 Ga0209026_1044895 Ga0209026_10448952 157
483 3300025253 Ga0209677_100419 Ga0209677_1004195 157
484 3300025256 Ga0209759_1000417 Ga0209759_100041723 157
485 3300025258 Ga0209129_1000640 Ga0209129_100064013 157
486 3300025258 Ga0209129_1000795 Ga0209129_100079518 157
487 3300025261 Ga0209233_1000056 Ga0209233_1000056203 157
488 3300025261 Ga0209233_1000064 Ga0209233_1000064290 157
489 3300025273 Ga0209673_1000015 Ga0209673_100001517 157
490 3300025273 Ga0209673_1000683 Ga0209673_100068335 157
491 3300025273 Ga0209673_1001072 Ga0209673_100107232 157
492 3300025273 Ga0209673_1009138 Ga0209673_10091381 157
493 3300025273 Ga0209673_1029080 Ga0209673_10290803 157
494 3300025273 Ga0209673_1031927 Ga0209673_10319272 157
495 3300025284 Ga0209130_1000038 Ga0209130_1000038265 157
496 3300025284 Ga0209130_1051955 Ga0209130_10519552 157
497 3300025292 Ga0209676_1018816 Ga0209676_10188162 157
498 3300025292 Ga0209676_1039585 Ga0209676_10395852 157
499 3300025294 Ga0209025_1000165 Ga0209025_1000165103 157
500 3300025294 Ga0209025_1001991 Ga0209025_100199116 157
501 3300025294 Ga0209025_1008957 Ga0209025_10089576 157
502 3300025294 Ga0209025_1063119 Ga0209025_10631193 157
503 3300025295 Ga0209564_1001249 Ga0209564_100124927 157
504 3300025295 Ga0209564_1011603 Ga0209564_10116032 157
505 3300025295 Ga0209564_1027628 Ga0209564_10276283 157
506 3300025297 Ga0209758_1000121 Ga0209758_100012155 157
507 3300025297 Ga0209758_1001831 Ga0209758_100183116 157
508 3300025297 Ga0209758_1030705 Ga0209758_10307052 157
509 3300025297 Ga0209758_1075507 Ga0209758_10755071 157
510 3300025298 Ga0209050_1003961 Ga0209050_100396112 157
511 3300025299 Ga0209256_1001279 Ga0209256_10012799 157
512 3300025299 Ga0209256_1002727 Ga0209256_10027278 157
513 3300025299 Ga0209256_1023535 Ga0209256_10235352 157
514 3300025299 Ga0209256_1048728 Ga0209256_10487282 157
515 3300025302 Ga0207426_1000081 Ga0207426_1000081305 157
516 3300025302 Ga0207426_1001592 Ga0207426_10015924 157
517 3300025302 Ga0207426_1075231 Ga0207426_10752311 157
518 3300025303 Ga0209051_1001973 Ga0209051_100197315 157
519 3300025303 Ga0209051_1012223 Ga0209051_10122232 157
520 3300025304 Ga0209257_1009681 Ga0209257_10096817 157
521 3300025304 Ga0209257_1052777 Ga0209257_10527772 157
522 3300025304 Ga0209257_1064268 Ga0209257_10642682 157
523 3300025900 Ga0207710_10122840 Ga0207710_101228402 157
524 3300025913 Ga0207695_10000024 Ga0207695_10000024359 157
525 3300025914 Ga0207671_10001277 Ga0207671_100012777 157
526 3300025923 Ga0207681_10188540 Ga0207681_101885402 157
527 3300025924 Ga0207694_10767877 Ga0207694_107678772 157
528 3300025931 Ga0207644_10162051 Ga0207644_101620512 157
529 3300025949 Ga0207667_11155606 Ga0207667_111556062 157
530 3300026041 Ga0207639_10672058 Ga0207639_106720582 157
531 3300026067 Ga0207678_10189856 Ga0207678_101898562 157
532 3300026118 Ga0207675_101049121 Ga0207675_1010491213 157
533 3300026142 Ga0207698_10088159 Ga0207698_100881594 157
534 3300027111 Ga0209281_1000078 Ga0209281_100007881 157
535 3300027111 Ga0209281_1000164 Ga0209281_1000164105 157
536 3300027111 Ga0209281_1000377 Ga0209281_100037758 157
537 3300027666 Ga0209282_1000007 Ga0209282_100000751 157
538 3300028379 Ga0268266_10097794 Ga0268266_100977942 157
539 3300028379 Ga0268266_10107898 Ga0268266_101078983 157
540 3300028794 Ga0307515_10018668 Ga0307515_100186686 157
541 3300031456 Ga0307513_10514385 Ga0307513_105143852 157
542 3300031548 Ga0307408_100090670 Ga0307408_1000906704 157
543 3300031548 Ga0307408_100357989 Ga0307408_1003579892 157
544 3300031691 Ga0316579_10175491 Ga0316579_101754911 157
545 3300031731 Ga0307405_10000740 Ga0307405_100007401 157
546 3300031731 Ga0307405_10235838 Ga0307405_102358382 157
547 3300031731 Ga0307405_10513570 Ga0307405_105135702 157
548 3300031731 Ga0307405_11765972 Ga0307405_117659721 157
549 3300031901 Ga0307406_10768934 Ga0307406_107689342 157
550 3300031911 Ga0307412_10001859 Ga0307412_100018593 157
551 3300031911 Ga0307412_10321732 Ga0307412_103217322 157
552 3300031967 Ga0315914_1000006 Ga0315914_1000006191 157
553 3300031995 Ga0307409_100078385 Ga0307409_1000783854 157
554 3300031995 Ga0307409_100127570 Ga0307409_1001275702 157
555 3300032004 Ga0307414_10299490 Ga0307414_102994902 157
556 3300033430 Ga0315913_1000002 Ga0315913_100000251 157
557 3300033464 Ga0315915_1000001 Ga0315915_1000001435 157
558 3300036712 Ga0316584_0198769 Ga0316584_0198769_23_496 157
559 3300041404 Ga0439436_0006782 Ga0439436_0006782_1288_1764 157
560 3300041405 Ga0439438_027989 Ga0439438_027989_435_911 157
561 3300041406 Ga0439439_0192418 Ga0439439_0192418_106_579 157
562 3300041413 Ga0439465_0005740 Ga0439465_0005740_938_1414 157
563 3300041413 Ga0439465_0017997 Ga0439465_0017997_31_504 157
564 3300041458 Ga0451798_0035870 Ga0451798_0035870_1235_1711 157
565 3300041494 Ga0451837_0625152 Ga0451837_0625152_750_1223 157
566 3300041498 Ga0451841_1363145 Ga0451841_1363145_60_533 157
567 3300041509 Ga0451843_0401528 Ga0451843_0401528_247_720 157
568 3300041511 Ga0451855_1896387 Ga0451855_1896387_407_880 157
569 3300041512 Ga0451853_2544414 Ga0451853_2544414_169_642 157
570 3300042015 Ga0439462_0008191 Ga0439462_0008191_2001_2474 157
571 3300042531 Ga0450918_013425 Ga0450918_013425_605_1081 157
572 3300044683 Ga0466965_0089286 Ga0466965_0089286_381_854 157
573 3300044684 Ga0466966_0159380 Ga0466966_0159380_520_993 157
574 3300044694 Ga0466963_0111467 Ga0466963_0111467_401_874 157
575 3300044735 Ga0466968_0047658 Ga0466968_0047658_555_1028 157
576 3300044765 Ga0466970_0024757 Ga0466970_0024757_2328_2801 157
577 3300044765 Ga0466970_0062628 Ga0466970_0062628_65_538 157
578 3300045051 Ga0451576_0422227 Ga0451576_0422227_33_506 157
579 3300045836 Ga0466958_0120906 Ga0466958_0120906_338_811 157
580 3300046459 Ga0495629_0055368 Ga0495629_0055368_571_1044 157
581 3300046460 Ga0495638_0000281 Ga0495638_0000281_24573_25046 157
582 3300046462 Ga0495651_0031665 Ga0495651_0031665_1980_2453 157
583 3300046471 Ga0495650_0076748 Ga0495650_0076748_177_650 157
584 3300046474 Ga0495605_0023765 Ga0495605_0023765_956_1429 157
585 3300046492 Ga0495585_0011348 Ga0495585_0011348_1780_2253 157
586 3300046492 Ga0495585_0059601 Ga0495585_0059601_785_1258 157
587 3300046501 Ga0495607_0065362 Ga0495607_0065362_858_1331 157
588 3300046501 Ga0495607_0229539 Ga0495607_0229539_51_524 157
589 3300046506 Ga0495583_0003262 Ga0495583_0003262_7558_8031 157
590 3300046506 Ga0495583_0042416 Ga0495583_0042416_1632_2105 157
591 3300046507 Ga0495606_0019113 Ga0495606_0019113_289_762 157
592 3300046507 Ga0495606_0059492 Ga0495606_0059492_955_1428 157
593 3300046507 Ga0495606_0124834 Ga0495606_0124834_913_1386 157
594 3300046507 Ga0495606_0147413 Ga0495606_0147413_26_499 157
595 3300046512 Ga0495610_0000618 Ga0495610_0000618_21712_22185 157
596 3300046512 Ga0495610_0077235 Ga0495610_0077235_310_783 157
597 3300046512 Ga0495610_0131497 Ga0495610_0131497_47_520 157
598 3300046513 Ga0495616_0057407 Ga0495616_0057407_746_1219 157
599 3300046515 Ga0495620_0012939 Ga0495620_0012939_3078_3551 157
600 3300046515 Ga0495620_0029299 Ga0495620_0029299_912_1385 157
601 3300046515 Ga0495620_0062837 Ga0495620_0062837_817_1290 157
602 3300046516 Ga0495628_0240282 Ga0495628_0240282_668_1141 157
603 3300046518 Ga0495631_0000470 Ga0495631_0000470_13022_13495 157
604 3300046519 Ga0495632_0004597 Ga0495632_0004597_3625_4098 157
605 3300046519 Ga0495632_0051942 Ga0495632_0051942_1212_1685 157
606 3300046522 Ga0495643_0047251 Ga0495643_0047251_543_1016 157
607 3300046522 Ga0495643_0088715 Ga0495643_0088715_197_670 157
608 3300046529 Ga0495652_0066370 Ga0495652_0066370_2265_2738 157
609 3300046530 Ga0495654_0000223 Ga0495654_0000223_18331_18804 157
610 3300046557 Ga0495622_0017205 Ga0495622_0017205_236_709 157
611 3300046558 Ga0495633_0149648 Ga0495633_0149648_300_773 157
612 3300046615 Ga0495656_0042294 Ga0495656_0042294_31_507 157
613 3300046615 Ga0495656_0043805 Ga0495656_0043805_816_1289 157
614 3300046616 Ga0495668_0015641 Ga0495668_0015641_2017_2490 157
615 3300046616 Ga0495668_0179964 Ga0495668_0179964_321_794 157
616 3300046660 Ga0495625_0001926 Ga0495625_0001926_16300_16773 157
617 3300046660 Ga0495625_0017921 Ga0495625_0017921_1905_2381 157
618 3300046660 Ga0495625_0113468 Ga0495625_0113468_897_1370 157
619 3300046660 Ga0495625_0137014 Ga0495625_0137014_1058_1531 157
620 3300046660 Ga0495625_0193495 Ga0495625_0193495_457_930 157
621 3300046674 Ga0495588_0134646 Ga0495588_0134646_599_1072 157
622 3300046675 Ga0495657_0226735 Ga0495657_0226735_468_941 157
623 3300046679 Ga0495623_0347184 Ga0495623_0347184_145_618 157
624 3300046691 Ga0495670_0039950 Ga0495670_0039950_1024_1497 157
625 3300046809 Ga0495600_0174017 Ga0495600_0174017_549_1022 157
626 3300047317 Ga0495604_0110470 Ga0495604_0110470_1136_1609 157
627 3300047321 Ga0495676_0137757 Ga0495676_0137757_864_1337 157
628 3300047323 Ga0495683_0076393 Ga0495683_0076393_421_894 157
629 3300047469 Ga0495673_0063121 Ga0495673_0063121_755_1228 157
630 3300047469 Ga0495673_0108665 Ga0495673_0108665_209_682 157
631 3300047470 Ga0495681_0018565 Ga0495681_0018565_1090_1563 157
632 3300047470 Ga0495681_0050496 Ga0495681_0050496_206_679 157
633 3300047472 Ga0495686_0003970 Ga0495686_0003970_3323_3796 157
634 3300047472 Ga0495686_0445035 Ga0495686_0445035_129_602 157
635 3300048091 Ga0495626_0212973 Ga0495626_0212973_147_620 157
636 3300048903 Ga0496100_0091210 Ga0496100_0091210_682_1155 157
637 3300048904 Ga0496101_0059947 Ga0496101_0059947_2063_2536 157
638 3300048904 Ga0496101_0608267 Ga0496101_0608267_358_831 157
639 3300048905 Ga0496102_0002635 Ga0496102_0002635_2674_3147 157
640 3300048905 Ga0496102_0259416 Ga0496102_0259416_402_875 157
641 3300048906 Ga0496103_0014923 Ga0496103_0014923_3049_3522 157
642 3300048907 Ga0496104_0131776 Ga0496104_0131776_823_1296 157
643 3300048908 Ga0496105_0089520 Ga0496105_0089520_1079_1552 157
644 3300048909 Ga0496106_0055735 Ga0496106_0055735_637_1110 157
645 3300048909 Ga0496106_0294561 Ga0496106_0294561_136_609 157
646 3300048909 Ga0496106_0435337 Ga0496106_0435337_126_599 157
647 3300048910 Ga0496107_0266855 Ga0496107_0266855_721_1194 157
648 3300048914 Ga0496111_0073876 Ga0496111_0073876_1079_1552 157
649 3300048916 Ga0496113_0077078 Ga0496113_0077078_998_1471 157
650 3300048916 Ga0496113_0428825 Ga0496113_0428825_512_985 157
651 3300048916 Ga0496113_0436412 Ga0496113_0436412_43_516 157
652 3300048917 Ga0496114_0181684 Ga0496114_0181684_318_791 157
653 3300048917 Ga0496114_0340850 Ga0496114_0340850_36_509 157
654 3300048918 Ga0496115_0694802 Ga0496115_0694802_284_757 157
655 3300048919 Ga0496116_0000036 Ga0496116_0000036_121107_121586 157
656 3300048919 Ga0496116_0007038 Ga0496116_0007038_8663_9136 157
657 3300048919 Ga0496116_0007612 Ga0496116_0007612_8210_8683 157
658 3300048919 Ga0496116_0008710 Ga0496116_0008710_1680_2153 157
659 3300048919 Ga0496116_0029748 Ga0496116_0029748_1856_2329 157
660 3300048919 Ga0496116_0048846 Ga0496116_0048846_44_517 157
661 3300048919 Ga0496116_0079875 Ga0496116_0079875_950_1423 157
662 3300048919 Ga0496116_0129062 Ga0496116_0129062_190_663 157
663 3300048919 Ga0496116_0186522 Ga0496116_0186522_51_524 157
664 3300048920 Ga0496117_0000337 Ga0496117_0000337_16215_16688 157
665 3300048920 Ga0496117_0001371 Ga0496117_0001371_11759_12232 157
666 3300048920 Ga0496117_0007162 Ga0496117_0007162_7321_7794 157
667 3300048920 Ga0496117_0032567 Ga0496117_0032567_983_1456 157
668 3300048920 Ga0496117_0308317 Ga0496117_0308317_23_496 157
669 3300048921 Ga0496118_0000396 Ga0496118_0000396_66934_67407 157
670 3300048921 Ga0496118_0006030 Ga0496118_0006030_10880_11353 157
671 3300048921 Ga0496118_0058643 Ga0496118_0058643_1610_2083 157
672 3300048921 Ga0496118_0060522 Ga0496118_0060522_1664_2137 157
673 3300048921 Ga0496118_0152793 Ga0496118_0152793_17_490 157
674 3300048922 Ga0496119_0003866 Ga0496119_0003866_4011_4484 157
675 3300048922 Ga0496119_0033186 Ga0496119_0033186_1126_1599 157
676 3300048922 Ga0496119_0057298 Ga0496119_0057298_1682_2155 157
677 3300048922 Ga0496119_0121277 Ga0496119_0121277_651_1124 157
678 3300048922 Ga0496119_0324567 Ga0496119_0324567_48_521 157
679 3300048923 Ga0496120_0099286 Ga0496120_0099286_591_1064 157
680 3300048923 Ga0496120_0107773 Ga0496120_0107773_298_771 157
681 3300048923 Ga0496120_0190862 Ga0496120_0190862_207_680 157
682 3300048923 Ga0496120_0383329 Ga0496120_0383329_104_577 157
683 3300048924 Ga0496121_0001010 Ga0496121_0001010_28228_28701 157
684 3300048924 Ga0496121_0052633 Ga0496121_0052633_382_855 157
685 3300048924 Ga0496121_0092896 Ga0496121_0092896_1820_2299 157
686 3300048924 Ga0496121_0113565 Ga0496121_0113565_1000_1473 157
687 3300048924 Ga0496121_0126337 Ga0496121_0126337_801_1274 157
688 3300048924 Ga0496121_0132559 Ga0496121_0132559_453_926 157
689 3300048924 Ga0496121_0146053 Ga0496121_0146053_1200_1673 157
690 3300048924 Ga0496121_0147894 Ga0496121_0147894_524_997 157
691 3300048924 Ga0496121_0200756 Ga0496121_0200756_66_539 157
692 3300048924 Ga0496121_0208931 Ga0496121_0208931_29_502 157
693 3300048924 Ga0496121_0246865 Ga0496121_0246865_737_1210 157
694 3300048924 Ga0496121_0830779 Ga0496121_0830779_49_522 157
695 3300048925 Ga0496122_0000009 Ga0496122_0000009_142916_143389 157
696 3300048925 Ga0496122_0000205 Ga0496122_0000205_99451_99924 157
697 3300048925 Ga0496122_0005041 Ga0496122_0005041_12799_13272 157
698 3300048925 Ga0496122_0005051 Ga0496122_0005051_4290_4763 157
699 3300048925 Ga0496122_0006419 Ga0496122_0006419_10284_10757 157
700 3300048925 Ga0496122_0009595 Ga0496122_0009595_3877_4356 157
701 3300048925 Ga0496122_0018263 Ga0496122_0018263_949_1422 157
702 3300048925 Ga0496122_0059110 Ga0496122_0059110_1581_2054 157
703 3300048925 Ga0496122_0119057 Ga0496122_0119057_980_1453 157
704 3300048925 Ga0496122_0220670 Ga0496122_0220670_548_1027 157
705 3300048926 Ga0496123_0000103 Ga0496123_0000103_99451_99924 157
706 3300048926 Ga0496123_0000245 Ga0496123_0000245_52151_52624 157
707 3300048926 Ga0496123_0003144 Ga0496123_0003144_12298_12771 157
708 3300048926 Ga0496123_0013827 Ga0496123_0013827_1490_1963 157
709 3300048926 Ga0496123_0028567 Ga0496123_0028567_57_530 157
710 3300048926 Ga0496123_0044728 Ga0496123_0044728_2151_2630 157
711 3300048926 Ga0496123_0045945 Ga0496123_0045945_928_1401 157
712 3300048926 Ga0496123_0084594 Ga0496123_0084594_913_1386 157
713 3300048926 Ga0496123_0128139 Ga0496123_0128139_883_1356 157
714 3300048927 Ga0496124_0001609 Ga0496124_0001609_12223_12696 157
715 3300048927 Ga0496124_0002681 Ga0496124_0002681_6136_6609 157
716 3300048927 Ga0496124_0012882 Ga0496124_0012882_7071_7544 157
717 3300048927 Ga0496124_0013444 Ga0496124_0013444_4548_5021 157
718 3300048927 Ga0496124_0013991 Ga0496124_0013991_1680_2153 157
719 3300048927 Ga0496124_0017562 Ga0496124_0017562_3698_4171 157
720 3300048927 Ga0496124_0041714 Ga0496124_0041714_1912_2385 157
721 3300048927 Ga0496124_0076987 Ga0496124_0076987_783_1256 157
722 3300048927 Ga0496124_0139589 Ga0496124_0139589_1082_1555 157
723 3300048927 Ga0496124_0299907 Ga0496124_0299907_380_853 157
724 3300048927 Ga0496124_0381099 Ga0496124_0381099_187_666 157
725 3300048928 Ga0496125_0000879 Ga0496125_0000879_35315_35788 157
726 3300048928 Ga0496125_0006309 Ga0496125_0006309_7066_7539 157
727 3300048928 Ga0496125_0010798 Ga0496125_0010798_5524_5997 157
728 3300048928 Ga0496125_0292800 Ga0496125_0292800_488_961 157
729 3300048928 Ga0496125_0293282 Ga0496125_0293282_138_611 157
730 3300048928 Ga0496125_0338936 Ga0496125_0338936_166_639 157
731 3300048928 Ga0496125_0489564 Ga0496125_0489564_25_498 157
732 3300048929 Ga0496126_0001035 Ga0496126_0001035_12371_12844 157
733 3300048929 Ga0496126_0001111 Ga0496126_0001111_17297_17776 157
734 3300048929 Ga0496126_0043168 Ga0496126_0043168_674_1147 157
735 3300048929 Ga0496126_0072797 Ga0496126_0072797_2425_2898 157
736 3300048929 Ga0496126_0096598 Ga0496126_0096598_1151_1624 157
737 3300048929 Ga0496126_0724828 Ga0496126_0724828_75_548 157
738 3300049459 Ga0495678_011246 Ga0495678_011246_1828_2301 157
739 3300049459 Ga0495678_253699 Ga0495678_253699_17_490 157
740 3300049568 Ga0501031_0016406 Ga0501031_0016406_3287_3763 157
741 3300049569 Ga0501032_0000082 Ga0501032_0000082_27253_27729 157
742 3300049569 Ga0501032_0060370 Ga0501032_0060370_237_710 157
743 3300049570 Ga0501033_0000038 Ga0501033_0000038_108974_109447 157
744 3300049570 Ga0501033_0000070 Ga0501033_0000070_54555_55031 157
745 3300049570 Ga0501033_0372388 Ga0501033_0372388_136_609 157
746 3300049571 Ga0501034_0000087 Ga0501034_0000087_109845_110321 157
747 3300049571 Ga0501034_0548421 Ga0501034_0548421_464_937 157
748 3300049572 Ga0501036_0000256 Ga0501036_0000256_27693_28169 157
749 3300049572 Ga0501036_0116052 Ga0501036_0116052_1328_1801 157
750 3300049573 Ga0501037_0000014 Ga0501037_0000014_60715_61191 157
751 3300049573 Ga0501037_0049463 Ga0501037_0049463_694_1167 157
752 3300049574 Ga0501038_0000023 Ga0501038_0000023_41157_41633 157
753 3300049574 Ga0501038_0039847 Ga0501038_0039847_1764_2237 157
754 3300049575 Ga0501039_0000044 Ga0501039_0000044_50603_51079 157
755 3300049575 Ga0501039_0950508 Ga0501039_0950508_29_502 157
756 3300049579 Ga0501043_0000088 Ga0501043_0000088_27253_27729 157
757 3300049579 Ga0501043_0449830 Ga0501043_0449830_185_658 157
758 3300049580 Ga0501046_0166057 Ga0501046_0166057_148_624 157
759 3300049580 Ga0501046_0231837 Ga0501046_0231837_628_1101 157
760 3300049589 Ga0501073_0286105 Ga0501073_0286105_482_955 157
761 3300049592 Ga0501076_1152725 Ga0501076_1152725_51_524 157
762 3300049742 Ga0501080_0052025 Ga0501080_0052025_3235_3708 157
763 3300049744 Ga0501083_0115080 Ga0501083_0115080_834_1307 157
764 3300049758 Ga0501241_005912 Ga0501241_005912_19_492 157
765 3300049822 Ga0501035_0000047 Ga0501035_0000047_88272_88748 157
766 3300049822 Ga0501035_0000367 Ga0501035_0000367_17967_18440 157
767 3300049822 Ga0501035_0179658 Ga0501035_0179658_302_775 157
768 3300049823 Ga0501044_0001585 Ga0501044_0001585_10146_10622 157
769 3300049823 Ga0501044_0057807 Ga0501044_0057807_1579_2052 157
770 3300050489 nmdc:mga03683_604785_c1 nmdc:mga03683_604785_c1_33_506 157
771 3300050490 nmdc:mga03n38_254731_c1 nmdc:mga03n38_254731_c1_46_519 157
772 3300050492 nmdc:mga0yw44_12538_c1 nmdc:mga0yw44_12538_c1_1454_1927 157
773 3300050492 nmdc:mga0yw44_21512_c1 nmdc:mga0yw44_21512_c1_549_1022 157
774 3300050494 nmdc:mga06z11_39364_c1 nmdc:mga06z11_39364_c1_790_1263 157
775 3300050496 nmdc:mga07m45_114917_c1 nmdc:mga07m45_114917_c1_865_1338 157
776 3300050496 nmdc:mga07m45_370349_c1 nmdc:mga07m45_370349_c1_311_784 157
777 3300050516 nmdc:mga0sz30_31097_c1 nmdc:mga0sz30_31097_c1_76_549 157
778 3300050516 nmdc:mga0sz30_505309_c1 nmdc:mga0sz30_505309_c1_19_492 157
779 3300053079 Ga0500610_0078477 Ga0500610_0078477_1079_1552 157
780 3300053086 Ga0500578_0069739 Ga0500578_0069739_742_1215 157
781 3300053105 Ga0500557_000806 Ga0500557_000806_3017_3490 157
782 3300053108 Ga0500562_037489 Ga0500562_037489_334_807 157
783 3300053109 Ga0500569_045351 Ga0500569_045351_733_1206 157
784 3300053109 Ga0500569_117122 Ga0500569_117122_326_802 157
785 3300053111 Ga0500572_009945 Ga0500572_009945_779_1258 157
786 3300053118 Ga0500594_0000728 Ga0500594_0000728_1676_2149 157
787 3300053125 Ga0500618_000007 Ga0500618_000007_45202_45675 157
788 3300053125 Ga0500618_003278 Ga0500618_003278_2470_2943 157
789 3300053125 Ga0500618_009376 Ga0500618_009376_1413_1886 157
790 3300053139 Ga0500568_0001294 Ga0500568_0001294_1856_2329 157
791 3300053142 Ga0500577_0066683 Ga0500577_0066683_279_752 157
792 3300053146 Ga0500588_0021150 Ga0500588_0021150_1243_1716 157
793 3300053148 Ga0500590_003716 Ga0500590_003716_4450_4923 157
794 3300053153 Ga0500616_0000328 Ga0500616_0000328_9766_10239 157
795 3300053153 Ga0500616_0000599 Ga0500616_0000599_17636_18109 157
796 3300053156 Ga0500622_0099703 Ga0500622_0099703_915_1388 157
797 3300053157 Ga0500624_023380 Ga0500624_023380_498_974 157
798 3300053161 Ga0500634_0007251 Ga0500634_0007251_2945_3418 157
799 3300053161 Ga0500634_0266767 Ga0500634_0266767_85_561 157
800 3300053177 Ga0500636_0000004 Ga0500636_0000004_180088_180567 157
801 3300053177 Ga0500636_0004687 Ga0500636_0004687_6506_6985 157
802 3300053177 Ga0500636_0187692 Ga0500636_0187692_365_838 157
803 3300053734 Ga0500565_046521 Ga0500565_046521_134_610 157
804 3300060353 Ga0501082_0206276 Ga0501082_0206276_542_1015 157
805 iso_pu_bacteria 2513237159 2513999396 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

12

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.9529 2 45
5zng-assembly1.cif.gz_A the crystal complex of immune receptor rga5a_s of pia from rice (oryzae sativa) with rice blast (magnaporthe oryzae) effector protein avr1-co39 0.9007 86 132
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8783 2 45
7nlj-assembly1.cif.gz_A complex of rice blast (magnaporthe oryzae) effector protein apikl2a with host target shma25 from setaria italica 0.8543 87 132
8b2r-assembly1.cif.gz_A complex of rice blast (magnaporthe oryzae) effector protein avr-pikf with a rice (oryza sativa) rga5 hma domain mutant. 0.8458 87 146
ID Description Score Start End Superfamily
5zngA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9007 86 132 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8895 88 131 3.30.70.100
af_I1LL17_38_112_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8466 89 146 3.30.70.100
af_Q9C5D3_169_235_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8445 86 146 3.30.70.100
af_A0A1D6KPQ3_20_86_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8429 86 146 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Y9EXY4-F1-model_v4 Sodium:proton antiporter 0.9385 52 157 GO:0005886
GO:0008324
AF-A0A2N6A1Z0-F1-model_v4 Cation:proton antiporter 0.9381 50 157 GO:0005886
GO:0008324
AF-A0A1X7GCM3-F1-model_v4 Multicomponent Na+:H+ antiporter subunit E 0.9345 50 157 GO:0005886
GO:0008324
AF-A0A391N4B9-F1-model_v4 Na(+)/H(+) antiporter subunit E 0.9329 47 157 GO:0005886
GO:0008324
AF-A0A6G4N3V1-F1-model_v4 Na+/H+ antiporter subunit E 0.9313 80 154 GO:0005886
GO:0008324
GO:0015297

Feature Viewer

pLDDT pTM Quality
85.22 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map