F481455

General Info

Members Datasets Scaffolds Average Seq Length
802 308 1604 145

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100965248|Ga0070696_1009652482
Length 153
Sequence VSEGLPRVRVSALLRWQSRVLLCRQEKPGKEYWMLPGGGVDGGETLLRALWRELEEEVGLPQEQALEGPIAVAESIAPDWKPGGRHVVHIVFGADLSHRSLEDVESRDAAVRGLRLFSLEELEDVVVHPPIKRFLQRWRPGDPAVYLGSLWVR

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.1
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 8.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100965248 3300005546 Bacteria 710
2 Ga0070658_10124310 3300005327 Bacteria 2146
3 Ga0070658_10343226 3300005327 Bacteria 1277
4 Ga0070658_10606457 3300005327 Bacteria 949
5 Ga0070658_10809555 3300005327 Bacteria 814
6 Ga0070683_100076297 3300005329 Bacteria 3133
7 Ga0070683_100090265 3300005329 Bacteria 2877
8 Ga0070683_100351431 3300005329 Bacteria 1404
9 Ga0070683_100866834 3300005329 Bacteria 866
10 Ga0070683_102123429 3300005329 Unclassified 539
11 Ga0068869_100131113 3300005334 Bacteria 1927
12 Ga0070680_100045576 3300005336 Bacteria 3565
13 Ga0070680_100234783 3300005336 Bacteria 1549
14 Ga0070680_100885278 3300005336 Bacteria 770
15 Ga0070680_100952105 3300005336 Bacteria 741
16 Ga0070682_100062400 3300005337 Bacteria 2361
17 Ga0070682_100814986 3300005337 Bacteria 760
18 Ga0068868_100010799 3300005338 Bacteria 6624
19 Ga0068868_100941771 3300005338 Bacteria 787
20 Ga0070660_100002352 3300005339 Bacteria 12989
21 Ga0070660_100005889 3300005339 Bacteria 8480
22 Ga0070660_100023989 3300005339 Bacteria 4523
23 Ga0070660_100094004 3300005339 Bacteria 2368
24 Ga0070660_101392375 3300005339 Unclassified 596
25 Ga0070689_100125549 3300005340 Bacteria 2053
26 Ga0070689_100309573 3300005340 Unclassified 1317
27 Ga0070689_101069124 3300005340 Unclassified 720
28 Ga0070661_100008922 3300005344 Bacteria 6939
29 Ga0070661_100068325 3300005344 Bacteria 2611
30 Ga0070661_100155711 3300005344 Bacteria 1729
31 Ga0070661_100407385 3300005344 Bacteria 1076
32 Ga0070661_100979963 3300005344 Bacteria 701
33 Ga0070668_100313895 3300005347 Bacteria 1318
34 Ga0070668_100395285 3300005347 Bacteria 1179
35 Ga0070669_100611154 3300005353 Bacteria 914
36 Ga0070669_100740767 3300005353 Bacteria 832
37 Ga0070675_100050229 3300005354 Bacteria 3424
38 Ga0070675_100356315 3300005354 Unclassified 1298
39 Ga0070674_101136295 3300005356 Bacteria 691
40 Ga0070673_100342940 3300005364 Bacteria 1324
41 Ga0070673_100638433 3300005364 Unclassified 974
42 Ga0070659_100016427 3300005366 Bacteria 5558
43 Ga0070659_100062058 3300005366 Bacteria 2954
44 Ga0070659_100065967 3300005366 Bacteria 2868
45 Ga0070659_100404443 3300005366 Bacteria 1153
46 Ga0070659_101363856 3300005366 Bacteria 630
47 Ga0070709_10074822 3300005434 Bacteria 2195
48 Ga0070709_10806703 3300005434 Bacteria 737
49 Ga0070714_100048146 3300005435 Bacteria 3624
50 Ga0070714_100793767 3300005435 Bacteria 917
51 Ga0070714_100999601 3300005435 Bacteria 814
52 Ga0070714_101723747 3300005435 Bacteria 612
53 Ga0070713_100326383 3300005436 Bacteria 1418
54 Ga0070713_101078635 3300005436 Bacteria 776
55 Ga0070701_10110536 3300005438 Bacteria 1535
56 Ga0070701_10519854 3300005438 Bacteria 776
57 Ga0070711_100044029 3300005439 Bacteria 3027
58 Ga0070711_100207302 3300005439 Bacteria 1516
59 Ga0070705_100165761 3300005440 Unclassified 1482
60 Ga0070700_100214549 3300005441 Bacteria 1360
61 Ga0070700_100380952 3300005441 Bacteria 1055
62 Ga0070694_100082597 3300005444 Bacteria 2238
63 Ga0070694_100145458 3300005444 Bacteria 1726
64 Ga0070694_100270887 3300005444 Bacteria 1291
65 Ga0070708_101253663 3300005445 Bacteria 693
66 Ga0070663_100136808 3300005455 Bacteria 1866
67 Ga0070663_100252502 3300005455 Bacteria 1396
68 Ga0070678_100879552 3300005456 Bacteria 818
69 Ga0070681_10001211 3300005458 Bacteria 22450
70 Ga0070681_10006154 3300005458 Bacteria 11657
71 Ga0070681_10024508 3300005458 Bacteria 6073
72 Ga0070681_10216002 3300005458 Bacteria 1833
73 Ga0070681_10450732 3300005458 Bacteria 1199
74 Ga0070681_10670737 3300005458 Bacteria 952
75 Ga0070681_11121321 3300005458 Bacteria 708
76 Ga0068867_100469403 3300005459 Bacteria 1076
77 Ga0070685_10128816 3300005466 Bacteria 1580
78 Ga0070685_10660088 3300005466 Unclassified 759
79 Ga0070706_101153024 3300005467 Unclassified 713
80 Ga0070698_100425159 3300005471 Bacteria 1263
81 Ga0070698_100896785 3300005471 Bacteria 832
82 Ga0070699_100529217 3300005518 Bacteria 1072
83 Ga0070679_100018501 3300005530 Bacteria 6762
84 Ga0070679_100043990 3300005530 Bacteria 4447
85 Ga0070679_100101945 3300005530 Bacteria 2857
86 Ga0070679_100129670 3300005530 Bacteria 2503
87 Ga0070679_100192070 3300005530 Bacteria 2010
88 Ga0070679_101328334 3300005530 Unclassified 665
89 Ga0070684_100000250 3300005535 Bacteria 37184
90 Ga0070684_100107435 3300005535 Bacteria 2499
91 Ga0070684_100174590 3300005535 Bacteria 1952
92 Ga0070684_100512200 3300005535 Bacteria 1112
93 Ga0070684_101104827 3300005535 Unclassified 745
94 Ga0068853_101012533 3300005539 Bacteria 800
95 Ga0070686_100177299 3300005544 Bacteria 1512
96 Ga0070686_100182041 3300005544 Bacteria 1494
97 Ga0070695_100599314 3300005545 Unclassified 865
98 Ga0070696_100011162 3300005546 Bacteria 6011
99 Ga0070696_101598383 3300005546 Bacteria 560
100 Ga0070693_100056213 3300005547 Bacteria 2270
101 Ga0070693_100347283 3300005547 Bacteria 1014
102 Ga0070693_100508125 3300005547 Bacteria 856
103 Ga0070665_100072181 3300005548 Bacteria 3460
104 Ga0070665_100146064 3300005548 Bacteria 2368
105 Ga0070665_100318038 3300005548 Bacteria 1561
106 Ga0070704_100249105 3300005549 Bacteria 1458
107 Ga0068855_100036020 3300005563 Bacteria 5891
108 Ga0068855_100047718 3300005563 Bacteria 5059
109 Ga0068855_100081419 3300005563 Bacteria 3753
110 Ga0068855_100081606 3300005563 Bacteria 3748
111 Ga0068855_100095467 3300005563 Bacteria 3427
112 Ga0068855_100130908 3300005563 Bacteria 2865
113 Ga0068855_101342378 3300005563 Bacteria 739
114 Ga0070664_100561279 3300005564 Bacteria 1056
115 Ga0068857_100002162 3300005577 Bacteria 15982
116 Ga0068854_100026502 3300005578 Bacteria 3985
117 Ga0068854_100273459 3300005578 Bacteria 1357
118 Ga0068854_100573594 3300005578 Bacteria 960
119 Ga0068856_100050117 3300005614 Bacteria 4116
120 Ga0068856_100093676 3300005614 Bacteria 2990
121 Ga0068856_100312709 3300005614 Bacteria 1588
122 Ga0068856_100635847 3300005614 Bacteria 1088
123 Ga0070702_100131202 3300005615 Bacteria 1583
124 Ga0070702_100435071 3300005615 Unclassified 948
125 Ga0068852_100485011 3300005616 Bacteria 1229
126 Ga0068852_100796346 3300005616 Bacteria 959
127 Ga0068852_101545465 3300005616 Unclassified 686
128 Ga0068852_101640944 3300005616 Unclassified 665
129 Ga0068864_101014582 3300005618 Unclassified 823
130 Ga0068866_10040831 3300005718 Bacteria 2299
131 Ga0068861_100713463 3300005719 Bacteria 933
132 Ga0068870_10049495 3300005840 Bacteria 2217
133 Ga0068858_100248979 3300005842 Bacteria 1687
134 Ga0068860_100298761 3300005843 Bacteria 1577
135 Ga0068862_100385367 3300005844 Bacteria 1308
136 Ga0081455_10080323 3300005937 Bacteria 2674
137 Ga0070717_10051446 3300006028 Bacteria 3390
138 Ga0070717_10159985 3300006028 Bacteria 1953
139 Ga0070715_10033961 3300006163 Bacteria 2088
140 Ga0070716_100968517 3300006173 Bacteria 671
141 Ga0070712_100303112 3300006175 Bacteria 1294
142 Ga0070712_100353752 3300006175 Bacteria 1203
143 Ga0097621_100056373 3300006237 Bacteria 3210
144 Ga0068871_100245529 3300006358 Bacteria 1558
145 Ga0068871_100258438 3300006358 Bacteria 1519
146 Ga0075433_10178710 3300006852 Bacteria 1888
147 Ga0075433_11196211 3300006852 Bacteria 660
148 Ga0075434_100003594 3300006871 Bacteria 13853
149 Ga0075434_101778816 3300006871 Bacteria 623
150 Ga0068865_100032727 3300006881 Bacteria 3476
151 Ga0068865_101181939 3300006881 Unclassified 676
152 Ga0075436_100010977 3300006914 Bacteria 6219
153 Ga0075435_100017896 3300007076 Bacteria 5372
154 Ga0075435_100273568 3300007076 Bacteria 1441
155 Ga0075435_100804868 3300007076 Bacteria 818
156 Ga0099794_10420716 3300007265 Bacteria 699
157 Ga0105240_10198685 3300009093 Bacteria 2352
158 Ga0105240_10286551 3300009093 Bacteria 1890
159 Ga0105240_10324900 3300009093 Bacteria 1752
160 Ga0105240_10917517 3300009093 Bacteria 941
161 Ga0105240_11526507 3300009093 Bacteria 700
162 Ga0111539_10192044 3300009094 Bacteria 2383
163 Ga0105245_10123593 3300009098 Bacteria 2420
164 Ga0105245_10561839 3300009098 Bacteria 1164
165 Ga0105247_10011568 3300009101 Bacteria 5316
166 Ga0114129_10121910 3300009147 Bacteria 3588
167 Ga0114129_10532318 3300009147 Bacteria 1531
168 Ga0114129_11767202 3300009147 Unclassified 753
169 Ga0105243_10135309 3300009148 Bacteria 2096
170 Ga0105243_10863660 3300009148 Bacteria 897
171 Ga0105243_11008981 3300009148 Bacteria 835
172 Ga0105241_10024319 3300009174 Bacteria 4498
173 Ga0105241_10587997 3300009174 Bacteria 1004
174 Ga0105241_11168457 3300009174 Bacteria 728
175 Ga0105242_10221894 3300009176 Bacteria 1690
176 Ga0105242_10457813 3300009176 Bacteria 1204
177 Ga0105242_11675413 3300009176 Bacteria 671
178 Ga0105248_10172714 3300009177 Bacteria 2436
179 Ga0105237_10052617 3300009545 Bacteria 4087
180 Ga0105237_10233681 3300009545 Bacteria 1839
181 Ga0105237_11792631 3300009545 Bacteria 621
182 Ga0105238_10013187 3300009551 Bacteria 8342
183 Ga0105238_10108439 3300009551 Bacteria 2758
184 Ga0105238_11136067 3300009551 Bacteria 805
185 Ga0105249_10071305 3300009553 Bacteria 3209
186 Ga0105249_10244879 3300009553 Bacteria 1774
187 Ga0105249_11121659 3300009553 Unclassified 857
188 Ga0105239_10187270 3300010375 Bacteria 2316
189 Ga0105239_10326379 3300010375 Bacteria 1731
190 Ga0105239_10613079 3300010375 Bacteria 1242
191 Ga0105239_10757979 3300010375 Bacteria 1111
192 Ga0105239_11027049 3300010375 Bacteria 948
193 Ga0105239_11426155 3300010375 Bacteria 800
194 Ga0105239_12121636 3300010375 Unclassified 653
195 Ga0105246_10018170 3300011119 Bacteria 4479
196 Ga0105246_10359596 3300011119 Bacteria 1196
197 Ga0157373_10774514 3300013100 Bacteria 706
198 Ga0157373_11049168 3300013100 Bacteria 610
199 Ga0157371_11372247 3300013102 Bacteria 548
200 Ga0157370_10132064 3300013104 Bacteria 2329
201 Ga0157370_10180672 3300013104 Bacteria 1961
202 Ga0157370_10605480 3300013104 Bacteria 1003
203 Ga0157370_11120916 3300013104 Unclassified 711
204 Ga0157369_10071417 3300013105 Bacteria 3727
205 Ga0157369_10172259 3300013105 Bacteria 2280
206 Ga0157369_10216570 3300013105 Bacteria 2006
207 Ga0157369_10222969 3300013105 Bacteria 1973
208 Ga0157369_10499722 3300013105 Bacteria 1258
209 Ga0157369_10908724 3300013105 Bacteria 903
210 Ga0157374_10029908 3300013296 Bacteria 4941
211 Ga0157374_10669362 3300013296 Bacteria 1050
212 Ga0157374_11483943 3300013296 Bacteria 701
213 Ga0157374_12405036 3300013296 Bacteria 554
214 Ga0157378_10378171 3300013297 Bacteria 1390
215 Ga0157378_10466830 3300013297 Bacteria 1255
216 Ga0163162_12381069 3300013306 Unclassified 609
217 Ga0157372_10066429 3300013307 Bacteria 4052
218 Ga0157372_10140424 3300013307 Bacteria 2782
219 Ga0157372_10165956 3300013307 Bacteria 2553
220 Ga0157372_10396235 3300013307 Bacteria 1609
221 Ga0157372_11165550 3300013307 Unclassified 891
222 Ga0157375_10282868 3300013308 Bacteria 1822
223 Ga0157375_10725446 3300013308 Bacteria 1146
224 Ga0163163_10008013 3300014325 Bacteria 9351
225 Ga0157380_10230534 3300014326 Bacteria 1663
226 Ga0157377_10003132 3300014745 Bacteria 7446
227 Ga0157377_10145271 3300014745 Bacteria 1461
228 Ga0157379_10038303 3300014968 Bacteria 4278
229 Ga0157379_10556144 3300014968 Bacteria 1068
230 Ga0157376_10023167 3300014969 Bacteria 4856
231 Ga0157376_10086590 3300014969 Bacteria 2702
232 Ga0157376_11961929 3300014969 Unclassified 623
233 Ga0206356_10859772 3300020070 Bacteria 2818
234 Ga0206356_11244172 3300020070 Bacteria 1890
235 Ga0206356_11453522 3300020070 Bacteria 939
236 Ga0206354_10308263 3300020081 Bacteria 4394
237 Ga0206353_10470091 3300020082 Bacteria 1204
238 Ga0206353_10926494 3300020082 Bacteria 1412
239 Ga0213874_10103019 3300021377 Bacteria 951
240 Ga0213871_10023264 3300021441 Bacteria 1559
241 Ga0224712_10192891 3300022467 Bacteria 923
242 Ga0207692_10587043 3300025898 Bacteria 715
243 Ga0207642_10162430 3300025899 Bacteria 1201
244 Ga0207642_10669678 3300025899 Bacteria 652
245 Ga0207710_10009744 3300025900 Bacteria 4037
246 Ga0207688_10011879 3300025901 Bacteria 4740
247 Ga0207688_10259682 3300025901 Unclassified 1054
248 Ga0207680_10060864 3300025903 Bacteria 2300
249 Ga0207699_10338003 3300025906 Bacteria 1060
250 Ga0207654_10025331 3300025911 Bacteria 3199
251 Ga0207654_10385017 3300025911 Bacteria 972
252 Ga0207707_10007562 3300025912 Bacteria 9465
253 Ga0207707_10053474 3300025912 Bacteria 3515
254 Ga0207707_10070905 3300025912 Bacteria 3036
255 Ga0207707_10328666 3300025912 Bacteria 1319
256 Ga0207707_10535465 3300025912 Bacteria 996
257 Ga0207707_10572924 3300025912 Bacteria 958
258 Ga0207707_11046170 3300025912 Bacteria 668
259 Ga0207695_10171531 3300025913 Bacteria 2095
260 Ga0207671_10076666 3300025914 Bacteria 2502
261 Ga0207671_10094543 3300025914 Bacteria 2256
262 Ga0207671_10183310 3300025914 Bacteria 1630
263 Ga0207671_10591576 3300025914 Bacteria 884
264 Ga0207693_10124223 3300025915 Bacteria 2028
265 Ga0207693_10294725 3300025915 Unclassified 1271
266 Ga0207693_10589030 3300025915 Bacteria 866
267 Ga0207693_10651565 3300025915 Bacteria 818
268 Ga0207663_10289598 3300025916 Bacteria 1219
269 Ga0207663_10321089 3300025916 Unclassified 1163
270 Ga0207663_10573623 3300025916 Unclassified 884
271 Ga0207663_10752257 3300025916 Bacteria 774
272 Ga0207660_10017445 3300025917 Bacteria 4770
273 Ga0207660_10017816 3300025917 Bacteria 4726
274 Ga0207660_10315680 3300025917 Bacteria 1247
275 Ga0207660_10807295 3300025917 Unclassified 766
276 Ga0207660_10850234 3300025917 Bacteria 745
277 Ga0207662_10091336 3300025918 Bacteria 1873
278 Ga0207657_10003977 3300025919 Bacteria 15705
279 Ga0207657_10005514 3300025919 Bacteria 13210
280 Ga0207657_10006045 3300025919 Bacteria 12582
281 Ga0207657_10011616 3300025919 Bacteria 8734
282 Ga0207657_10037356 3300025919 Bacteria 4338
283 Ga0207657_10645388 3300025919 Bacteria 824
284 Ga0207649_10034276 3300025920 Bacteria 3040
285 Ga0207649_10129540 3300025920 Bacteria 1712
286 Ga0207649_10408685 3300025920 Bacteria 1017
287 Ga0207649_10672029 3300025920 Bacteria 802
288 Ga0207649_11080277 3300025920 Unclassified 633
289 Ga0207652_10004445 3300025921 Bacteria 11420
290 Ga0207652_10063362 3300025921 Bacteria 3197
291 Ga0207652_10111726 3300025921 Bacteria 2424
292 Ga0207652_10354970 3300025921 Bacteria 1323
293 Ga0207652_10820998 3300025921 Bacteria 825
294 Ga0207652_11094366 3300025921 Bacteria 697
295 Ga0207681_10951633 3300025923 Bacteria 720
296 Ga0207694_10031169 3300025924 Bacteria 4072
297 Ga0207694_10627813 3300025924 Bacteria 904
298 Ga0207694_10821555 3300025924 Bacteria 785
299 Ga0207650_10378471 3300025925 Unclassified 1169
300 Ga0207659_10293146 3300025926 Unclassified 1334
301 Ga0207687_10004237 3300025927 Bacteria 9590
302 Ga0207687_10083146 3300025927 Bacteria 2317
303 Ga0207687_10938467 3300025927 Bacteria 741
304 Ga0207700_10548297 3300025928 Unclassified 1026
305 Ga0207664_10537782 3300025929 Bacteria 1048
306 Ga0207664_10592432 3300025929 Unclassified 995
307 Ga0207664_10761727 3300025929 Bacteria 871
308 Ga0207664_11026260 3300025929 Bacteria 739
309 Ga0207664_11279163 3300025929 Bacteria 653
310 Ga0207644_10535388 3300025931 Bacteria 969
311 Ga0207690_10035494 3300025932 Bacteria 3221
312 Ga0207690_10147847 3300025932 Bacteria 1739
313 Ga0207690_10235268 3300025932 Bacteria 1408
314 Ga0207690_10378482 3300025932 Bacteria 1124
315 Ga0207690_10416799 3300025932 Bacteria 1074
316 Ga0207706_10069229 3300025933 Bacteria 3104
317 Ga0207709_10078734 3300025935 Bacteria 2117
318 Ga0207670_10143722 3300025936 Bacteria 1762
319 Ga0207670_10630915 3300025936 Bacteria 882
320 Ga0207669_10019902 3300025937 Bacteria 3506
321 Ga0207704_10327523 3300025938 Bacteria 1184
322 Ga0207665_10030025 3300025939 Bacteria 3592
323 Ga0207711_10860552 3300025941 Bacteria 843
324 Ga0207689_10011471 3300025942 Bacteria 7595
325 Ga0207661_10028651 3300025944 Bacteria 4267
326 Ga0207661_10326308 3300025944 Bacteria 1381
327 Ga0207661_10580822 3300025944 Bacteria 1028
328 Ga0207661_10595452 3300025944 Bacteria 1015
329 Ga0207679_11488638 3300025945 Bacteria 621
330 Ga0207667_10023514 3300025949 Bacteria 6785
331 Ga0207667_10048297 3300025949 Bacteria 4501
332 Ga0207667_10141333 3300025949 Bacteria 2478
333 Ga0207667_10196978 3300025949 Bacteria 2067
334 Ga0207667_10533182 3300025949 Bacteria 1188
335 Ga0207667_10612497 3300025949 Unclassified 1097
336 Ga0207712_10041383 3300025961 Bacteria 3166
337 Ga0207712_10144896 3300025961 Bacteria 1827
338 Ga0207668_10522944 3300025972 Bacteria 1024
339 Ga0207640_10043974 3300025981 Bacteria 2858
340 Ga0207640_10503988 3300025981 Bacteria 1009
341 Ga0207677_10006522 3300026023 Bacteria 6408
342 Ga0207677_10414514 3300026023 Bacteria 1146
343 Ga0207703_10070287 3300026035 Bacteria 2889
344 Ga0207703_11027523 3300026035 Bacteria 791
345 Ga0207678_10172388 3300026067 Bacteria 1847
346 Ga0207678_10195005 3300026067 Bacteria 1731
347 Ga0207678_10618074 3300026067 Bacteria 951
348 Ga0207708_10009849 3300026075 Bacteria 7093
349 Ga0207708_10017816 3300026075 Bacteria 5345
350 Ga0207702_10114925 3300026078 Bacteria 2399
351 Ga0207702_10374591 3300026078 Bacteria 1368
352 Ga0207702_10682761 3300026078 Bacteria 1011
353 Ga0207674_10002083 3300026116 Bacteria 25331
354 Ga0207674_10112588 3300026116 Bacteria 2695
355 Ga0207675_100602663 3300026118 Bacteria 1102
356 Ga0207675_100630140 3300026118 Bacteria 1077
357 Ga0207683_10648284 3300026121 Bacteria 978
358 Ga0207698_10578362 3300026142 Bacteria 1105
359 Ga0207698_10747567 3300026142 Bacteria 976
360 Ga0207698_11386045 3300026142 Bacteria 718
361 Ga0207698_11580635 3300026142 Unclassified 671
362 Ga0207428_10109758 3300027907 Bacteria 2124
363 Ga0268266_10055904 3300028379 Bacteria 3394
364 Ga0268266_10236597 3300028379 Bacteria 1684
365 Ga0268266_10253135 3300028379 Bacteria 1630
366 Ga0268265_10460456 3300028380 Bacteria 1190
367 Ga0268264_10130825 3300028381 Bacteria 2224
368 Ga0268264_10691142 3300028381 Unclassified 1013
369 Ga0265326_10101544 3300028558 Bacteria 816
370 Ga0265334_10112907 3300028573 Bacteria 975
371 Ga0265318_10017960 3300028577 Bacteria 2895
372 Ga0265318_10054636 3300028577 Bacteria 1496
373 Ga0265318_10066103 3300028577 Bacteria 1344
374 Ga0265322_10011308 3300028654 Bacteria 2589
375 Ga0265338_10013856 3300028800 Bacteria 9057
376 Ga0265338_10051579 3300028800 Bacteria 3702
377 Ga0265338_10060338 3300028800 Bacteria 3334
378 Ga0265338_10144842 3300028800 Bacteria 1855
379 Ga0265338_10342268 3300028800 Bacteria 1077
380 Ga0265330_10074404 3300031235 Bacteria 1468
381 Ga0265325_10027275 3300031241 Bacteria 3088
382 Ga0265340_10030522 3300031247 Bacteria 2701
383 Ga0265340_10172819 3300031247 Bacteria 978
384 Ga0265339_10090713 3300031249 Bacteria 1602
385 Ga0265327_10003047 3300031251 Bacteria 16584
386 Ga0265327_10018739 3300031251 Bacteria 4278
387 Ga0265327_10055378 3300031251 Bacteria 2049
388 Ga0265327_10076032 3300031251 Bacteria 1669
389 Ga0265316_10002206 3300031344 Bacteria 20468
390 Ga0307408_100062840 3300031548 Bacteria 2715
391 Ga0265313_10061702 3300031595 Bacteria 1753
392 Ga0265313_10084827 3300031595 Bacteria 1432
393 Ga0265314_10003413 3300031711 Bacteria 15378
394 Ga0265314_10086123 3300031711 Bacteria 2058
395 Ga0265314_10174511 3300031711 Bacteria 1294
396 Ga0265342_10069720 3300031712 Bacteria 2052
397 Ga0307409_100860448 3300031995 Unclassified 918
398 Ga0373926_0056892 3300035083 Bacteria 1420
399 Ga0373944_0056438 3300035089 Unclassified 1250
400 Ga0373923_0094277 3300035111 Unclassified 1313
401 Ga0373932_0280071 3300035112 Unclassified 617
402 Ga0373936_0165745 3300035113 Bacteria 964
403 Ga0373936_0493781 3300035113 Bacteria 569
404 Ga0373945_0226331 3300035116 Unclassified 783
405 Ga0373945_0259168 3300035116 Bacteria 736
406 Ga0373954_0094483 3300035118 Bacteria 1439
407 Ga0373956_0212368 3300035119 Unclassified 918
408 Ga0373957_0253734 3300035120 Unclassified 740
409 Ga0373943_0001309 3300035170 Bacteria 11182
410 Ga0373943_0017100 3300035170 Bacteria 3317
411 Ga0373943_0042530 3300035170 Bacteria 2202
412 Ga0373946_0030604 3300035171 Bacteria 2150
413 Ga0373946_0771807 3300035171 Bacteria 505
414 Ga0373924_0338841 3300035410 Bacteria 670
415 Ga0373931_0239202 3300035691 Bacteria 1100
416 Ga0373931_0572659 3300035691 Bacteria 736
417 Ga0373935_0094332 3300035692 Bacteria 1963
418 Ga0373927_0429531 3300035695 Unclassified 872
419 Ga0373933_0018885 3300035724 Bacteria 3884
420 Ga0373947_0002249 3300035725 Bacteria 11665
421 Ga0373947_0007984 3300035725 Bacteria 6103
422 Ga0373947_0038780 3300035725 Bacteria 2832
423 Ga0373947_0390750 3300035725 Bacteria 937
424 Ga0373925_0031071 3300037068 Bacteria 3922
425 Ga0373925_0045718 3300037068 Bacteria 3253
426 Ga0373925_0047599 3300037068 Bacteria 3192
427 Ga0373925_0571228 3300037068 Bacteria 930
428 Ga0395899_0087202 3300037312 Bacteria 2266
429 Ga0395899_0109281 3300037312 Bacteria 1990
430 Ga0395899_0177516 3300037312 Bacteria 1497
431 Ga0395899_0625793 3300037312 Bacteria 683
432 Ga0395899_0892041 3300037312 Unclassified 543
433 Ga0395900_0042379 3300037418 Bacteria 4691
434 Ga0395900_0061702 3300037418 Bacteria 3854
435 Ga0395900_0066125 3300037418 Bacteria 3715
436 Ga0395900_0082795 3300037418 Bacteria 3297
437 Ga0395900_0152117 3300037418 Bacteria 2364
438 Ga0395900_0156960 3300037418 Bacteria 2324
439 Ga0395900_0419444 3300037418 Bacteria 1299
440 Ga0395900_0794100 3300037418 Bacteria 875
441 Ga0395898_0002616 3300037466 Bacteria 20962
442 Ga0395898_0018106 3300037466 Bacteria 7189
443 Ga0395898_0059516 3300037466 Bacteria 3715
444 Ga0395898_0098449 3300037466 Bacteria 2808
445 Ga0395898_0432054 3300037466 Bacteria 1255
446 Ga0395898_0440983 3300037466 Bacteria 1240
447 Ga0395898_0500125 3300037466 Bacteria 1156
448 Ga0395898_1585869 3300037466 Unclassified 579
449 Ga0395898_1882279 3300037466 Bacteria 519
450 Ga0395905_0027769 3300037471 Bacteria 5337
451 Ga0395905_0147780 3300037471 Unclassified 2211
452 Ga0395905_0456890 3300037471 Bacteria 1175
453 Ga0395905_1740806 3300037471 Bacteria 529
454 Ga0395905_1800849 3300037471 Bacteria 518
455 Ga0436364_1344902 3300037853 Bacteria 1110
456 Ga0395901_0014181 3300038443 Bacteria 8114
457 Ga0395901_0079240 3300038443 Bacteria 3430
458 Ga0395901_0136216 3300038443 Bacteria 2581
459 Ga0395901_0265129 3300038443 Bacteria 1787
460 Ga0395901_0491990 3300038443 Bacteria 1250
461 Ga0395901_0510823 3300038443 Bacteria 1222
462 Ga0395901_0523408 3300038443 Bacteria 1204
463 Ga0436365_0024573 3300039437 Bacteria 1109
464 Ga0436360_0637419 3300039438 Bacteria 5531
465 Ga0436363_1209816 3300039450 Bacteria 1377
466 Ga0436363_1414311 3300039450 Bacteria 1810
467 Ga0436362_0655244 3300039453 Bacteria 1591
468 Ga0436362_0738256 3300039453 Bacteria 3305
469 Ga0451802_1645868 3300041460 Bacteria 602
470 Ga0451806_408931 3300041462 Bacteria 531
471 Ga0451839_1417588 3300041496 Unclassified 751
472 Ga0451853_0611674 3300041512 Unclassified 1136
473 Ga0466969_0411513 3300044656 Bacteria 614
474 Ga0466972_0482237 3300044658 Bacteria 583
475 Ga0466966_0034771 3300044684 Bacteria 3258
476 Ga0466966_0090891 3300044684 Bacteria 1896
477 Ga0466966_0114382 3300044684 Bacteria 1661
478 Ga0466966_0171835 3300044684 Bacteria 1317
479 Ga0466966_0236749 3300044684 Bacteria 1101
480 Ga0466966_0296349 3300044684 Bacteria 972
481 Ga0466961_0005606 3300044693 Bacteria 7932
482 Ga0466961_0041711 3300044693 Bacteria 2942
483 Ga0466961_0067154 3300044693 Bacteria 2278
484 Ga0466963_0001686 3300044694 Bacteria 12038
485 Ga0466963_0039235 3300044694 Bacteria 3100
486 Ga0466963_0204388 3300044694 Bacteria 1381
487 Ga0466963_0528750 3300044694 Unclassified 833
488 Ga0466963_0814367 3300044694 Bacteria 658
489 Ga0466963_0819397 3300044694 Bacteria 656
490 Ga0466963_0954222 3300044694 Bacteria 604
491 Ga0466964_0011257 3300044706 Bacteria 3379
492 Ga0466964_0064444 3300044706 Bacteria 1533
493 Ga0466964_0069204 3300044706 Bacteria 1488
494 Ga0466964_0632466 3300044706 Bacteria 590
495 Ga0466971_0026907 3300044719 Bacteria 2574
496 Ga0466971_0030805 3300044719 Bacteria 2401
497 Ga0466971_0037502 3300044719 Bacteria 2172
498 Ga0466968_0013261 3300044735 Bacteria 3239
499 Ga0466968_0013361 3300044735 Bacteria 3229
500 Ga0466970_0051419 3300044765 Bacteria 2199
501 Ga0466970_0863634 3300044765 Bacteria 531
502 Ga0466957_0023601 3300044842 Bacteria 3636
503 Ga0466957_0054182 3300044842 Bacteria 2447
504 Ga0466957_0172289 3300044842 Bacteria 1410
505 Ga0466957_1205275 3300044842 Bacteria 548
506 Ga0466959_0017673 3300045049 Bacteria 5230
507 Ga0466959_0027523 3300045049 Bacteria 4217
508 Ga0466959_0048565 3300045049 Bacteria 3119
509 Ga0466959_0079871 3300045049 Bacteria 2359
510 Ga0466959_0083882 3300045049 Bacteria 2294
511 Ga0466959_0111240 3300045049 Bacteria 1954
512 Ga0451576_0331672 3300045051 Bacteria 1592
513 Ga0451576_1197738 3300045051 Bacteria 793
514 Ga0466958_0000208 3300045836 Bacteria 21875
515 Ga0466958_0039817 3300045836 Bacteria 2824
516 Ga0466958_0091463 3300045836 Bacteria 1884
517 Ga0466958_0296889 3300045836 Bacteria 1037
518 Ga0466967_0001314 3300045976 Bacteria 14204
519 Ga0466967_0002552 3300045976 Bacteria 11411
520 Ga0466967_0006757 3300045976 Bacteria 8167
521 Ga0466967_0037241 3300045976 Bacteria 4161
522 Ga0466967_0049004 3300045976 Bacteria 3692
523 Ga0466967_0075564 3300045976 Bacteria 3028
524 Ga0466967_0099170 3300045976 Bacteria 2660
525 Ga0466967_0152964 3300045976 Bacteria 2158
526 Ga0466967_0159432 3300045976 Bacteria 2116
527 Ga0466967_0274409 3300045976 Bacteria 1616
528 Ga0466967_0313385 3300045976 Bacteria 1512
529 Ga0466967_0363585 3300045976 Bacteria 1402
530 Ga0466967_0433496 3300045976 Bacteria 1282
531 Ga0466967_0561556 3300045976 Bacteria 1124
532 Ga0466967_0644394 3300045976 Bacteria 1047
533 Ga0466967_1268956 3300045976 Bacteria 734
534 Ga0466967_1844358 3300045976 Bacteria 602
535 Ga0466967_1897917 3300045976 Bacteria 592
536 Ga0495592_0024548 3300046454 Bacteria 4582
537 Ga0495592_0049041 3300046454 Bacteria 3140
538 Ga0495603_0016807 3300046455 Bacteria 4427
539 Ga0495603_0025289 3300046455 Bacteria 3591
540 Ga0495629_0076995 3300046459 Bacteria 2328
541 Ga0495629_0115674 3300046459 Bacteria 1869
542 Ga0495629_0206331 3300046459 Bacteria 1358
543 Ga0495629_0394377 3300046459 Bacteria 941
544 Ga0495641_0008508 3300046461 Bacteria 6241
545 Ga0495641_0011878 3300046461 Bacteria 4919
546 Ga0495641_0093315 3300046461 Bacteria 1345
547 Ga0495641_0307005 3300046461 Bacteria 715
548 Ga0495641_0377848 3300046461 Bacteria 642
549 Ga0495651_0030082 3300046462 Bacteria 4234
550 Ga0495651_0030293 3300046462 Bacteria 4220
551 Ga0495651_0383970 3300046462 Bacteria 920
552 Ga0495653_0043265 3300046463 Bacteria 3503
553 Ga0495653_0122739 3300046463 Bacteria 1848
554 Ga0495582_0012801 3300046473 Bacteria 4621
555 Ga0495582_0774602 3300046473 Bacteria 555
556 Ga0495639_0023393 3300046475 Bacteria 2715
557 Ga0495639_0184656 3300046475 Bacteria 1016
558 Ga0495662_0013635 3300046476 Bacteria 3957
559 Ga0495662_0105815 3300046476 Bacteria 1377
560 Ga0495664_0007418 3300046477 Bacteria 6089
561 Ga0495664_0035068 3300046477 Bacteria 2953
562 Ga0495664_0394444 3300046477 Bacteria 831
563 Ga0495594_0041068 3300046499 Bacteria 2533
564 Ga0495594_0757752 3300046499 Bacteria 548
565 Ga0495608_0022077 3300046511 Bacteria 4363
566 Ga0495608_0028165 3300046511 Bacteria 3818
567 Ga0495608_0030660 3300046511 Bacteria 3640
568 Ga0495618_0100475 3300046514 Bacteria 1851
569 Ga0495618_0126879 3300046514 Bacteria 1633
570 Ga0495628_0015735 3300046516 Bacteria 6315
571 Ga0495628_0217343 3300046516 Bacteria 1436
572 Ga0495630_0002069 3300046517 Bacteria 13948
573 Ga0495630_0004136 3300046517 Bacteria 10161
574 Ga0495630_0131651 3300046517 Bacteria 1899
575 Ga0495630_0708237 3300046517 Unclassified 770
576 Ga0495630_1190320 3300046517 Bacteria 576
577 Ga0495666_0064156 3300046526 Bacteria 1753
578 Ga0495652_0027828 3300046529 Bacteria 4980
579 Ga0495652_0441047 3300046529 Bacteria 913
580 Ga0495652_0513110 3300046529 Bacteria 829
581 Ga0495665_0051934 3300046531 Bacteria 2170
582 Ga0495640_0005760 3300046533 Bacteria 9844
583 Ga0495640_0017637 3300046533 Bacteria 5314
584 Ga0495640_0169711 3300046533 Bacteria 1394
585 Ga0495640_0320865 3300046533 Unclassified 960
586 Ga0495640_0329947 3300046533 Bacteria 944
587 Ga0495640_0409897 3300046533 Bacteria 831
588 Ga0495586_0378723 3300046535 Bacteria 814
589 Ga0495587_0044355 3300046536 Bacteria 2645
590 Ga0495587_0235606 3300046536 Bacteria 1031
591 Ga0495587_0344116 3300046536 Bacteria 832
592 Ga0495587_0394285 3300046536 Unclassified 769
593 Ga0495645_0552519 3300046543 Bacteria 713
594 Ga0495667_0001444 3300046559 Bacteria 15650
595 Ga0495667_0001994 3300046559 Bacteria 13519
596 Ga0495667_0013594 3300046559 Bacteria 5503
597 Ga0495667_0288536 3300046559 Bacteria 1041
598 Ga0495634_0008262 3300046642 Bacteria 7763
599 Ga0495634_0031500 3300046642 Bacteria 3653
600 Ga0495634_0056762 3300046642 Bacteria 2615
601 Ga0495635_0024659 3300046663 Bacteria 4191
602 Ga0495635_0139515 3300046663 Bacteria 1651
603 Ga0495635_0253415 3300046663 Bacteria 1186
604 Ga0495588_0270708 3300046674 Bacteria 895
605 Ga0495588_0343854 3300046674 Bacteria 784
606 Ga0495657_0071790 3300046675 Bacteria 2259
607 Ga0495657_0258476 3300046675 Bacteria 1047
608 Ga0495657_0285169 3300046675 Bacteria 987
609 Ga0495599_0081417 3300046678 Bacteria 2022
610 Ga0495599_0105223 3300046678 Bacteria 1758
611 Ga0495599_0272701 3300046678 Bacteria 1026
612 Ga0495646_0150612 3300046680 Bacteria 1294
613 Ga0495646_0166574 3300046680 Bacteria 1217
614 Ga0495647_0019270 3300046681 Bacteria 2438
615 Ga0495658_0073103 3300046683 Bacteria 1995
616 Ga0495658_0302512 3300046683 Bacteria 1012
617 Ga0495613_0045353 3300046689 Bacteria 3251
618 Ga0495613_0054486 3300046689 Bacteria 2939
619 Ga0495613_0164409 3300046689 Bacteria 1577
620 Ga0495613_0888190 3300046689 Bacteria 577
621 Ga0495624_0021784 3300046690 Bacteria 4246
622 Ga0495624_0145763 3300046690 Bacteria 1449
623 Ga0495624_0157242 3300046690 Bacteria 1389
624 Ga0495600_0001166 3300046809 Bacteria 14336
625 Ga0495600_0101104 3300046809 Bacteria 1879
626 Ga0495600_0168124 3300046809 Bacteria 1416
627 Ga0495581_0004109 3300047315 Bacteria 8375
628 Ga0495581_0212275 3300047315 Bacteria 1132
629 Ga0495581_0412476 3300047315 Unclassified 787
630 Ga0495604_0085473 3300047317 Bacteria 2354
631 Ga0495604_0178215 3300047317 Bacteria 1488
632 Ga0495604_0379185 3300047317 Bacteria 934
633 Ga0495604_0607863 3300047317 Bacteria 700
634 Ga0495674_0001928 3300047319 Bacteria 20475
635 Ga0495674_0028248 3300047319 Bacteria 5119
636 Ga0495674_0055342 3300047319 Bacteria 3480
637 Ga0495674_0075363 3300047319 Bacteria 2903
638 Ga0495674_0098705 3300047319 Bacteria 2487
639 Ga0495674_0113547 3300047319 Bacteria 2294
640 Ga0495674_0120041 3300047319 Bacteria 2222
641 Ga0495676_0016380 3300047321 Bacteria 6583
642 Ga0495676_0136964 3300047321 Bacteria 1759
643 Ga0495676_0337744 3300047321 Bacteria 1009
644 Ga0495676_0356055 3300047321 Bacteria 978
645 Ga0495680_0004318 3300047322 Bacteria 13624
646 Ga0495680_0042648 3300047322 Bacteria 3598
647 Ga0495680_0516712 3300047322 Unclassified 809
648 Ga0495675_0075599 3300047444 Bacteria 2123
649 Ga0495684_0010521 3300047471 Bacteria 7154
650 Ga0495684_0042197 3300047471 Bacteria 3494
651 Ga0495684_0120732 3300047471 Bacteria 1974
652 Ga0495593_0093335 3300047673 Bacteria 1549
653 Ga0495593_0102281 3300047673 Bacteria 1469
654 Ga0495593_0161077 3300047673 Unclassified 1132
655 Ga0495602_0376265 3300048088 Unclassified 1018
656 Ga0495614_0137698 3300048089 Unclassified 1083
657 Ga0496100_0042219 3300048903 Bacteria 2912
658 Ga0496100_0092566 3300048903 Bacteria 2066
659 Ga0496100_0109415 3300048903 Bacteria 1917
660 Ga0496100_0161135 3300048903 Bacteria 1608
661 Ga0496100_0202473 3300048903 Bacteria 1447
662 Ga0496100_0678502 3300048903 Unclassified 803
663 Ga0496100_0920642 3300048903 Unclassified 687
664 Ga0496101_0001814 3300048904 Bacteria 12868
665 Ga0496101_0004861 3300048904 Bacteria 8524
666 Ga0496101_0258655 3300048904 Bacteria 1357
667 Ga0496101_0668979 3300048904 Unclassified 820
668 Ga0496101_0767288 3300048904 Bacteria 761
669 Ga0496102_0052256 3300048905 Bacteria 3722
670 Ga0496102_0125102 3300048905 Bacteria 2403
671 Ga0496102_0187419 3300048905 Bacteria 1950
672 Ga0496102_0304705 3300048905 Bacteria 1501
673 Ga0496102_0368080 3300048905 Bacteria 1353
674 Ga0496102_0470111 3300048905 Bacteria 1178
675 Ga0496102_0604213 3300048905 Bacteria 1020
676 Ga0496102_0764549 3300048905 Bacteria 889
677 Ga0496103_0040431 3300048906 Bacteria 2865
678 Ga0496103_0075386 3300048906 Bacteria 2116
679 Ga0496103_0141998 3300048906 Bacteria 1536
680 Ga0496103_0753973 3300048906 Bacteria 615
681 Ga0496104_0056269 3300048907 Bacteria 3719
682 Ga0496104_0065620 3300048907 Bacteria 3445
683 Ga0496104_0097950 3300048907 Bacteria 2807
684 Ga0496104_0335295 3300048907 Bacteria 1425
685 Ga0496104_0349592 3300048907 Bacteria 1391
686 Ga0496104_0573717 3300048907 Bacteria 1039
687 Ga0496104_1686676 3300048907 Unclassified 536
688 Ga0496105_0007666 3300048908 Bacteria 8369
689 Ga0496105_0015440 3300048908 Bacteria 6086
690 Ga0496105_0024596 3300048908 Bacteria 4894
691 Ga0496105_0051065 3300048908 Bacteria 3417
692 Ga0496105_0056995 3300048908 Bacteria 3226
693 Ga0496105_0170737 3300048908 Bacteria 1783
694 Ga0496106_0001681 3300048909 Bacteria 16555
695 Ga0496106_0007513 3300048909 Bacteria 8057
696 Ga0496106_0037477 3300048909 Bacteria 3627
697 Ga0496107_0030353 3300048910 Bacteria 3852
698 Ga0496107_0045645 3300048910 Bacteria 3152
699 Ga0496107_0065477 3300048910 Bacteria 2634
700 Ga0496107_0086712 3300048910 Bacteria 2285
701 Ga0496107_0113911 3300048910 Bacteria 1989
702 Ga0496108_0002006 3300048911 Bacteria 16312
703 Ga0496108_0002053 3300048911 Bacteria 16134
704 Ga0496108_0049211 3300048911 Bacteria 3525
705 Ga0496108_0110235 3300048911 Bacteria 2353
706 Ga0496108_0765976 3300048911 Bacteria 834
707 Ga0496108_1324558 3300048911 Bacteria 605
708 Ga0496109_0013489 3300048912 Bacteria 7089
709 Ga0496109_0041081 3300048912 Bacteria 4190
710 Ga0496109_0080397 3300048912 Bacteria 3003
711 Ga0496109_0233345 3300048912 Bacteria 1731
712 Ga0496109_0442951 3300048912 Unclassified 1227
713 Ga0496109_0464054 3300048912 Bacteria 1196
714 Ga0496109_0659035 3300048912 Bacteria 984
715 Ga0496110_0003922 3300048913 Bacteria 11444
716 Ga0496110_0049929 3300048913 Bacteria 3672
717 Ga0496110_0087684 3300048913 Bacteria 2779
718 Ga0496110_0172781 3300048913 Bacteria 1961
719 Ga0496110_0432359 3300048913 Bacteria 1200
720 Ga0496111_0005121 3300048914 Bacteria 8349
721 Ga0496111_0044678 3300048914 Bacteria 3185
722 Ga0496112_0003187 3300048915 Bacteria 13491
723 Ga0496112_0004509 3300048915 Bacteria 11819
724 Ga0496112_0009108 3300048915 Bacteria 8921
725 Ga0496112_0083854 3300048915 Bacteria 3152
726 Ga0496112_0320530 3300048915 Bacteria 1494
727 Ga0496112_0468186 3300048915 Bacteria 1197
728 Ga0496113_0009751 3300048916 Bacteria 6312
729 Ga0496113_0102804 3300048916 Bacteria 2216
730 Ga0496113_0108457 3300048916 Bacteria 2158
731 Ga0496113_0776731 3300048916 Bacteria 762
732 Ga0496114_0025592 3300048917 Bacteria 4825
733 Ga0496114_0032599 3300048917 Bacteria 4289
734 Ga0496114_0126950 3300048917 Bacteria 2199
735 Ga0496114_0161879 3300048917 Bacteria 1946
736 Ga0496114_0213448 3300048917 Bacteria 1693
737 Ga0496114_0281507 3300048917 Bacteria 1466
738 Ga0496114_0475946 3300048917 Bacteria 1105
739 Ga0496115_0071906 3300048918 Bacteria 2806
740 Ga0496115_0298304 3300048918 Bacteria 1321
741 Ga0496115_0421081 3300048918 Bacteria 1082
742 Ga0496115_0681963 3300048918 Unclassified 809
743 Ga0496115_1005816 3300048918 Unclassified 637
744 Ga0501032_0483794 3300049569 Bacteria 792
745 Ga0501032_1032056 3300049569 Bacteria 516
746 Ga0501033_0406639 3300049570 Bacteria 949
747 Ga0501034_0525358 3300049571 Bacteria 1095
748 Ga0501040_0097892 3300049576 Bacteria 2044
749 Ga0501042_0700341 3300049578 Bacteria 736
750 Ga0501047_0076139 3300049581 Bacteria 3229
751 Ga0501047_1297281 3300049581 Bacteria 542
752 Ga0501048_1047782 3300049582 Bacteria 587
753 Ga0501067_0002005 3300049583 Bacteria 11218
754 Ga0501067_0019609 3300049583 Bacteria 3744
755 Ga0501067_0140496 3300049583 Bacteria 1345
756 Ga0501067_0177001 3300049583 Bacteria 1188
757 Ga0501068_0044241 3300049584 Bacteria 2681
758 Ga0501069_0009763 3300049585 Bacteria 5072
759 Ga0501069_0161480 3300049585 Bacteria 1290
760 Ga0501069_0387186 3300049585 Bacteria 826
761 Ga0501069_0768567 3300049585 Unclassified 583
762 Ga0501070_0001179 3300049586 Bacteria 23338
763 Ga0501070_0159385 3300049586 Bacteria 1861
764 Ga0501070_0780572 3300049586 Bacteria 751
765 Ga0501072_0269873 3300049588 Bacteria 1354
766 Ga0501074_0036483 3300049590 Bacteria 3561
767 Ga0501074_0334577 3300049590 Bacteria 1075
768 Ga0501074_0526728 3300049590 Bacteria 837
769 Ga0501077_0025788 3300049593 Bacteria 3730
770 Ga0501077_0868837 3300049593 Bacteria 580
771 Ga0501080_0778410 3300049742 Bacteria 840
772 Ga0501080_1006032 3300049742 Bacteria 723
773 Ga0501035_0385255 3300049822 Bacteria 1169
774 Ga0501044_0831342 3300049823 Bacteria 801
775 Ga0501045_0105902 3300049824 Bacteria 2084
776 nmdc:mga05p37_250174_c1 3300050507 Bacteria 2126
777 nmdc:mga05p37_759631_c1 3300050507 Bacteria 1067
778 nmdc:mga08y16_120588_c1 3300050511 Bacteria 2729
779 nmdc:mga0n895_21702_c1 3300050512 Bacteria 6009
780 nmdc:mga0n895_533388_c1 3300050512 Bacteria 1180
781 nmdc:mga0n895_59212_c1 3300050512 Bacteria 3779
782 nmdc:mga0rr50_25457_c1 3300050513 Bacteria 4114
783 nmdc:mga08x19_32023_c1 3300050514 Bacteria 3312
784 nmdc:mga0a205_259530_c1 3300050515 Bacteria 1615
785 Ga0495601_0020691 3300053077 Bacteria 4020
786 Ga0495601_0102510 3300053077 Bacteria 1849
787 Ga0495601_0202891 3300053077 Bacteria 1295
788 Ga0495601_0238466 3300053077 Unclassified 1187
789 Ga0495601_0605104 3300053077 Bacteria 703
790 Ga0495612_0010120 3300053078 Bacteria 3815
791 Ga0495612_0056444 3300053078 Bacteria 1621
792 Ga0495612_0279825 3300053078 Unclassified 745
793 Ga0495595_0004918 3300053084 Bacteria 5390
794 Ga0495595_0145899 3300053084 Unclassified 1162
795 Ga0495619_0003192 3300053085 Bacteria 10620
796 Ga0495619_0120128 3300053085 Bacteria 1801
797 Ga0495619_0473024 3300053085 Bacteria 863
798 Ga0501084_0860749 3300054114 Unclassified 763
799 Ga0466962_0016201 3300061719 Bacteria 3595
800 Ga0466962_0184731 3300061719 Bacteria 1017
801 Ga0466962_0338224 3300061719 Bacteria 748
802 Ga0530510_0048768 3300061734 Bacteria 3061
803 Ga0070696_100965248
804 Ga0070658_10124310
805 Ga0070658_10343226
806 Ga0070658_10606457
807 Ga0070658_10809555
808 Ga0070683_100076297
809 Ga0070683_100090265
810 Ga0070683_100351431
811 Ga0070683_100866834
812 Ga0070683_102123429
813 Ga0068869_100131113
814 Ga0070680_100045576
815 Ga0070680_100234783
816 Ga0070680_100885278
817 Ga0070680_100952105
818 Ga0070682_100062400
819 Ga0070682_100814986
820 Ga0068868_100010799
821 Ga0068868_100941771
822 Ga0070660_100002352
823 Ga0070660_100005889
824 Ga0070660_100023989
825 Ga0070660_100094004
826 Ga0070660_101392375
827 Ga0070689_100125549
828 Ga0070689_100309573
829 Ga0070689_101069124
830 Ga0070661_100008922
831 Ga0070661_100068325
832 Ga0070661_100155711
833 Ga0070661_100407385
834 Ga0070661_100979963
835 Ga0070668_100313895
836 Ga0070668_100395285
837 Ga0070669_100611154
838 Ga0070669_100740767
839 Ga0070675_100050229
840 Ga0070675_100356315
841 Ga0070674_101136295
842 Ga0070673_100342940
843 Ga0070673_100638433
844 Ga0070659_100016427
845 Ga0070659_100062058
846 Ga0070659_100065967
847 Ga0070659_100404443
848 Ga0070659_101363856
849 Ga0070709_10074822
850 Ga0070709_10806703
851 Ga0070714_100048146
852 Ga0070714_100793767
853 Ga0070714_100999601
854 Ga0070714_101723747
855 Ga0070713_100326383
856 Ga0070713_101078635
857 Ga0070701_10110536
858 Ga0070701_10519854
859 Ga0070711_100044029
860 Ga0070711_100207302
861 Ga0070705_100165761
862 Ga0070700_100214549
863 Ga0070700_100380952
864 Ga0070694_100082597
865 Ga0070694_100145458
866 Ga0070694_100270887
867 Ga0070708_101253663
868 Ga0070663_100136808
869 Ga0070663_100252502
870 Ga0070678_100879552
871 Ga0070681_10001211
872 Ga0070681_10006154
873 Ga0070681_10024508
874 Ga0070681_10216002
875 Ga0070681_10450732
876 Ga0070681_10670737
877 Ga0070681_11121321
878 Ga0068867_100469403
879 Ga0070685_10128816
880 Ga0070685_10660088
881 Ga0070706_101153024
882 Ga0070698_100425159
883 Ga0070698_100896785
884 Ga0070699_100529217
885 Ga0070679_100018501
886 Ga0070679_100043990
887 Ga0070679_100101945
888 Ga0070679_100129670
889 Ga0070679_100192070
890 Ga0070679_101328334
891 Ga0070684_100000250
892 Ga0070684_100107435
893 Ga0070684_100174590
894 Ga0070684_100512200
895 Ga0070684_101104827
896 Ga0068853_101012533
897 Ga0070686_100177299
898 Ga0070686_100182041
899 Ga0070695_100599314
900 Ga0070696_100011162
901 Ga0070696_101598383
902 Ga0070693_100056213
903 Ga0070693_100347283
904 Ga0070693_100508125
905 Ga0070665_100072181
906 Ga0070665_100146064
907 Ga0070665_100318038
908 Ga0070704_100249105
909 Ga0068855_100036020
910 Ga0068855_100047718
911 Ga0068855_100081419
912 Ga0068855_100081606
913 Ga0068855_100095467
914 Ga0068855_100130908
915 Ga0068855_101342378
916 Ga0070664_100561279
917 Ga0068857_100002162
918 Ga0068854_100026502
919 Ga0068854_100273459
920 Ga0068854_100573594
921 Ga0068856_100050117
922 Ga0068856_100093676
923 Ga0068856_100312709
924 Ga0068856_100635847
925 Ga0070702_100131202
926 Ga0070702_100435071
927 Ga0068852_100485011
928 Ga0068852_100796346
929 Ga0068852_101545465
930 Ga0068852_101640944
931 Ga0068864_101014582
932 Ga0068866_10040831
933 Ga0068861_100713463
934 Ga0068870_10049495
935 Ga0068858_100248979
936 Ga0068860_100298761
937 Ga0068862_100385367
938 Ga0081455_10080323
939 Ga0070717_10051446
940 Ga0070717_10159985
941 Ga0070715_10033961
942 Ga0070716_100968517
943 Ga0070712_100303112
944 Ga0070712_100353752
945 Ga0097621_100056373
946 Ga0068871_100245529
947 Ga0068871_100258438
948 Ga0075433_10178710
949 Ga0075433_11196211
950 Ga0075434_100003594
951 Ga0075434_101778816
952 Ga0068865_100032727
953 Ga0068865_101181939
954 Ga0075436_100010977
955 Ga0075435_100017896
956 Ga0075435_100273568
957 Ga0075435_100804868
958 Ga0099794_10420716
959 Ga0105240_10198685
960 Ga0105240_10286551
961 Ga0105240_10324900
962 Ga0105240_10917517
963 Ga0105240_11526507
964 Ga0111539_10192044
965 Ga0105245_10123593
966 Ga0105245_10561839
967 Ga0105247_10011568
968 Ga0114129_10121910
969 Ga0114129_10532318
970 Ga0114129_11767202
971 Ga0105243_10135309
972 Ga0105243_10863660
973 Ga0105243_11008981
974 Ga0105241_10024319
975 Ga0105241_10587997
976 Ga0105241_11168457
977 Ga0105242_10221894
978 Ga0105242_10457813
979 Ga0105242_11675413
980 Ga0105248_10172714
981 Ga0105237_10052617
982 Ga0105237_10233681
983 Ga0105237_11792631
984 Ga0105238_10013187
985 Ga0105238_10108439
986 Ga0105238_11136067
987 Ga0105249_10071305
988 Ga0105249_10244879
989 Ga0105249_11121659
990 Ga0105239_10187270
991 Ga0105239_10326379
992 Ga0105239_10613079
993 Ga0105239_10757979
994 Ga0105239_11027049
995 Ga0105239_11426155
996 Ga0105239_12121636
997 Ga0105246_10018170
998 Ga0105246_10359596
999 Ga0157373_10774514
1000 Ga0157373_11049168
1001 Ga0157371_11372247
1002 Ga0157370_10132064
1003 Ga0157370_10180672
1004 Ga0157370_10605480
1005 Ga0157370_11120916
1006 Ga0157369_10071417
1007 Ga0157369_10172259
1008 Ga0157369_10216570
1009 Ga0157369_10222969
1010 Ga0157369_10499722
1011 Ga0157369_10908724
1012 Ga0157374_10029908
1013 Ga0157374_10669362
1014 Ga0157374_11483943
1015 Ga0157374_12405036
1016 Ga0157378_10378171
1017 Ga0157378_10466830
1018 Ga0163162_12381069
1019 Ga0157372_10066429
1020 Ga0157372_10140424
1021 Ga0157372_10165956
1022 Ga0157372_10396235
1023 Ga0157372_11165550
1024 Ga0157375_10282868
1025 Ga0157375_10725446
1026 Ga0163163_10008013
1027 Ga0157380_10230534
1028 Ga0157377_10003132
1029 Ga0157377_10145271
1030 Ga0157379_10038303
1031 Ga0157379_10556144
1032 Ga0157376_10023167
1033 Ga0157376_10086590
1034 Ga0157376_11961929
1035 Ga0206356_10859772
1036 Ga0206356_11244172
1037 Ga0206356_11453522
1038 Ga0206354_10308263
1039 Ga0206353_10470091
1040 Ga0206353_10926494
1041 Ga0213874_10103019
1042 Ga0213871_10023264
1043 Ga0224712_10192891
1044 Ga0207692_10587043
1045 Ga0207642_10162430
1046 Ga0207642_10669678
1047 Ga0207710_10009744
1048 Ga0207688_10011879
1049 Ga0207688_10259682
1050 Ga0207680_10060864
1051 Ga0207699_10338003
1052 Ga0207654_10025331
1053 Ga0207654_10385017
1054 Ga0207707_10007562
1055 Ga0207707_10053474
1056 Ga0207707_10070905
1057 Ga0207707_10328666
1058 Ga0207707_10535465
1059 Ga0207707_10572924
1060 Ga0207707_11046170
1061 Ga0207695_10171531
1062 Ga0207671_10076666
1063 Ga0207671_10094543
1064 Ga0207671_10183310
1065 Ga0207671_10591576
1066 Ga0207693_10124223
1067 Ga0207693_10294725
1068 Ga0207693_10589030
1069 Ga0207693_10651565
1070 Ga0207663_10289598
1071 Ga0207663_10321089
1072 Ga0207663_10573623
1073 Ga0207663_10752257
1074 Ga0207660_10017445
1075 Ga0207660_10017816
1076 Ga0207660_10315680
1077 Ga0207660_10807295
1078 Ga0207660_10850234
1079 Ga0207662_10091336
1080 Ga0207657_10003977
1081 Ga0207657_10005514
1082 Ga0207657_10006045
1083 Ga0207657_10011616
1084 Ga0207657_10037356
1085 Ga0207657_10645388
1086 Ga0207649_10034276
1087 Ga0207649_10129540
1088 Ga0207649_10408685
1089 Ga0207649_10672029
1090 Ga0207649_11080277
1091 Ga0207652_10004445
1092 Ga0207652_10063362
1093 Ga0207652_10111726
1094 Ga0207652_10354970
1095 Ga0207652_10820998
1096 Ga0207652_11094366
1097 Ga0207681_10951633
1098 Ga0207694_10031169
1099 Ga0207694_10627813
1100 Ga0207694_10821555
1101 Ga0207650_10378471
1102 Ga0207659_10293146
1103 Ga0207687_10004237
1104 Ga0207687_10083146
1105 Ga0207687_10938467
1106 Ga0207700_10548297
1107 Ga0207664_10537782
1108 Ga0207664_10592432
1109 Ga0207664_10761727
1110 Ga0207664_11026260
1111 Ga0207664_11279163
1112 Ga0207644_10535388
1113 Ga0207690_10035494
1114 Ga0207690_10147847
1115 Ga0207690_10235268
1116 Ga0207690_10378482
1117 Ga0207690_10416799
1118 Ga0207706_10069229
1119 Ga0207709_10078734
1120 Ga0207670_10143722
1121 Ga0207670_10630915
1122 Ga0207669_10019902
1123 Ga0207704_10327523
1124 Ga0207665_10030025
1125 Ga0207711_10860552
1126 Ga0207689_10011471
1127 Ga0207661_10028651
1128 Ga0207661_10326308
1129 Ga0207661_10580822
1130 Ga0207661_10595452
1131 Ga0207679_11488638
1132 Ga0207667_10023514
1133 Ga0207667_10048297
1134 Ga0207667_10141333
1135 Ga0207667_10196978
1136 Ga0207667_10533182
1137 Ga0207667_10612497
1138 Ga0207712_10041383
1139 Ga0207712_10144896
1140 Ga0207668_10522944
1141 Ga0207640_10043974
1142 Ga0207640_10503988
1143 Ga0207677_10006522
1144 Ga0207677_10414514
1145 Ga0207703_10070287
1146 Ga0207703_11027523
1147 Ga0207678_10172388
1148 Ga0207678_10195005
1149 Ga0207678_10618074
1150 Ga0207708_10009849
1151 Ga0207708_10017816
1152 Ga0207702_10114925
1153 Ga0207702_10374591
1154 Ga0207702_10682761
1155 Ga0207674_10002083
1156 Ga0207674_10112588
1157 Ga0207675_100602663
1158 Ga0207675_100630140
1159 Ga0207683_10648284
1160 Ga0207698_10578362
1161 Ga0207698_10747567
1162 Ga0207698_11386045
1163 Ga0207698_11580635
1164 Ga0207428_10109758
1165 Ga0268266_10055904
1166 Ga0268266_10236597
1167 Ga0268266_10253135
1168 Ga0268265_10460456
1169 Ga0268264_10130825
1170 Ga0268264_10691142
1171 Ga0265326_10101544
1172 Ga0265334_10112907
1173 Ga0265318_10017960
1174 Ga0265318_10054636
1175 Ga0265318_10066103
1176 Ga0265322_10011308
1177 Ga0265338_10013856
1178 Ga0265338_10051579
1179 Ga0265338_10060338
1180 Ga0265338_10144842
1181 Ga0265338_10342268
1182 Ga0265330_10074404
1183 Ga0265325_10027275
1184 Ga0265340_10030522
1185 Ga0265340_10172819
1186 Ga0265339_10090713
1187 Ga0265327_10003047
1188 Ga0265327_10018739
1189 Ga0265327_10055378
1190 Ga0265327_10076032
1191 Ga0265316_10002206
1192 Ga0307408_100062840
1193 Ga0265313_10061702
1194 Ga0265313_10084827
1195 Ga0265314_10003413
1196 Ga0265314_10086123
1197 Ga0265314_10174511
1198 Ga0265342_10069720
1199 Ga0307409_100860448
1200 Ga0373926_0056892
1201 Ga0373944_0056438
1202 Ga0373923_0094277
1203 Ga0373932_0280071
1204 Ga0373936_0165745
1205 Ga0373936_0493781
1206 Ga0373945_0226331
1207 Ga0373945_0259168
1208 Ga0373954_0094483
1209 Ga0373956_0212368
1210 Ga0373957_0253734
1211 Ga0373943_0001309
1212 Ga0373943_0017100
1213 Ga0373943_0042530
1214 Ga0373946_0030604
1215 Ga0373946_0771807
1216 Ga0373924_0338841
1217 Ga0373931_0239202
1218 Ga0373931_0572659
1219 Ga0373935_0094332
1220 Ga0373927_0429531
1221 Ga0373933_0018885
1222 Ga0373947_0002249
1223 Ga0373947_0007984
1224 Ga0373947_0038780
1225 Ga0373947_0390750
1226 Ga0373925_0031071
1227 Ga0373925_0045718
1228 Ga0373925_0047599
1229 Ga0373925_0571228
1230 Ga0395899_0087202
1231 Ga0395899_0109281
1232 Ga0395899_0177516
1233 Ga0395899_0625793
1234 Ga0395899_0892041
1235 Ga0395900_0042379
1236 Ga0395900_0061702
1237 Ga0395900_0066125
1238 Ga0395900_0082795
1239 Ga0395900_0152117
1240 Ga0395900_0156960
1241 Ga0395900_0419444
1242 Ga0395900_0794100
1243 Ga0395898_0002616
1244 Ga0395898_0018106
1245 Ga0395898_0059516
1246 Ga0395898_0098449
1247 Ga0395898_0432054
1248 Ga0395898_0440983
1249 Ga0395898_0500125
1250 Ga0395898_1585869
1251 Ga0395898_1882279
1252 Ga0395905_0027769
1253 Ga0395905_0147780
1254 Ga0395905_0456890
1255 Ga0395905_1740806
1256 Ga0395905_1800849
1257 Ga0436364_1344902
1258 Ga0395901_0014181
1259 Ga0395901_0079240
1260 Ga0395901_0136216
1261 Ga0395901_0265129
1262 Ga0395901_0491990
1263 Ga0395901_0510823
1264 Ga0395901_0523408
1265 Ga0436365_0024573
1266 Ga0436360_0637419
1267 Ga0436363_1209816
1268 Ga0436363_1414311
1269 Ga0436362_0655244
1270 Ga0436362_0738256
1271 Ga0451802_1645868
1272 Ga0451806_408931
1273 Ga0451839_1417588
1274 Ga0451853_0611674
1275 Ga0466969_0411513
1276 Ga0466972_0482237
1277 Ga0466966_0034771
1278 Ga0466966_0090891
1279 Ga0466966_0114382
1280 Ga0466966_0171835
1281 Ga0466966_0236749
1282 Ga0466966_0296349
1283 Ga0466961_0005606
1284 Ga0466961_0041711
1285 Ga0466961_0067154
1286 Ga0466963_0001686
1287 Ga0466963_0039235
1288 Ga0466963_0204388
1289 Ga0466963_0528750
1290 Ga0466963_0814367
1291 Ga0466963_0819397
1292 Ga0466963_0954222
1293 Ga0466964_0011257
1294 Ga0466964_0064444
1295 Ga0466964_0069204
1296 Ga0466964_0632466
1297 Ga0466971_0026907
1298 Ga0466971_0030805
1299 Ga0466971_0037502
1300 Ga0466968_0013261
1301 Ga0466968_0013361
1302 Ga0466970_0051419
1303 Ga0466970_0863634
1304 Ga0466957_0023601
1305 Ga0466957_0054182
1306 Ga0466957_0172289
1307 Ga0466957_1205275
1308 Ga0466959_0017673
1309 Ga0466959_0027523
1310 Ga0466959_0048565
1311 Ga0466959_0079871
1312 Ga0466959_0083882
1313 Ga0466959_0111240
1314 Ga0451576_0331672
1315 Ga0451576_1197738
1316 Ga0466958_0000208
1317 Ga0466958_0039817
1318 Ga0466958_0091463
1319 Ga0466958_0296889
1320 Ga0466967_0001314
1321 Ga0466967_0002552
1322 Ga0466967_0006757
1323 Ga0466967_0037241
1324 Ga0466967_0049004
1325 Ga0466967_0075564
1326 Ga0466967_0099170
1327 Ga0466967_0152964
1328 Ga0466967_0159432
1329 Ga0466967_0274409
1330 Ga0466967_0313385
1331 Ga0466967_0363585
1332 Ga0466967_0433496
1333 Ga0466967_0561556
1334 Ga0466967_0644394
1335 Ga0466967_1268956
1336 Ga0466967_1844358
1337 Ga0466967_1897917
1338 Ga0495592_0024548
1339 Ga0495592_0049041
1340 Ga0495603_0016807
1341 Ga0495603_0025289
1342 Ga0495629_0076995
1343 Ga0495629_0115674
1344 Ga0495629_0206331
1345 Ga0495629_0394377
1346 Ga0495641_0008508
1347 Ga0495641_0011878
1348 Ga0495641_0093315
1349 Ga0495641_0307005
1350 Ga0495641_0377848
1351 Ga0495651_0030082
1352 Ga0495651_0030293
1353 Ga0495651_0383970
1354 Ga0495653_0043265
1355 Ga0495653_0122739
1356 Ga0495582_0012801
1357 Ga0495582_0774602
1358 Ga0495639_0023393
1359 Ga0495639_0184656
1360 Ga0495662_0013635
1361 Ga0495662_0105815
1362 Ga0495664_0007418
1363 Ga0495664_0035068
1364 Ga0495664_0394444
1365 Ga0495594_0041068
1366 Ga0495594_0757752
1367 Ga0495608_0022077
1368 Ga0495608_0028165
1369 Ga0495608_0030660
1370 Ga0495618_0100475
1371 Ga0495618_0126879
1372 Ga0495628_0015735
1373 Ga0495628_0217343
1374 Ga0495630_0002069
1375 Ga0495630_0004136
1376 Ga0495630_0131651
1377 Ga0495630_0708237
1378 Ga0495630_1190320
1379 Ga0495666_0064156
1380 Ga0495652_0027828
1381 Ga0495652_0441047
1382 Ga0495652_0513110
1383 Ga0495665_0051934
1384 Ga0495640_0005760
1385 Ga0495640_0017637
1386 Ga0495640_0169711
1387 Ga0495640_0320865
1388 Ga0495640_0329947
1389 Ga0495640_0409897
1390 Ga0495586_0378723
1391 Ga0495587_0044355
1392 Ga0495587_0235606
1393 Ga0495587_0344116
1394 Ga0495587_0394285
1395 Ga0495645_0552519
1396 Ga0495667_0001444
1397 Ga0495667_0001994
1398 Ga0495667_0013594
1399 Ga0495667_0288536
1400 Ga0495634_0008262
1401 Ga0495634_0031500
1402 Ga0495634_0056762
1403 Ga0495635_0024659
1404 Ga0495635_0139515
1405 Ga0495635_0253415
1406 Ga0495588_0270708
1407 Ga0495588_0343854
1408 Ga0495657_0071790
1409 Ga0495657_0258476
1410 Ga0495657_0285169
1411 Ga0495599_0081417
1412 Ga0495599_0105223
1413 Ga0495599_0272701
1414 Ga0495646_0150612
1415 Ga0495646_0166574
1416 Ga0495647_0019270
1417 Ga0495658_0073103
1418 Ga0495658_0302512
1419 Ga0495613_0045353
1420 Ga0495613_0054486
1421 Ga0495613_0164409
1422 Ga0495613_0888190
1423 Ga0495624_0021784
1424 Ga0495624_0145763
1425 Ga0495624_0157242
1426 Ga0495600_0001166
1427 Ga0495600_0101104
1428 Ga0495600_0168124
1429 Ga0495581_0004109
1430 Ga0495581_0212275
1431 Ga0495581_0412476
1432 Ga0495604_0085473
1433 Ga0495604_0178215
1434 Ga0495604_0379185
1435 Ga0495604_0607863
1436 Ga0495674_0001928
1437 Ga0495674_0028248
1438 Ga0495674_0055342
1439 Ga0495674_0075363
1440 Ga0495674_0098705
1441 Ga0495674_0113547
1442 Ga0495674_0120041
1443 Ga0495676_0016380
1444 Ga0495676_0136964
1445 Ga0495676_0337744
1446 Ga0495676_0356055
1447 Ga0495680_0004318
1448 Ga0495680_0042648
1449 Ga0495680_0516712
1450 Ga0495675_0075599
1451 Ga0495684_0010521
1452 Ga0495684_0042197
1453 Ga0495684_0120732
1454 Ga0495593_0093335
1455 Ga0495593_0102281
1456 Ga0495593_0161077
1457 Ga0495602_0376265
1458 Ga0495614_0137698
1459 Ga0496100_0042219
1460 Ga0496100_0092566
1461 Ga0496100_0109415
1462 Ga0496100_0161135
1463 Ga0496100_0202473
1464 Ga0496100_0678502
1465 Ga0496100_0920642
1466 Ga0496101_0001814
1467 Ga0496101_0004861
1468 Ga0496101_0258655
1469 Ga0496101_0668979
1470 Ga0496101_0767288
1471 Ga0496102_0052256
1472 Ga0496102_0125102
1473 Ga0496102_0187419
1474 Ga0496102_0304705
1475 Ga0496102_0368080
1476 Ga0496102_0470111
1477 Ga0496102_0604213
1478 Ga0496102_0764549
1479 Ga0496103_0040431
1480 Ga0496103_0075386
1481 Ga0496103_0141998
1482 Ga0496103_0753973
1483 Ga0496104_0056269
1484 Ga0496104_0065620
1485 Ga0496104_0097950
1486 Ga0496104_0335295
1487 Ga0496104_0349592
1488 Ga0496104_0573717
1489 Ga0496104_1686676
1490 Ga0496105_0007666
1491 Ga0496105_0015440
1492 Ga0496105_0024596
1493 Ga0496105_0051065
1494 Ga0496105_0056995
1495 Ga0496105_0170737
1496 Ga0496106_0001681
1497 Ga0496106_0007513
1498 Ga0496106_0037477
1499 Ga0496107_0030353
1500 Ga0496107_0045645
1501 Ga0496107_0065477
1502 Ga0496107_0086712
1503 Ga0496107_0113911
1504 Ga0496108_0002006
1505 Ga0496108_0002053
1506 Ga0496108_0049211
1507 Ga0496108_0110235
1508 Ga0496108_0765976
1509 Ga0496108_1324558
1510 Ga0496109_0013489
1511 Ga0496109_0041081
1512 Ga0496109_0080397
1513 Ga0496109_0233345
1514 Ga0496109_0442951
1515 Ga0496109_0464054
1516 Ga0496109_0659035
1517 Ga0496110_0003922
1518 Ga0496110_0049929
1519 Ga0496110_0087684
1520 Ga0496110_0172781
1521 Ga0496110_0432359
1522 Ga0496111_0005121
1523 Ga0496111_0044678
1524 Ga0496112_0003187
1525 Ga0496112_0004509
1526 Ga0496112_0009108
1527 Ga0496112_0083854
1528 Ga0496112_0320530
1529 Ga0496112_0468186
1530 Ga0496113_0009751
1531 Ga0496113_0102804
1532 Ga0496113_0108457
1533 Ga0496113_0776731
1534 Ga0496114_0025592
1535 Ga0496114_0032599
1536 Ga0496114_0126950
1537 Ga0496114_0161879
1538 Ga0496114_0213448
1539 Ga0496114_0281507
1540 Ga0496114_0475946
1541 Ga0496115_0071906
1542 Ga0496115_0298304
1543 Ga0496115_0421081
1544 Ga0496115_0681963
1545 Ga0496115_1005816
1546 Ga0501032_0483794
1547 Ga0501032_1032056
1548 Ga0501033_0406639
1549 Ga0501034_0525358
1550 Ga0501040_0097892
1551 Ga0501042_0700341
1552 Ga0501047_0076139
1553 Ga0501047_1297281
1554 Ga0501048_1047782
1555 Ga0501067_0002005
1556 Ga0501067_0019609
1557 Ga0501067_0140496
1558 Ga0501067_0177001
1559 Ga0501068_0044241
1560 Ga0501069_0009763
1561 Ga0501069_0161480
1562 Ga0501069_0387186
1563 Ga0501069_0768567
1564 Ga0501070_0001179
1565 Ga0501070_0159385
1566 Ga0501070_0780572
1567 Ga0501072_0269873
1568 Ga0501074_0036483
1569 Ga0501074_0334577
1570 Ga0501074_0526728
1571 Ga0501077_0025788
1572 Ga0501077_0868837
1573 Ga0501080_0778410
1574 Ga0501080_1006032
1575 Ga0501035_0385255
1576 Ga0501044_0831342
1577 Ga0501045_0105902
1578 nmdc:mga05p37_250174_c1
1579 nmdc:mga05p37_759631_c1
1580 nmdc:mga08y16_120588_c1
1581 nmdc:mga0n895_21702_c1
1582 nmdc:mga0n895_533388_c1
1583 nmdc:mga0n895_59212_c1
1584 nmdc:mga0rr50_25457_c1
1585 nmdc:mga08x19_32023_c1
1586 nmdc:mga0a205_259530_c1
1587 Ga0495601_0020691
1588 Ga0495601_0102510
1589 Ga0495601_0202891
1590 Ga0495601_0238466
1591 Ga0495601_0605104
1592 Ga0495612_0010120
1593 Ga0495612_0056444
1594 Ga0495612_0279825
1595 Ga0495595_0004918
1596 Ga0495595_0145899
1597 Ga0495619_0003192
1598 Ga0495619_0120128
1599 Ga0495619_0473024
1600 Ga0501084_0860749
1601 Ga0466962_0016201
1602 Ga0466962_0184731
1603 Ga0466962_0338224
1604 Ga0530510_0048768

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

5

138

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dku-assembly8.cif.gz_H crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1 0.7685 1 121
5gp0-assembly1.cif.gz_I crystal structure of geraniol-nudx1 complex 0.7367 1 124
5wy6-assembly1.cif.gz_A crystal structure of atnudx1 (e56a) 0.7362 1 124
8dwd-assembly1.cif.gz_A adenine glycosylase muty variant e43s in complex with dna containing d(8-oxo-g) paired with an ap site generated by the enzyme acting on purine 0.7279 1 111
2b0v-assembly1.cif.gz_A nudix hydrolase from nitrosomonas europaea. 0.7181 2 119
ID Description Score Start End Superfamily
af_I6YDV4_172_318_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7446 2 113 3.90.79.10
5wwdA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.726 1 127 3.90.79.10
2b0vA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7181 2 120 3.90.79.10
af_Q54N32_273_457_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7049 1 106 3.90.79.10
3gz8B01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7037 6 111 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7W0QJW2-F1-model_v4 NUDIX hydrolase 0.9188 1 137 GO:0016787
AF-A0A7W0QJW2-F1-model_v4 NUDIX hydrolase 0.9124 1 137 GO:0016787
AF-A0A538BMJ1-F1-model_v4 NUDIX domain-containing protein 0.9071 1 114 GO:0016787
AF-A0A1Q7VK63-F1-model_v4 Nudix hydrolase domain-containing protein 0.8889 1 133 GO:0016787
AF-A0A7W0UEC5-F1-model_v4 NUDIX hydrolase 0.8856 18 137 GO:0016787

Map