F481455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 802 | 308 | 1604 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100965248|Ga0070696_1009652482 |
| Length | 153 |
| Sequence | VSEGLPRVRVSALLRWQSRVLLCRQEKPGKEYWMLPGGGVDGGETLLRALWRELEEEVGLPQEQALEGPIAVAESIAPDWKPGGRHVVHIVFGADLSHRSLEDVESRDAAVRGLRLFSLEELEDVVVHPPIKRFLQRWRPGDPAVYLGSLWVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.1 |
| Rhizosphere | 88.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070696_100965248 | 3300005546 | Bacteria | 710 |
| 2 | Ga0070658_10124310 | 3300005327 | Bacteria | 2146 |
| 3 | Ga0070658_10343226 | 3300005327 | Bacteria | 1277 |
| 4 | Ga0070658_10606457 | 3300005327 | Bacteria | 949 |
| 5 | Ga0070658_10809555 | 3300005327 | Bacteria | 814 |
| 6 | Ga0070683_100076297 | 3300005329 | Bacteria | 3133 |
| 7 | Ga0070683_100090265 | 3300005329 | Bacteria | 2877 |
| 8 | Ga0070683_100351431 | 3300005329 | Bacteria | 1404 |
| 9 | Ga0070683_100866834 | 3300005329 | Bacteria | 866 |
| 10 | Ga0070683_102123429 | 3300005329 | Unclassified | 539 |
| 11 | Ga0068869_100131113 | 3300005334 | Bacteria | 1927 |
| 12 | Ga0070680_100045576 | 3300005336 | Bacteria | 3565 |
| 13 | Ga0070680_100234783 | 3300005336 | Bacteria | 1549 |
| 14 | Ga0070680_100885278 | 3300005336 | Bacteria | 770 |
| 15 | Ga0070680_100952105 | 3300005336 | Bacteria | 741 |
| 16 | Ga0070682_100062400 | 3300005337 | Bacteria | 2361 |
| 17 | Ga0070682_100814986 | 3300005337 | Bacteria | 760 |
| 18 | Ga0068868_100010799 | 3300005338 | Bacteria | 6624 |
| 19 | Ga0068868_100941771 | 3300005338 | Bacteria | 787 |
| 20 | Ga0070660_100002352 | 3300005339 | Bacteria | 12989 |
| 21 | Ga0070660_100005889 | 3300005339 | Bacteria | 8480 |
| 22 | Ga0070660_100023989 | 3300005339 | Bacteria | 4523 |
| 23 | Ga0070660_100094004 | 3300005339 | Bacteria | 2368 |
| 24 | Ga0070660_101392375 | 3300005339 | Unclassified | 596 |
| 25 | Ga0070689_100125549 | 3300005340 | Bacteria | 2053 |
| 26 | Ga0070689_100309573 | 3300005340 | Unclassified | 1317 |
| 27 | Ga0070689_101069124 | 3300005340 | Unclassified | 720 |
| 28 | Ga0070661_100008922 | 3300005344 | Bacteria | 6939 |
| 29 | Ga0070661_100068325 | 3300005344 | Bacteria | 2611 |
| 30 | Ga0070661_100155711 | 3300005344 | Bacteria | 1729 |
| 31 | Ga0070661_100407385 | 3300005344 | Bacteria | 1076 |
| 32 | Ga0070661_100979963 | 3300005344 | Bacteria | 701 |
| 33 | Ga0070668_100313895 | 3300005347 | Bacteria | 1318 |
| 34 | Ga0070668_100395285 | 3300005347 | Bacteria | 1179 |
| 35 | Ga0070669_100611154 | 3300005353 | Bacteria | 914 |
| 36 | Ga0070669_100740767 | 3300005353 | Bacteria | 832 |
| 37 | Ga0070675_100050229 | 3300005354 | Bacteria | 3424 |
| 38 | Ga0070675_100356315 | 3300005354 | Unclassified | 1298 |
| 39 | Ga0070674_101136295 | 3300005356 | Bacteria | 691 |
| 40 | Ga0070673_100342940 | 3300005364 | Bacteria | 1324 |
| 41 | Ga0070673_100638433 | 3300005364 | Unclassified | 974 |
| 42 | Ga0070659_100016427 | 3300005366 | Bacteria | 5558 |
| 43 | Ga0070659_100062058 | 3300005366 | Bacteria | 2954 |
| 44 | Ga0070659_100065967 | 3300005366 | Bacteria | 2868 |
| 45 | Ga0070659_100404443 | 3300005366 | Bacteria | 1153 |
| 46 | Ga0070659_101363856 | 3300005366 | Bacteria | 630 |
| 47 | Ga0070709_10074822 | 3300005434 | Bacteria | 2195 |
| 48 | Ga0070709_10806703 | 3300005434 | Bacteria | 737 |
| 49 | Ga0070714_100048146 | 3300005435 | Bacteria | 3624 |
| 50 | Ga0070714_100793767 | 3300005435 | Bacteria | 917 |
| 51 | Ga0070714_100999601 | 3300005435 | Bacteria | 814 |
| 52 | Ga0070714_101723747 | 3300005435 | Bacteria | 612 |
| 53 | Ga0070713_100326383 | 3300005436 | Bacteria | 1418 |
| 54 | Ga0070713_101078635 | 3300005436 | Bacteria | 776 |
| 55 | Ga0070701_10110536 | 3300005438 | Bacteria | 1535 |
| 56 | Ga0070701_10519854 | 3300005438 | Bacteria | 776 |
| 57 | Ga0070711_100044029 | 3300005439 | Bacteria | 3027 |
| 58 | Ga0070711_100207302 | 3300005439 | Bacteria | 1516 |
| 59 | Ga0070705_100165761 | 3300005440 | Unclassified | 1482 |
| 60 | Ga0070700_100214549 | 3300005441 | Bacteria | 1360 |
| 61 | Ga0070700_100380952 | 3300005441 | Bacteria | 1055 |
| 62 | Ga0070694_100082597 | 3300005444 | Bacteria | 2238 |
| 63 | Ga0070694_100145458 | 3300005444 | Bacteria | 1726 |
| 64 | Ga0070694_100270887 | 3300005444 | Bacteria | 1291 |
| 65 | Ga0070708_101253663 | 3300005445 | Bacteria | 693 |
| 66 | Ga0070663_100136808 | 3300005455 | Bacteria | 1866 |
| 67 | Ga0070663_100252502 | 3300005455 | Bacteria | 1396 |
| 68 | Ga0070678_100879552 | 3300005456 | Bacteria | 818 |
| 69 | Ga0070681_10001211 | 3300005458 | Bacteria | 22450 |
| 70 | Ga0070681_10006154 | 3300005458 | Bacteria | 11657 |
| 71 | Ga0070681_10024508 | 3300005458 | Bacteria | 6073 |
| 72 | Ga0070681_10216002 | 3300005458 | Bacteria | 1833 |
| 73 | Ga0070681_10450732 | 3300005458 | Bacteria | 1199 |
| 74 | Ga0070681_10670737 | 3300005458 | Bacteria | 952 |
| 75 | Ga0070681_11121321 | 3300005458 | Bacteria | 708 |
| 76 | Ga0068867_100469403 | 3300005459 | Bacteria | 1076 |
| 77 | Ga0070685_10128816 | 3300005466 | Bacteria | 1580 |
| 78 | Ga0070685_10660088 | 3300005466 | Unclassified | 759 |
| 79 | Ga0070706_101153024 | 3300005467 | Unclassified | 713 |
| 80 | Ga0070698_100425159 | 3300005471 | Bacteria | 1263 |
| 81 | Ga0070698_100896785 | 3300005471 | Bacteria | 832 |
| 82 | Ga0070699_100529217 | 3300005518 | Bacteria | 1072 |
| 83 | Ga0070679_100018501 | 3300005530 | Bacteria | 6762 |
| 84 | Ga0070679_100043990 | 3300005530 | Bacteria | 4447 |
| 85 | Ga0070679_100101945 | 3300005530 | Bacteria | 2857 |
| 86 | Ga0070679_100129670 | 3300005530 | Bacteria | 2503 |
| 87 | Ga0070679_100192070 | 3300005530 | Bacteria | 2010 |
| 88 | Ga0070679_101328334 | 3300005530 | Unclassified | 665 |
| 89 | Ga0070684_100000250 | 3300005535 | Bacteria | 37184 |
| 90 | Ga0070684_100107435 | 3300005535 | Bacteria | 2499 |
| 91 | Ga0070684_100174590 | 3300005535 | Bacteria | 1952 |
| 92 | Ga0070684_100512200 | 3300005535 | Bacteria | 1112 |
| 93 | Ga0070684_101104827 | 3300005535 | Unclassified | 745 |
| 94 | Ga0068853_101012533 | 3300005539 | Bacteria | 800 |
| 95 | Ga0070686_100177299 | 3300005544 | Bacteria | 1512 |
| 96 | Ga0070686_100182041 | 3300005544 | Bacteria | 1494 |
| 97 | Ga0070695_100599314 | 3300005545 | Unclassified | 865 |
| 98 | Ga0070696_100011162 | 3300005546 | Bacteria | 6011 |
| 99 | Ga0070696_101598383 | 3300005546 | Bacteria | 560 |
| 100 | Ga0070693_100056213 | 3300005547 | Bacteria | 2270 |
| 101 | Ga0070693_100347283 | 3300005547 | Bacteria | 1014 |
| 102 | Ga0070693_100508125 | 3300005547 | Bacteria | 856 |
| 103 | Ga0070665_100072181 | 3300005548 | Bacteria | 3460 |
| 104 | Ga0070665_100146064 | 3300005548 | Bacteria | 2368 |
| 105 | Ga0070665_100318038 | 3300005548 | Bacteria | 1561 |
| 106 | Ga0070704_100249105 | 3300005549 | Bacteria | 1458 |
| 107 | Ga0068855_100036020 | 3300005563 | Bacteria | 5891 |
| 108 | Ga0068855_100047718 | 3300005563 | Bacteria | 5059 |
| 109 | Ga0068855_100081419 | 3300005563 | Bacteria | 3753 |
| 110 | Ga0068855_100081606 | 3300005563 | Bacteria | 3748 |
| 111 | Ga0068855_100095467 | 3300005563 | Bacteria | 3427 |
| 112 | Ga0068855_100130908 | 3300005563 | Bacteria | 2865 |
| 113 | Ga0068855_101342378 | 3300005563 | Bacteria | 739 |
| 114 | Ga0070664_100561279 | 3300005564 | Bacteria | 1056 |
| 115 | Ga0068857_100002162 | 3300005577 | Bacteria | 15982 |
| 116 | Ga0068854_100026502 | 3300005578 | Bacteria | 3985 |
| 117 | Ga0068854_100273459 | 3300005578 | Bacteria | 1357 |
| 118 | Ga0068854_100573594 | 3300005578 | Bacteria | 960 |
| 119 | Ga0068856_100050117 | 3300005614 | Bacteria | 4116 |
| 120 | Ga0068856_100093676 | 3300005614 | Bacteria | 2990 |
| 121 | Ga0068856_100312709 | 3300005614 | Bacteria | 1588 |
| 122 | Ga0068856_100635847 | 3300005614 | Bacteria | 1088 |
| 123 | Ga0070702_100131202 | 3300005615 | Bacteria | 1583 |
| 124 | Ga0070702_100435071 | 3300005615 | Unclassified | 948 |
| 125 | Ga0068852_100485011 | 3300005616 | Bacteria | 1229 |
| 126 | Ga0068852_100796346 | 3300005616 | Bacteria | 959 |
| 127 | Ga0068852_101545465 | 3300005616 | Unclassified | 686 |
| 128 | Ga0068852_101640944 | 3300005616 | Unclassified | 665 |
| 129 | Ga0068864_101014582 | 3300005618 | Unclassified | 823 |
| 130 | Ga0068866_10040831 | 3300005718 | Bacteria | 2299 |
| 131 | Ga0068861_100713463 | 3300005719 | Bacteria | 933 |
| 132 | Ga0068870_10049495 | 3300005840 | Bacteria | 2217 |
| 133 | Ga0068858_100248979 | 3300005842 | Bacteria | 1687 |
| 134 | Ga0068860_100298761 | 3300005843 | Bacteria | 1577 |
| 135 | Ga0068862_100385367 | 3300005844 | Bacteria | 1308 |
| 136 | Ga0081455_10080323 | 3300005937 | Bacteria | 2674 |
| 137 | Ga0070717_10051446 | 3300006028 | Bacteria | 3390 |
| 138 | Ga0070717_10159985 | 3300006028 | Bacteria | 1953 |
| 139 | Ga0070715_10033961 | 3300006163 | Bacteria | 2088 |
| 140 | Ga0070716_100968517 | 3300006173 | Bacteria | 671 |
| 141 | Ga0070712_100303112 | 3300006175 | Bacteria | 1294 |
| 142 | Ga0070712_100353752 | 3300006175 | Bacteria | 1203 |
| 143 | Ga0097621_100056373 | 3300006237 | Bacteria | 3210 |
| 144 | Ga0068871_100245529 | 3300006358 | Bacteria | 1558 |
| 145 | Ga0068871_100258438 | 3300006358 | Bacteria | 1519 |
| 146 | Ga0075433_10178710 | 3300006852 | Bacteria | 1888 |
| 147 | Ga0075433_11196211 | 3300006852 | Bacteria | 660 |
| 148 | Ga0075434_100003594 | 3300006871 | Bacteria | 13853 |
| 149 | Ga0075434_101778816 | 3300006871 | Bacteria | 623 |
| 150 | Ga0068865_100032727 | 3300006881 | Bacteria | 3476 |
| 151 | Ga0068865_101181939 | 3300006881 | Unclassified | 676 |
| 152 | Ga0075436_100010977 | 3300006914 | Bacteria | 6219 |
| 153 | Ga0075435_100017896 | 3300007076 | Bacteria | 5372 |
| 154 | Ga0075435_100273568 | 3300007076 | Bacteria | 1441 |
| 155 | Ga0075435_100804868 | 3300007076 | Bacteria | 818 |
| 156 | Ga0099794_10420716 | 3300007265 | Bacteria | 699 |
| 157 | Ga0105240_10198685 | 3300009093 | Bacteria | 2352 |
| 158 | Ga0105240_10286551 | 3300009093 | Bacteria | 1890 |
| 159 | Ga0105240_10324900 | 3300009093 | Bacteria | 1752 |
| 160 | Ga0105240_10917517 | 3300009093 | Bacteria | 941 |
| 161 | Ga0105240_11526507 | 3300009093 | Bacteria | 700 |
| 162 | Ga0111539_10192044 | 3300009094 | Bacteria | 2383 |
| 163 | Ga0105245_10123593 | 3300009098 | Bacteria | 2420 |
| 164 | Ga0105245_10561839 | 3300009098 | Bacteria | 1164 |
| 165 | Ga0105247_10011568 | 3300009101 | Bacteria | 5316 |
| 166 | Ga0114129_10121910 | 3300009147 | Bacteria | 3588 |
| 167 | Ga0114129_10532318 | 3300009147 | Bacteria | 1531 |
| 168 | Ga0114129_11767202 | 3300009147 | Unclassified | 753 |
| 169 | Ga0105243_10135309 | 3300009148 | Bacteria | 2096 |
| 170 | Ga0105243_10863660 | 3300009148 | Bacteria | 897 |
| 171 | Ga0105243_11008981 | 3300009148 | Bacteria | 835 |
| 172 | Ga0105241_10024319 | 3300009174 | Bacteria | 4498 |
| 173 | Ga0105241_10587997 | 3300009174 | Bacteria | 1004 |
| 174 | Ga0105241_11168457 | 3300009174 | Bacteria | 728 |
| 175 | Ga0105242_10221894 | 3300009176 | Bacteria | 1690 |
| 176 | Ga0105242_10457813 | 3300009176 | Bacteria | 1204 |
| 177 | Ga0105242_11675413 | 3300009176 | Bacteria | 671 |
| 178 | Ga0105248_10172714 | 3300009177 | Bacteria | 2436 |
| 179 | Ga0105237_10052617 | 3300009545 | Bacteria | 4087 |
| 180 | Ga0105237_10233681 | 3300009545 | Bacteria | 1839 |
| 181 | Ga0105237_11792631 | 3300009545 | Bacteria | 621 |
| 182 | Ga0105238_10013187 | 3300009551 | Bacteria | 8342 |
| 183 | Ga0105238_10108439 | 3300009551 | Bacteria | 2758 |
| 184 | Ga0105238_11136067 | 3300009551 | Bacteria | 805 |
| 185 | Ga0105249_10071305 | 3300009553 | Bacteria | 3209 |
| 186 | Ga0105249_10244879 | 3300009553 | Bacteria | 1774 |
| 187 | Ga0105249_11121659 | 3300009553 | Unclassified | 857 |
| 188 | Ga0105239_10187270 | 3300010375 | Bacteria | 2316 |
| 189 | Ga0105239_10326379 | 3300010375 | Bacteria | 1731 |
| 190 | Ga0105239_10613079 | 3300010375 | Bacteria | 1242 |
| 191 | Ga0105239_10757979 | 3300010375 | Bacteria | 1111 |
| 192 | Ga0105239_11027049 | 3300010375 | Bacteria | 948 |
| 193 | Ga0105239_11426155 | 3300010375 | Bacteria | 800 |
| 194 | Ga0105239_12121636 | 3300010375 | Unclassified | 653 |
| 195 | Ga0105246_10018170 | 3300011119 | Bacteria | 4479 |
| 196 | Ga0105246_10359596 | 3300011119 | Bacteria | 1196 |
| 197 | Ga0157373_10774514 | 3300013100 | Bacteria | 706 |
| 198 | Ga0157373_11049168 | 3300013100 | Bacteria | 610 |
| 199 | Ga0157371_11372247 | 3300013102 | Bacteria | 548 |
| 200 | Ga0157370_10132064 | 3300013104 | Bacteria | 2329 |
| 201 | Ga0157370_10180672 | 3300013104 | Bacteria | 1961 |
| 202 | Ga0157370_10605480 | 3300013104 | Bacteria | 1003 |
| 203 | Ga0157370_11120916 | 3300013104 | Unclassified | 711 |
| 204 | Ga0157369_10071417 | 3300013105 | Bacteria | 3727 |
| 205 | Ga0157369_10172259 | 3300013105 | Bacteria | 2280 |
| 206 | Ga0157369_10216570 | 3300013105 | Bacteria | 2006 |
| 207 | Ga0157369_10222969 | 3300013105 | Bacteria | 1973 |
| 208 | Ga0157369_10499722 | 3300013105 | Bacteria | 1258 |
| 209 | Ga0157369_10908724 | 3300013105 | Bacteria | 903 |
| 210 | Ga0157374_10029908 | 3300013296 | Bacteria | 4941 |
| 211 | Ga0157374_10669362 | 3300013296 | Bacteria | 1050 |
| 212 | Ga0157374_11483943 | 3300013296 | Bacteria | 701 |
| 213 | Ga0157374_12405036 | 3300013296 | Bacteria | 554 |
| 214 | Ga0157378_10378171 | 3300013297 | Bacteria | 1390 |
| 215 | Ga0157378_10466830 | 3300013297 | Bacteria | 1255 |
| 216 | Ga0163162_12381069 | 3300013306 | Unclassified | 609 |
| 217 | Ga0157372_10066429 | 3300013307 | Bacteria | 4052 |
| 218 | Ga0157372_10140424 | 3300013307 | Bacteria | 2782 |
| 219 | Ga0157372_10165956 | 3300013307 | Bacteria | 2553 |
| 220 | Ga0157372_10396235 | 3300013307 | Bacteria | 1609 |
| 221 | Ga0157372_11165550 | 3300013307 | Unclassified | 891 |
| 222 | Ga0157375_10282868 | 3300013308 | Bacteria | 1822 |
| 223 | Ga0157375_10725446 | 3300013308 | Bacteria | 1146 |
| 224 | Ga0163163_10008013 | 3300014325 | Bacteria | 9351 |
| 225 | Ga0157380_10230534 | 3300014326 | Bacteria | 1663 |
| 226 | Ga0157377_10003132 | 3300014745 | Bacteria | 7446 |
| 227 | Ga0157377_10145271 | 3300014745 | Bacteria | 1461 |
| 228 | Ga0157379_10038303 | 3300014968 | Bacteria | 4278 |
| 229 | Ga0157379_10556144 | 3300014968 | Bacteria | 1068 |
| 230 | Ga0157376_10023167 | 3300014969 | Bacteria | 4856 |
| 231 | Ga0157376_10086590 | 3300014969 | Bacteria | 2702 |
| 232 | Ga0157376_11961929 | 3300014969 | Unclassified | 623 |
| 233 | Ga0206356_10859772 | 3300020070 | Bacteria | 2818 |
| 234 | Ga0206356_11244172 | 3300020070 | Bacteria | 1890 |
| 235 | Ga0206356_11453522 | 3300020070 | Bacteria | 939 |
| 236 | Ga0206354_10308263 | 3300020081 | Bacteria | 4394 |
| 237 | Ga0206353_10470091 | 3300020082 | Bacteria | 1204 |
| 238 | Ga0206353_10926494 | 3300020082 | Bacteria | 1412 |
| 239 | Ga0213874_10103019 | 3300021377 | Bacteria | 951 |
| 240 | Ga0213871_10023264 | 3300021441 | Bacteria | 1559 |
| 241 | Ga0224712_10192891 | 3300022467 | Bacteria | 923 |
| 242 | Ga0207692_10587043 | 3300025898 | Bacteria | 715 |
| 243 | Ga0207642_10162430 | 3300025899 | Bacteria | 1201 |
| 244 | Ga0207642_10669678 | 3300025899 | Bacteria | 652 |
| 245 | Ga0207710_10009744 | 3300025900 | Bacteria | 4037 |
| 246 | Ga0207688_10011879 | 3300025901 | Bacteria | 4740 |
| 247 | Ga0207688_10259682 | 3300025901 | Unclassified | 1054 |
| 248 | Ga0207680_10060864 | 3300025903 | Bacteria | 2300 |
| 249 | Ga0207699_10338003 | 3300025906 | Bacteria | 1060 |
| 250 | Ga0207654_10025331 | 3300025911 | Bacteria | 3199 |
| 251 | Ga0207654_10385017 | 3300025911 | Bacteria | 972 |
| 252 | Ga0207707_10007562 | 3300025912 | Bacteria | 9465 |
| 253 | Ga0207707_10053474 | 3300025912 | Bacteria | 3515 |
| 254 | Ga0207707_10070905 | 3300025912 | Bacteria | 3036 |
| 255 | Ga0207707_10328666 | 3300025912 | Bacteria | 1319 |
| 256 | Ga0207707_10535465 | 3300025912 | Bacteria | 996 |
| 257 | Ga0207707_10572924 | 3300025912 | Bacteria | 958 |
| 258 | Ga0207707_11046170 | 3300025912 | Bacteria | 668 |
| 259 | Ga0207695_10171531 | 3300025913 | Bacteria | 2095 |
| 260 | Ga0207671_10076666 | 3300025914 | Bacteria | 2502 |
| 261 | Ga0207671_10094543 | 3300025914 | Bacteria | 2256 |
| 262 | Ga0207671_10183310 | 3300025914 | Bacteria | 1630 |
| 263 | Ga0207671_10591576 | 3300025914 | Bacteria | 884 |
| 264 | Ga0207693_10124223 | 3300025915 | Bacteria | 2028 |
| 265 | Ga0207693_10294725 | 3300025915 | Unclassified | 1271 |
| 266 | Ga0207693_10589030 | 3300025915 | Bacteria | 866 |
| 267 | Ga0207693_10651565 | 3300025915 | Bacteria | 818 |
| 268 | Ga0207663_10289598 | 3300025916 | Bacteria | 1219 |
| 269 | Ga0207663_10321089 | 3300025916 | Unclassified | 1163 |
| 270 | Ga0207663_10573623 | 3300025916 | Unclassified | 884 |
| 271 | Ga0207663_10752257 | 3300025916 | Bacteria | 774 |
| 272 | Ga0207660_10017445 | 3300025917 | Bacteria | 4770 |
| 273 | Ga0207660_10017816 | 3300025917 | Bacteria | 4726 |
| 274 | Ga0207660_10315680 | 3300025917 | Bacteria | 1247 |
| 275 | Ga0207660_10807295 | 3300025917 | Unclassified | 766 |
| 276 | Ga0207660_10850234 | 3300025917 | Bacteria | 745 |
| 277 | Ga0207662_10091336 | 3300025918 | Bacteria | 1873 |
| 278 | Ga0207657_10003977 | 3300025919 | Bacteria | 15705 |
| 279 | Ga0207657_10005514 | 3300025919 | Bacteria | 13210 |
| 280 | Ga0207657_10006045 | 3300025919 | Bacteria | 12582 |
| 281 | Ga0207657_10011616 | 3300025919 | Bacteria | 8734 |
| 282 | Ga0207657_10037356 | 3300025919 | Bacteria | 4338 |
| 283 | Ga0207657_10645388 | 3300025919 | Bacteria | 824 |
| 284 | Ga0207649_10034276 | 3300025920 | Bacteria | 3040 |
| 285 | Ga0207649_10129540 | 3300025920 | Bacteria | 1712 |
| 286 | Ga0207649_10408685 | 3300025920 | Bacteria | 1017 |
| 287 | Ga0207649_10672029 | 3300025920 | Bacteria | 802 |
| 288 | Ga0207649_11080277 | 3300025920 | Unclassified | 633 |
| 289 | Ga0207652_10004445 | 3300025921 | Bacteria | 11420 |
| 290 | Ga0207652_10063362 | 3300025921 | Bacteria | 3197 |
| 291 | Ga0207652_10111726 | 3300025921 | Bacteria | 2424 |
| 292 | Ga0207652_10354970 | 3300025921 | Bacteria | 1323 |
| 293 | Ga0207652_10820998 | 3300025921 | Bacteria | 825 |
| 294 | Ga0207652_11094366 | 3300025921 | Bacteria | 697 |
| 295 | Ga0207681_10951633 | 3300025923 | Bacteria | 720 |
| 296 | Ga0207694_10031169 | 3300025924 | Bacteria | 4072 |
| 297 | Ga0207694_10627813 | 3300025924 | Bacteria | 904 |
| 298 | Ga0207694_10821555 | 3300025924 | Bacteria | 785 |
| 299 | Ga0207650_10378471 | 3300025925 | Unclassified | 1169 |
| 300 | Ga0207659_10293146 | 3300025926 | Unclassified | 1334 |
| 301 | Ga0207687_10004237 | 3300025927 | Bacteria | 9590 |
| 302 | Ga0207687_10083146 | 3300025927 | Bacteria | 2317 |
| 303 | Ga0207687_10938467 | 3300025927 | Bacteria | 741 |
| 304 | Ga0207700_10548297 | 3300025928 | Unclassified | 1026 |
| 305 | Ga0207664_10537782 | 3300025929 | Bacteria | 1048 |
| 306 | Ga0207664_10592432 | 3300025929 | Unclassified | 995 |
| 307 | Ga0207664_10761727 | 3300025929 | Bacteria | 871 |
| 308 | Ga0207664_11026260 | 3300025929 | Bacteria | 739 |
| 309 | Ga0207664_11279163 | 3300025929 | Bacteria | 653 |
| 310 | Ga0207644_10535388 | 3300025931 | Bacteria | 969 |
| 311 | Ga0207690_10035494 | 3300025932 | Bacteria | 3221 |
| 312 | Ga0207690_10147847 | 3300025932 | Bacteria | 1739 |
| 313 | Ga0207690_10235268 | 3300025932 | Bacteria | 1408 |
| 314 | Ga0207690_10378482 | 3300025932 | Bacteria | 1124 |
| 315 | Ga0207690_10416799 | 3300025932 | Bacteria | 1074 |
| 316 | Ga0207706_10069229 | 3300025933 | Bacteria | 3104 |
| 317 | Ga0207709_10078734 | 3300025935 | Bacteria | 2117 |
| 318 | Ga0207670_10143722 | 3300025936 | Bacteria | 1762 |
| 319 | Ga0207670_10630915 | 3300025936 | Bacteria | 882 |
| 320 | Ga0207669_10019902 | 3300025937 | Bacteria | 3506 |
| 321 | Ga0207704_10327523 | 3300025938 | Bacteria | 1184 |
| 322 | Ga0207665_10030025 | 3300025939 | Bacteria | 3592 |
| 323 | Ga0207711_10860552 | 3300025941 | Bacteria | 843 |
| 324 | Ga0207689_10011471 | 3300025942 | Bacteria | 7595 |
| 325 | Ga0207661_10028651 | 3300025944 | Bacteria | 4267 |
| 326 | Ga0207661_10326308 | 3300025944 | Bacteria | 1381 |
| 327 | Ga0207661_10580822 | 3300025944 | Bacteria | 1028 |
| 328 | Ga0207661_10595452 | 3300025944 | Bacteria | 1015 |
| 329 | Ga0207679_11488638 | 3300025945 | Bacteria | 621 |
| 330 | Ga0207667_10023514 | 3300025949 | Bacteria | 6785 |
| 331 | Ga0207667_10048297 | 3300025949 | Bacteria | 4501 |
| 332 | Ga0207667_10141333 | 3300025949 | Bacteria | 2478 |
| 333 | Ga0207667_10196978 | 3300025949 | Bacteria | 2067 |
| 334 | Ga0207667_10533182 | 3300025949 | Bacteria | 1188 |
| 335 | Ga0207667_10612497 | 3300025949 | Unclassified | 1097 |
| 336 | Ga0207712_10041383 | 3300025961 | Bacteria | 3166 |
| 337 | Ga0207712_10144896 | 3300025961 | Bacteria | 1827 |
| 338 | Ga0207668_10522944 | 3300025972 | Bacteria | 1024 |
| 339 | Ga0207640_10043974 | 3300025981 | Bacteria | 2858 |
| 340 | Ga0207640_10503988 | 3300025981 | Bacteria | 1009 |
| 341 | Ga0207677_10006522 | 3300026023 | Bacteria | 6408 |
| 342 | Ga0207677_10414514 | 3300026023 | Bacteria | 1146 |
| 343 | Ga0207703_10070287 | 3300026035 | Bacteria | 2889 |
| 344 | Ga0207703_11027523 | 3300026035 | Bacteria | 791 |
| 345 | Ga0207678_10172388 | 3300026067 | Bacteria | 1847 |
| 346 | Ga0207678_10195005 | 3300026067 | Bacteria | 1731 |
| 347 | Ga0207678_10618074 | 3300026067 | Bacteria | 951 |
| 348 | Ga0207708_10009849 | 3300026075 | Bacteria | 7093 |
| 349 | Ga0207708_10017816 | 3300026075 | Bacteria | 5345 |
| 350 | Ga0207702_10114925 | 3300026078 | Bacteria | 2399 |
| 351 | Ga0207702_10374591 | 3300026078 | Bacteria | 1368 |
| 352 | Ga0207702_10682761 | 3300026078 | Bacteria | 1011 |
| 353 | Ga0207674_10002083 | 3300026116 | Bacteria | 25331 |
| 354 | Ga0207674_10112588 | 3300026116 | Bacteria | 2695 |
| 355 | Ga0207675_100602663 | 3300026118 | Bacteria | 1102 |
| 356 | Ga0207675_100630140 | 3300026118 | Bacteria | 1077 |
| 357 | Ga0207683_10648284 | 3300026121 | Bacteria | 978 |
| 358 | Ga0207698_10578362 | 3300026142 | Bacteria | 1105 |
| 359 | Ga0207698_10747567 | 3300026142 | Bacteria | 976 |
| 360 | Ga0207698_11386045 | 3300026142 | Bacteria | 718 |
| 361 | Ga0207698_11580635 | 3300026142 | Unclassified | 671 |
| 362 | Ga0207428_10109758 | 3300027907 | Bacteria | 2124 |
| 363 | Ga0268266_10055904 | 3300028379 | Bacteria | 3394 |
| 364 | Ga0268266_10236597 | 3300028379 | Bacteria | 1684 |
| 365 | Ga0268266_10253135 | 3300028379 | Bacteria | 1630 |
| 366 | Ga0268265_10460456 | 3300028380 | Bacteria | 1190 |
| 367 | Ga0268264_10130825 | 3300028381 | Bacteria | 2224 |
| 368 | Ga0268264_10691142 | 3300028381 | Unclassified | 1013 |
| 369 | Ga0265326_10101544 | 3300028558 | Bacteria | 816 |
| 370 | Ga0265334_10112907 | 3300028573 | Bacteria | 975 |
| 371 | Ga0265318_10017960 | 3300028577 | Bacteria | 2895 |
| 372 | Ga0265318_10054636 | 3300028577 | Bacteria | 1496 |
| 373 | Ga0265318_10066103 | 3300028577 | Bacteria | 1344 |
| 374 | Ga0265322_10011308 | 3300028654 | Bacteria | 2589 |
| 375 | Ga0265338_10013856 | 3300028800 | Bacteria | 9057 |
| 376 | Ga0265338_10051579 | 3300028800 | Bacteria | 3702 |
| 377 | Ga0265338_10060338 | 3300028800 | Bacteria | 3334 |
| 378 | Ga0265338_10144842 | 3300028800 | Bacteria | 1855 |
| 379 | Ga0265338_10342268 | 3300028800 | Bacteria | 1077 |
| 380 | Ga0265330_10074404 | 3300031235 | Bacteria | 1468 |
| 381 | Ga0265325_10027275 | 3300031241 | Bacteria | 3088 |
| 382 | Ga0265340_10030522 | 3300031247 | Bacteria | 2701 |
| 383 | Ga0265340_10172819 | 3300031247 | Bacteria | 978 |
| 384 | Ga0265339_10090713 | 3300031249 | Bacteria | 1602 |
| 385 | Ga0265327_10003047 | 3300031251 | Bacteria | 16584 |
| 386 | Ga0265327_10018739 | 3300031251 | Bacteria | 4278 |
| 387 | Ga0265327_10055378 | 3300031251 | Bacteria | 2049 |
| 388 | Ga0265327_10076032 | 3300031251 | Bacteria | 1669 |
| 389 | Ga0265316_10002206 | 3300031344 | Bacteria | 20468 |
| 390 | Ga0307408_100062840 | 3300031548 | Bacteria | 2715 |
| 391 | Ga0265313_10061702 | 3300031595 | Bacteria | 1753 |
| 392 | Ga0265313_10084827 | 3300031595 | Bacteria | 1432 |
| 393 | Ga0265314_10003413 | 3300031711 | Bacteria | 15378 |
| 394 | Ga0265314_10086123 | 3300031711 | Bacteria | 2058 |
| 395 | Ga0265314_10174511 | 3300031711 | Bacteria | 1294 |
| 396 | Ga0265342_10069720 | 3300031712 | Bacteria | 2052 |
| 397 | Ga0307409_100860448 | 3300031995 | Unclassified | 918 |
| 398 | Ga0373926_0056892 | 3300035083 | Bacteria | 1420 |
| 399 | Ga0373944_0056438 | 3300035089 | Unclassified | 1250 |
| 400 | Ga0373923_0094277 | 3300035111 | Unclassified | 1313 |
| 401 | Ga0373932_0280071 | 3300035112 | Unclassified | 617 |
| 402 | Ga0373936_0165745 | 3300035113 | Bacteria | 964 |
| 403 | Ga0373936_0493781 | 3300035113 | Bacteria | 569 |
| 404 | Ga0373945_0226331 | 3300035116 | Unclassified | 783 |
| 405 | Ga0373945_0259168 | 3300035116 | Bacteria | 736 |
| 406 | Ga0373954_0094483 | 3300035118 | Bacteria | 1439 |
| 407 | Ga0373956_0212368 | 3300035119 | Unclassified | 918 |
| 408 | Ga0373957_0253734 | 3300035120 | Unclassified | 740 |
| 409 | Ga0373943_0001309 | 3300035170 | Bacteria | 11182 |
| 410 | Ga0373943_0017100 | 3300035170 | Bacteria | 3317 |
| 411 | Ga0373943_0042530 | 3300035170 | Bacteria | 2202 |
| 412 | Ga0373946_0030604 | 3300035171 | Bacteria | 2150 |
| 413 | Ga0373946_0771807 | 3300035171 | Bacteria | 505 |
| 414 | Ga0373924_0338841 | 3300035410 | Bacteria | 670 |
| 415 | Ga0373931_0239202 | 3300035691 | Bacteria | 1100 |
| 416 | Ga0373931_0572659 | 3300035691 | Bacteria | 736 |
| 417 | Ga0373935_0094332 | 3300035692 | Bacteria | 1963 |
| 418 | Ga0373927_0429531 | 3300035695 | Unclassified | 872 |
| 419 | Ga0373933_0018885 | 3300035724 | Bacteria | 3884 |
| 420 | Ga0373947_0002249 | 3300035725 | Bacteria | 11665 |
| 421 | Ga0373947_0007984 | 3300035725 | Bacteria | 6103 |
| 422 | Ga0373947_0038780 | 3300035725 | Bacteria | 2832 |
| 423 | Ga0373947_0390750 | 3300035725 | Bacteria | 937 |
| 424 | Ga0373925_0031071 | 3300037068 | Bacteria | 3922 |
| 425 | Ga0373925_0045718 | 3300037068 | Bacteria | 3253 |
| 426 | Ga0373925_0047599 | 3300037068 | Bacteria | 3192 |
| 427 | Ga0373925_0571228 | 3300037068 | Bacteria | 930 |
| 428 | Ga0395899_0087202 | 3300037312 | Bacteria | 2266 |
| 429 | Ga0395899_0109281 | 3300037312 | Bacteria | 1990 |
| 430 | Ga0395899_0177516 | 3300037312 | Bacteria | 1497 |
| 431 | Ga0395899_0625793 | 3300037312 | Bacteria | 683 |
| 432 | Ga0395899_0892041 | 3300037312 | Unclassified | 543 |
| 433 | Ga0395900_0042379 | 3300037418 | Bacteria | 4691 |
| 434 | Ga0395900_0061702 | 3300037418 | Bacteria | 3854 |
| 435 | Ga0395900_0066125 | 3300037418 | Bacteria | 3715 |
| 436 | Ga0395900_0082795 | 3300037418 | Bacteria | 3297 |
| 437 | Ga0395900_0152117 | 3300037418 | Bacteria | 2364 |
| 438 | Ga0395900_0156960 | 3300037418 | Bacteria | 2324 |
| 439 | Ga0395900_0419444 | 3300037418 | Bacteria | 1299 |
| 440 | Ga0395900_0794100 | 3300037418 | Bacteria | 875 |
| 441 | Ga0395898_0002616 | 3300037466 | Bacteria | 20962 |
| 442 | Ga0395898_0018106 | 3300037466 | Bacteria | 7189 |
| 443 | Ga0395898_0059516 | 3300037466 | Bacteria | 3715 |
| 444 | Ga0395898_0098449 | 3300037466 | Bacteria | 2808 |
| 445 | Ga0395898_0432054 | 3300037466 | Bacteria | 1255 |
| 446 | Ga0395898_0440983 | 3300037466 | Bacteria | 1240 |
| 447 | Ga0395898_0500125 | 3300037466 | Bacteria | 1156 |
| 448 | Ga0395898_1585869 | 3300037466 | Unclassified | 579 |
| 449 | Ga0395898_1882279 | 3300037466 | Bacteria | 519 |
| 450 | Ga0395905_0027769 | 3300037471 | Bacteria | 5337 |
| 451 | Ga0395905_0147780 | 3300037471 | Unclassified | 2211 |
| 452 | Ga0395905_0456890 | 3300037471 | Bacteria | 1175 |
| 453 | Ga0395905_1740806 | 3300037471 | Bacteria | 529 |
| 454 | Ga0395905_1800849 | 3300037471 | Bacteria | 518 |
| 455 | Ga0436364_1344902 | 3300037853 | Bacteria | 1110 |
| 456 | Ga0395901_0014181 | 3300038443 | Bacteria | 8114 |
| 457 | Ga0395901_0079240 | 3300038443 | Bacteria | 3430 |
| 458 | Ga0395901_0136216 | 3300038443 | Bacteria | 2581 |
| 459 | Ga0395901_0265129 | 3300038443 | Bacteria | 1787 |
| 460 | Ga0395901_0491990 | 3300038443 | Bacteria | 1250 |
| 461 | Ga0395901_0510823 | 3300038443 | Bacteria | 1222 |
| 462 | Ga0395901_0523408 | 3300038443 | Bacteria | 1204 |
| 463 | Ga0436365_0024573 | 3300039437 | Bacteria | 1109 |
| 464 | Ga0436360_0637419 | 3300039438 | Bacteria | 5531 |
| 465 | Ga0436363_1209816 | 3300039450 | Bacteria | 1377 |
| 466 | Ga0436363_1414311 | 3300039450 | Bacteria | 1810 |
| 467 | Ga0436362_0655244 | 3300039453 | Bacteria | 1591 |
| 468 | Ga0436362_0738256 | 3300039453 | Bacteria | 3305 |
| 469 | Ga0451802_1645868 | 3300041460 | Bacteria | 602 |
| 470 | Ga0451806_408931 | 3300041462 | Bacteria | 531 |
| 471 | Ga0451839_1417588 | 3300041496 | Unclassified | 751 |
| 472 | Ga0451853_0611674 | 3300041512 | Unclassified | 1136 |
| 473 | Ga0466969_0411513 | 3300044656 | Bacteria | 614 |
| 474 | Ga0466972_0482237 | 3300044658 | Bacteria | 583 |
| 475 | Ga0466966_0034771 | 3300044684 | Bacteria | 3258 |
| 476 | Ga0466966_0090891 | 3300044684 | Bacteria | 1896 |
| 477 | Ga0466966_0114382 | 3300044684 | Bacteria | 1661 |
| 478 | Ga0466966_0171835 | 3300044684 | Bacteria | 1317 |
| 479 | Ga0466966_0236749 | 3300044684 | Bacteria | 1101 |
| 480 | Ga0466966_0296349 | 3300044684 | Bacteria | 972 |
| 481 | Ga0466961_0005606 | 3300044693 | Bacteria | 7932 |
| 482 | Ga0466961_0041711 | 3300044693 | Bacteria | 2942 |
| 483 | Ga0466961_0067154 | 3300044693 | Bacteria | 2278 |
| 484 | Ga0466963_0001686 | 3300044694 | Bacteria | 12038 |
| 485 | Ga0466963_0039235 | 3300044694 | Bacteria | 3100 |
| 486 | Ga0466963_0204388 | 3300044694 | Bacteria | 1381 |
| 487 | Ga0466963_0528750 | 3300044694 | Unclassified | 833 |
| 488 | Ga0466963_0814367 | 3300044694 | Bacteria | 658 |
| 489 | Ga0466963_0819397 | 3300044694 | Bacteria | 656 |
| 490 | Ga0466963_0954222 | 3300044694 | Bacteria | 604 |
| 491 | Ga0466964_0011257 | 3300044706 | Bacteria | 3379 |
| 492 | Ga0466964_0064444 | 3300044706 | Bacteria | 1533 |
| 493 | Ga0466964_0069204 | 3300044706 | Bacteria | 1488 |
| 494 | Ga0466964_0632466 | 3300044706 | Bacteria | 590 |
| 495 | Ga0466971_0026907 | 3300044719 | Bacteria | 2574 |
| 496 | Ga0466971_0030805 | 3300044719 | Bacteria | 2401 |
| 497 | Ga0466971_0037502 | 3300044719 | Bacteria | 2172 |
| 498 | Ga0466968_0013261 | 3300044735 | Bacteria | 3239 |
| 499 | Ga0466968_0013361 | 3300044735 | Bacteria | 3229 |
| 500 | Ga0466970_0051419 | 3300044765 | Bacteria | 2199 |
| 501 | Ga0466970_0863634 | 3300044765 | Bacteria | 531 |
| 502 | Ga0466957_0023601 | 3300044842 | Bacteria | 3636 |
| 503 | Ga0466957_0054182 | 3300044842 | Bacteria | 2447 |
| 504 | Ga0466957_0172289 | 3300044842 | Bacteria | 1410 |
| 505 | Ga0466957_1205275 | 3300044842 | Bacteria | 548 |
| 506 | Ga0466959_0017673 | 3300045049 | Bacteria | 5230 |
| 507 | Ga0466959_0027523 | 3300045049 | Bacteria | 4217 |
| 508 | Ga0466959_0048565 | 3300045049 | Bacteria | 3119 |
| 509 | Ga0466959_0079871 | 3300045049 | Bacteria | 2359 |
| 510 | Ga0466959_0083882 | 3300045049 | Bacteria | 2294 |
| 511 | Ga0466959_0111240 | 3300045049 | Bacteria | 1954 |
| 512 | Ga0451576_0331672 | 3300045051 | Bacteria | 1592 |
| 513 | Ga0451576_1197738 | 3300045051 | Bacteria | 793 |
| 514 | Ga0466958_0000208 | 3300045836 | Bacteria | 21875 |
| 515 | Ga0466958_0039817 | 3300045836 | Bacteria | 2824 |
| 516 | Ga0466958_0091463 | 3300045836 | Bacteria | 1884 |
| 517 | Ga0466958_0296889 | 3300045836 | Bacteria | 1037 |
| 518 | Ga0466967_0001314 | 3300045976 | Bacteria | 14204 |
| 519 | Ga0466967_0002552 | 3300045976 | Bacteria | 11411 |
| 520 | Ga0466967_0006757 | 3300045976 | Bacteria | 8167 |
| 521 | Ga0466967_0037241 | 3300045976 | Bacteria | 4161 |
| 522 | Ga0466967_0049004 | 3300045976 | Bacteria | 3692 |
| 523 | Ga0466967_0075564 | 3300045976 | Bacteria | 3028 |
| 524 | Ga0466967_0099170 | 3300045976 | Bacteria | 2660 |
| 525 | Ga0466967_0152964 | 3300045976 | Bacteria | 2158 |
| 526 | Ga0466967_0159432 | 3300045976 | Bacteria | 2116 |
| 527 | Ga0466967_0274409 | 3300045976 | Bacteria | 1616 |
| 528 | Ga0466967_0313385 | 3300045976 | Bacteria | 1512 |
| 529 | Ga0466967_0363585 | 3300045976 | Bacteria | 1402 |
| 530 | Ga0466967_0433496 | 3300045976 | Bacteria | 1282 |
| 531 | Ga0466967_0561556 | 3300045976 | Bacteria | 1124 |
| 532 | Ga0466967_0644394 | 3300045976 | Bacteria | 1047 |
| 533 | Ga0466967_1268956 | 3300045976 | Bacteria | 734 |
| 534 | Ga0466967_1844358 | 3300045976 | Bacteria | 602 |
| 535 | Ga0466967_1897917 | 3300045976 | Bacteria | 592 |
| 536 | Ga0495592_0024548 | 3300046454 | Bacteria | 4582 |
| 537 | Ga0495592_0049041 | 3300046454 | Bacteria | 3140 |
| 538 | Ga0495603_0016807 | 3300046455 | Bacteria | 4427 |
| 539 | Ga0495603_0025289 | 3300046455 | Bacteria | 3591 |
| 540 | Ga0495629_0076995 | 3300046459 | Bacteria | 2328 |
| 541 | Ga0495629_0115674 | 3300046459 | Bacteria | 1869 |
| 542 | Ga0495629_0206331 | 3300046459 | Bacteria | 1358 |
| 543 | Ga0495629_0394377 | 3300046459 | Bacteria | 941 |
| 544 | Ga0495641_0008508 | 3300046461 | Bacteria | 6241 |
| 545 | Ga0495641_0011878 | 3300046461 | Bacteria | 4919 |
| 546 | Ga0495641_0093315 | 3300046461 | Bacteria | 1345 |
| 547 | Ga0495641_0307005 | 3300046461 | Bacteria | 715 |
| 548 | Ga0495641_0377848 | 3300046461 | Bacteria | 642 |
| 549 | Ga0495651_0030082 | 3300046462 | Bacteria | 4234 |
| 550 | Ga0495651_0030293 | 3300046462 | Bacteria | 4220 |
| 551 | Ga0495651_0383970 | 3300046462 | Bacteria | 920 |
| 552 | Ga0495653_0043265 | 3300046463 | Bacteria | 3503 |
| 553 | Ga0495653_0122739 | 3300046463 | Bacteria | 1848 |
| 554 | Ga0495582_0012801 | 3300046473 | Bacteria | 4621 |
| 555 | Ga0495582_0774602 | 3300046473 | Bacteria | 555 |
| 556 | Ga0495639_0023393 | 3300046475 | Bacteria | 2715 |
| 557 | Ga0495639_0184656 | 3300046475 | Bacteria | 1016 |
| 558 | Ga0495662_0013635 | 3300046476 | Bacteria | 3957 |
| 559 | Ga0495662_0105815 | 3300046476 | Bacteria | 1377 |
| 560 | Ga0495664_0007418 | 3300046477 | Bacteria | 6089 |
| 561 | Ga0495664_0035068 | 3300046477 | Bacteria | 2953 |
| 562 | Ga0495664_0394444 | 3300046477 | Bacteria | 831 |
| 563 | Ga0495594_0041068 | 3300046499 | Bacteria | 2533 |
| 564 | Ga0495594_0757752 | 3300046499 | Bacteria | 548 |
| 565 | Ga0495608_0022077 | 3300046511 | Bacteria | 4363 |
| 566 | Ga0495608_0028165 | 3300046511 | Bacteria | 3818 |
| 567 | Ga0495608_0030660 | 3300046511 | Bacteria | 3640 |
| 568 | Ga0495618_0100475 | 3300046514 | Bacteria | 1851 |
| 569 | Ga0495618_0126879 | 3300046514 | Bacteria | 1633 |
| 570 | Ga0495628_0015735 | 3300046516 | Bacteria | 6315 |
| 571 | Ga0495628_0217343 | 3300046516 | Bacteria | 1436 |
| 572 | Ga0495630_0002069 | 3300046517 | Bacteria | 13948 |
| 573 | Ga0495630_0004136 | 3300046517 | Bacteria | 10161 |
| 574 | Ga0495630_0131651 | 3300046517 | Bacteria | 1899 |
| 575 | Ga0495630_0708237 | 3300046517 | Unclassified | 770 |
| 576 | Ga0495630_1190320 | 3300046517 | Bacteria | 576 |
| 577 | Ga0495666_0064156 | 3300046526 | Bacteria | 1753 |
| 578 | Ga0495652_0027828 | 3300046529 | Bacteria | 4980 |
| 579 | Ga0495652_0441047 | 3300046529 | Bacteria | 913 |
| 580 | Ga0495652_0513110 | 3300046529 | Bacteria | 829 |
| 581 | Ga0495665_0051934 | 3300046531 | Bacteria | 2170 |
| 582 | Ga0495640_0005760 | 3300046533 | Bacteria | 9844 |
| 583 | Ga0495640_0017637 | 3300046533 | Bacteria | 5314 |
| 584 | Ga0495640_0169711 | 3300046533 | Bacteria | 1394 |
| 585 | Ga0495640_0320865 | 3300046533 | Unclassified | 960 |
| 586 | Ga0495640_0329947 | 3300046533 | Bacteria | 944 |
| 587 | Ga0495640_0409897 | 3300046533 | Bacteria | 831 |
| 588 | Ga0495586_0378723 | 3300046535 | Bacteria | 814 |
| 589 | Ga0495587_0044355 | 3300046536 | Bacteria | 2645 |
| 590 | Ga0495587_0235606 | 3300046536 | Bacteria | 1031 |
| 591 | Ga0495587_0344116 | 3300046536 | Bacteria | 832 |
| 592 | Ga0495587_0394285 | 3300046536 | Unclassified | 769 |
| 593 | Ga0495645_0552519 | 3300046543 | Bacteria | 713 |
| 594 | Ga0495667_0001444 | 3300046559 | Bacteria | 15650 |
| 595 | Ga0495667_0001994 | 3300046559 | Bacteria | 13519 |
| 596 | Ga0495667_0013594 | 3300046559 | Bacteria | 5503 |
| 597 | Ga0495667_0288536 | 3300046559 | Bacteria | 1041 |
| 598 | Ga0495634_0008262 | 3300046642 | Bacteria | 7763 |
| 599 | Ga0495634_0031500 | 3300046642 | Bacteria | 3653 |
| 600 | Ga0495634_0056762 | 3300046642 | Bacteria | 2615 |
| 601 | Ga0495635_0024659 | 3300046663 | Bacteria | 4191 |
| 602 | Ga0495635_0139515 | 3300046663 | Bacteria | 1651 |
| 603 | Ga0495635_0253415 | 3300046663 | Bacteria | 1186 |
| 604 | Ga0495588_0270708 | 3300046674 | Bacteria | 895 |
| 605 | Ga0495588_0343854 | 3300046674 | Bacteria | 784 |
| 606 | Ga0495657_0071790 | 3300046675 | Bacteria | 2259 |
| 607 | Ga0495657_0258476 | 3300046675 | Bacteria | 1047 |
| 608 | Ga0495657_0285169 | 3300046675 | Bacteria | 987 |
| 609 | Ga0495599_0081417 | 3300046678 | Bacteria | 2022 |
| 610 | Ga0495599_0105223 | 3300046678 | Bacteria | 1758 |
| 611 | Ga0495599_0272701 | 3300046678 | Bacteria | 1026 |
| 612 | Ga0495646_0150612 | 3300046680 | Bacteria | 1294 |
| 613 | Ga0495646_0166574 | 3300046680 | Bacteria | 1217 |
| 614 | Ga0495647_0019270 | 3300046681 | Bacteria | 2438 |
| 615 | Ga0495658_0073103 | 3300046683 | Bacteria | 1995 |
| 616 | Ga0495658_0302512 | 3300046683 | Bacteria | 1012 |
| 617 | Ga0495613_0045353 | 3300046689 | Bacteria | 3251 |
| 618 | Ga0495613_0054486 | 3300046689 | Bacteria | 2939 |
| 619 | Ga0495613_0164409 | 3300046689 | Bacteria | 1577 |
| 620 | Ga0495613_0888190 | 3300046689 | Bacteria | 577 |
| 621 | Ga0495624_0021784 | 3300046690 | Bacteria | 4246 |
| 622 | Ga0495624_0145763 | 3300046690 | Bacteria | 1449 |
| 623 | Ga0495624_0157242 | 3300046690 | Bacteria | 1389 |
| 624 | Ga0495600_0001166 | 3300046809 | Bacteria | 14336 |
| 625 | Ga0495600_0101104 | 3300046809 | Bacteria | 1879 |
| 626 | Ga0495600_0168124 | 3300046809 | Bacteria | 1416 |
| 627 | Ga0495581_0004109 | 3300047315 | Bacteria | 8375 |
| 628 | Ga0495581_0212275 | 3300047315 | Bacteria | 1132 |
| 629 | Ga0495581_0412476 | 3300047315 | Unclassified | 787 |
| 630 | Ga0495604_0085473 | 3300047317 | Bacteria | 2354 |
| 631 | Ga0495604_0178215 | 3300047317 | Bacteria | 1488 |
| 632 | Ga0495604_0379185 | 3300047317 | Bacteria | 934 |
| 633 | Ga0495604_0607863 | 3300047317 | Bacteria | 700 |
| 634 | Ga0495674_0001928 | 3300047319 | Bacteria | 20475 |
| 635 | Ga0495674_0028248 | 3300047319 | Bacteria | 5119 |
| 636 | Ga0495674_0055342 | 3300047319 | Bacteria | 3480 |
| 637 | Ga0495674_0075363 | 3300047319 | Bacteria | 2903 |
| 638 | Ga0495674_0098705 | 3300047319 | Bacteria | 2487 |
| 639 | Ga0495674_0113547 | 3300047319 | Bacteria | 2294 |
| 640 | Ga0495674_0120041 | 3300047319 | Bacteria | 2222 |
| 641 | Ga0495676_0016380 | 3300047321 | Bacteria | 6583 |
| 642 | Ga0495676_0136964 | 3300047321 | Bacteria | 1759 |
| 643 | Ga0495676_0337744 | 3300047321 | Bacteria | 1009 |
| 644 | Ga0495676_0356055 | 3300047321 | Bacteria | 978 |
| 645 | Ga0495680_0004318 | 3300047322 | Bacteria | 13624 |
| 646 | Ga0495680_0042648 | 3300047322 | Bacteria | 3598 |
| 647 | Ga0495680_0516712 | 3300047322 | Unclassified | 809 |
| 648 | Ga0495675_0075599 | 3300047444 | Bacteria | 2123 |
| 649 | Ga0495684_0010521 | 3300047471 | Bacteria | 7154 |
| 650 | Ga0495684_0042197 | 3300047471 | Bacteria | 3494 |
| 651 | Ga0495684_0120732 | 3300047471 | Bacteria | 1974 |
| 652 | Ga0495593_0093335 | 3300047673 | Bacteria | 1549 |
| 653 | Ga0495593_0102281 | 3300047673 | Bacteria | 1469 |
| 654 | Ga0495593_0161077 | 3300047673 | Unclassified | 1132 |
| 655 | Ga0495602_0376265 | 3300048088 | Unclassified | 1018 |
| 656 | Ga0495614_0137698 | 3300048089 | Unclassified | 1083 |
| 657 | Ga0496100_0042219 | 3300048903 | Bacteria | 2912 |
| 658 | Ga0496100_0092566 | 3300048903 | Bacteria | 2066 |
| 659 | Ga0496100_0109415 | 3300048903 | Bacteria | 1917 |
| 660 | Ga0496100_0161135 | 3300048903 | Bacteria | 1608 |
| 661 | Ga0496100_0202473 | 3300048903 | Bacteria | 1447 |
| 662 | Ga0496100_0678502 | 3300048903 | Unclassified | 803 |
| 663 | Ga0496100_0920642 | 3300048903 | Unclassified | 687 |
| 664 | Ga0496101_0001814 | 3300048904 | Bacteria | 12868 |
| 665 | Ga0496101_0004861 | 3300048904 | Bacteria | 8524 |
| 666 | Ga0496101_0258655 | 3300048904 | Bacteria | 1357 |
| 667 | Ga0496101_0668979 | 3300048904 | Unclassified | 820 |
| 668 | Ga0496101_0767288 | 3300048904 | Bacteria | 761 |
| 669 | Ga0496102_0052256 | 3300048905 | Bacteria | 3722 |
| 670 | Ga0496102_0125102 | 3300048905 | Bacteria | 2403 |
| 671 | Ga0496102_0187419 | 3300048905 | Bacteria | 1950 |
| 672 | Ga0496102_0304705 | 3300048905 | Bacteria | 1501 |
| 673 | Ga0496102_0368080 | 3300048905 | Bacteria | 1353 |
| 674 | Ga0496102_0470111 | 3300048905 | Bacteria | 1178 |
| 675 | Ga0496102_0604213 | 3300048905 | Bacteria | 1020 |
| 676 | Ga0496102_0764549 | 3300048905 | Bacteria | 889 |
| 677 | Ga0496103_0040431 | 3300048906 | Bacteria | 2865 |
| 678 | Ga0496103_0075386 | 3300048906 | Bacteria | 2116 |
| 679 | Ga0496103_0141998 | 3300048906 | Bacteria | 1536 |
| 680 | Ga0496103_0753973 | 3300048906 | Bacteria | 615 |
| 681 | Ga0496104_0056269 | 3300048907 | Bacteria | 3719 |
| 682 | Ga0496104_0065620 | 3300048907 | Bacteria | 3445 |
| 683 | Ga0496104_0097950 | 3300048907 | Bacteria | 2807 |
| 684 | Ga0496104_0335295 | 3300048907 | Bacteria | 1425 |
| 685 | Ga0496104_0349592 | 3300048907 | Bacteria | 1391 |
| 686 | Ga0496104_0573717 | 3300048907 | Bacteria | 1039 |
| 687 | Ga0496104_1686676 | 3300048907 | Unclassified | 536 |
| 688 | Ga0496105_0007666 | 3300048908 | Bacteria | 8369 |
| 689 | Ga0496105_0015440 | 3300048908 | Bacteria | 6086 |
| 690 | Ga0496105_0024596 | 3300048908 | Bacteria | 4894 |
| 691 | Ga0496105_0051065 | 3300048908 | Bacteria | 3417 |
| 692 | Ga0496105_0056995 | 3300048908 | Bacteria | 3226 |
| 693 | Ga0496105_0170737 | 3300048908 | Bacteria | 1783 |
| 694 | Ga0496106_0001681 | 3300048909 | Bacteria | 16555 |
| 695 | Ga0496106_0007513 | 3300048909 | Bacteria | 8057 |
| 696 | Ga0496106_0037477 | 3300048909 | Bacteria | 3627 |
| 697 | Ga0496107_0030353 | 3300048910 | Bacteria | 3852 |
| 698 | Ga0496107_0045645 | 3300048910 | Bacteria | 3152 |
| 699 | Ga0496107_0065477 | 3300048910 | Bacteria | 2634 |
| 700 | Ga0496107_0086712 | 3300048910 | Bacteria | 2285 |
| 701 | Ga0496107_0113911 | 3300048910 | Bacteria | 1989 |
| 702 | Ga0496108_0002006 | 3300048911 | Bacteria | 16312 |
| 703 | Ga0496108_0002053 | 3300048911 | Bacteria | 16134 |
| 704 | Ga0496108_0049211 | 3300048911 | Bacteria | 3525 |
| 705 | Ga0496108_0110235 | 3300048911 | Bacteria | 2353 |
| 706 | Ga0496108_0765976 | 3300048911 | Bacteria | 834 |
| 707 | Ga0496108_1324558 | 3300048911 | Bacteria | 605 |
| 708 | Ga0496109_0013489 | 3300048912 | Bacteria | 7089 |
| 709 | Ga0496109_0041081 | 3300048912 | Bacteria | 4190 |
| 710 | Ga0496109_0080397 | 3300048912 | Bacteria | 3003 |
| 711 | Ga0496109_0233345 | 3300048912 | Bacteria | 1731 |
| 712 | Ga0496109_0442951 | 3300048912 | Unclassified | 1227 |
| 713 | Ga0496109_0464054 | 3300048912 | Bacteria | 1196 |
| 714 | Ga0496109_0659035 | 3300048912 | Bacteria | 984 |
| 715 | Ga0496110_0003922 | 3300048913 | Bacteria | 11444 |
| 716 | Ga0496110_0049929 | 3300048913 | Bacteria | 3672 |
| 717 | Ga0496110_0087684 | 3300048913 | Bacteria | 2779 |
| 718 | Ga0496110_0172781 | 3300048913 | Bacteria | 1961 |
| 719 | Ga0496110_0432359 | 3300048913 | Bacteria | 1200 |
| 720 | Ga0496111_0005121 | 3300048914 | Bacteria | 8349 |
| 721 | Ga0496111_0044678 | 3300048914 | Bacteria | 3185 |
| 722 | Ga0496112_0003187 | 3300048915 | Bacteria | 13491 |
| 723 | Ga0496112_0004509 | 3300048915 | Bacteria | 11819 |
| 724 | Ga0496112_0009108 | 3300048915 | Bacteria | 8921 |
| 725 | Ga0496112_0083854 | 3300048915 | Bacteria | 3152 |
| 726 | Ga0496112_0320530 | 3300048915 | Bacteria | 1494 |
| 727 | Ga0496112_0468186 | 3300048915 | Bacteria | 1197 |
| 728 | Ga0496113_0009751 | 3300048916 | Bacteria | 6312 |
| 729 | Ga0496113_0102804 | 3300048916 | Bacteria | 2216 |
| 730 | Ga0496113_0108457 | 3300048916 | Bacteria | 2158 |
| 731 | Ga0496113_0776731 | 3300048916 | Bacteria | 762 |
| 732 | Ga0496114_0025592 | 3300048917 | Bacteria | 4825 |
| 733 | Ga0496114_0032599 | 3300048917 | Bacteria | 4289 |
| 734 | Ga0496114_0126950 | 3300048917 | Bacteria | 2199 |
| 735 | Ga0496114_0161879 | 3300048917 | Bacteria | 1946 |
| 736 | Ga0496114_0213448 | 3300048917 | Bacteria | 1693 |
| 737 | Ga0496114_0281507 | 3300048917 | Bacteria | 1466 |
| 738 | Ga0496114_0475946 | 3300048917 | Bacteria | 1105 |
| 739 | Ga0496115_0071906 | 3300048918 | Bacteria | 2806 |
| 740 | Ga0496115_0298304 | 3300048918 | Bacteria | 1321 |
| 741 | Ga0496115_0421081 | 3300048918 | Bacteria | 1082 |
| 742 | Ga0496115_0681963 | 3300048918 | Unclassified | 809 |
| 743 | Ga0496115_1005816 | 3300048918 | Unclassified | 637 |
| 744 | Ga0501032_0483794 | 3300049569 | Bacteria | 792 |
| 745 | Ga0501032_1032056 | 3300049569 | Bacteria | 516 |
| 746 | Ga0501033_0406639 | 3300049570 | Bacteria | 949 |
| 747 | Ga0501034_0525358 | 3300049571 | Bacteria | 1095 |
| 748 | Ga0501040_0097892 | 3300049576 | Bacteria | 2044 |
| 749 | Ga0501042_0700341 | 3300049578 | Bacteria | 736 |
| 750 | Ga0501047_0076139 | 3300049581 | Bacteria | 3229 |
| 751 | Ga0501047_1297281 | 3300049581 | Bacteria | 542 |
| 752 | Ga0501048_1047782 | 3300049582 | Bacteria | 587 |
| 753 | Ga0501067_0002005 | 3300049583 | Bacteria | 11218 |
| 754 | Ga0501067_0019609 | 3300049583 | Bacteria | 3744 |
| 755 | Ga0501067_0140496 | 3300049583 | Bacteria | 1345 |
| 756 | Ga0501067_0177001 | 3300049583 | Bacteria | 1188 |
| 757 | Ga0501068_0044241 | 3300049584 | Bacteria | 2681 |
| 758 | Ga0501069_0009763 | 3300049585 | Bacteria | 5072 |
| 759 | Ga0501069_0161480 | 3300049585 | Bacteria | 1290 |
| 760 | Ga0501069_0387186 | 3300049585 | Bacteria | 826 |
| 761 | Ga0501069_0768567 | 3300049585 | Unclassified | 583 |
| 762 | Ga0501070_0001179 | 3300049586 | Bacteria | 23338 |
| 763 | Ga0501070_0159385 | 3300049586 | Bacteria | 1861 |
| 764 | Ga0501070_0780572 | 3300049586 | Bacteria | 751 |
| 765 | Ga0501072_0269873 | 3300049588 | Bacteria | 1354 |
| 766 | Ga0501074_0036483 | 3300049590 | Bacteria | 3561 |
| 767 | Ga0501074_0334577 | 3300049590 | Bacteria | 1075 |
| 768 | Ga0501074_0526728 | 3300049590 | Bacteria | 837 |
| 769 | Ga0501077_0025788 | 3300049593 | Bacteria | 3730 |
| 770 | Ga0501077_0868837 | 3300049593 | Bacteria | 580 |
| 771 | Ga0501080_0778410 | 3300049742 | Bacteria | 840 |
| 772 | Ga0501080_1006032 | 3300049742 | Bacteria | 723 |
| 773 | Ga0501035_0385255 | 3300049822 | Bacteria | 1169 |
| 774 | Ga0501044_0831342 | 3300049823 | Bacteria | 801 |
| 775 | Ga0501045_0105902 | 3300049824 | Bacteria | 2084 |
| 776 | nmdc:mga05p37_250174_c1 | 3300050507 | Bacteria | 2126 |
| 777 | nmdc:mga05p37_759631_c1 | 3300050507 | Bacteria | 1067 |
| 778 | nmdc:mga08y16_120588_c1 | 3300050511 | Bacteria | 2729 |
| 779 | nmdc:mga0n895_21702_c1 | 3300050512 | Bacteria | 6009 |
| 780 | nmdc:mga0n895_533388_c1 | 3300050512 | Bacteria | 1180 |
| 781 | nmdc:mga0n895_59212_c1 | 3300050512 | Bacteria | 3779 |
| 782 | nmdc:mga0rr50_25457_c1 | 3300050513 | Bacteria | 4114 |
| 783 | nmdc:mga08x19_32023_c1 | 3300050514 | Bacteria | 3312 |
| 784 | nmdc:mga0a205_259530_c1 | 3300050515 | Bacteria | 1615 |
| 785 | Ga0495601_0020691 | 3300053077 | Bacteria | 4020 |
| 786 | Ga0495601_0102510 | 3300053077 | Bacteria | 1849 |
| 787 | Ga0495601_0202891 | 3300053077 | Bacteria | 1295 |
| 788 | Ga0495601_0238466 | 3300053077 | Unclassified | 1187 |
| 789 | Ga0495601_0605104 | 3300053077 | Bacteria | 703 |
| 790 | Ga0495612_0010120 | 3300053078 | Bacteria | 3815 |
| 791 | Ga0495612_0056444 | 3300053078 | Bacteria | 1621 |
| 792 | Ga0495612_0279825 | 3300053078 | Unclassified | 745 |
| 793 | Ga0495595_0004918 | 3300053084 | Bacteria | 5390 |
| 794 | Ga0495595_0145899 | 3300053084 | Unclassified | 1162 |
| 795 | Ga0495619_0003192 | 3300053085 | Bacteria | 10620 |
| 796 | Ga0495619_0120128 | 3300053085 | Bacteria | 1801 |
| 797 | Ga0495619_0473024 | 3300053085 | Bacteria | 863 |
| 798 | Ga0501084_0860749 | 3300054114 | Unclassified | 763 |
| 799 | Ga0466962_0016201 | 3300061719 | Bacteria | 3595 |
| 800 | Ga0466962_0184731 | 3300061719 | Bacteria | 1017 |
| 801 | Ga0466962_0338224 | 3300061719 | Bacteria | 748 |
| 802 | Ga0530510_0048768 | 3300061734 | Bacteria | 3061 |
| 803 | Ga0070696_100965248 | |||
| 804 | Ga0070658_10124310 | |||
| 805 | Ga0070658_10343226 | |||
| 806 | Ga0070658_10606457 | |||
| 807 | Ga0070658_10809555 | |||
| 808 | Ga0070683_100076297 | |||
| 809 | Ga0070683_100090265 | |||
| 810 | Ga0070683_100351431 | |||
| 811 | Ga0070683_100866834 | |||
| 812 | Ga0070683_102123429 | |||
| 813 | Ga0068869_100131113 | |||
| 814 | Ga0070680_100045576 | |||
| 815 | Ga0070680_100234783 | |||
| 816 | Ga0070680_100885278 | |||
| 817 | Ga0070680_100952105 | |||
| 818 | Ga0070682_100062400 | |||
| 819 | Ga0070682_100814986 | |||
| 820 | Ga0068868_100010799 | |||
| 821 | Ga0068868_100941771 | |||
| 822 | Ga0070660_100002352 | |||
| 823 | Ga0070660_100005889 | |||
| 824 | Ga0070660_100023989 | |||
| 825 | Ga0070660_100094004 | |||
| 826 | Ga0070660_101392375 | |||
| 827 | Ga0070689_100125549 | |||
| 828 | Ga0070689_100309573 | |||
| 829 | Ga0070689_101069124 | |||
| 830 | Ga0070661_100008922 | |||
| 831 | Ga0070661_100068325 | |||
| 832 | Ga0070661_100155711 | |||
| 833 | Ga0070661_100407385 | |||
| 834 | Ga0070661_100979963 | |||
| 835 | Ga0070668_100313895 | |||
| 836 | Ga0070668_100395285 | |||
| 837 | Ga0070669_100611154 | |||
| 838 | Ga0070669_100740767 | |||
| 839 | Ga0070675_100050229 | |||
| 840 | Ga0070675_100356315 | |||
| 841 | Ga0070674_101136295 | |||
| 842 | Ga0070673_100342940 | |||
| 843 | Ga0070673_100638433 | |||
| 844 | Ga0070659_100016427 | |||
| 845 | Ga0070659_100062058 | |||
| 846 | Ga0070659_100065967 | |||
| 847 | Ga0070659_100404443 | |||
| 848 | Ga0070659_101363856 | |||
| 849 | Ga0070709_10074822 | |||
| 850 | Ga0070709_10806703 | |||
| 851 | Ga0070714_100048146 | |||
| 852 | Ga0070714_100793767 | |||
| 853 | Ga0070714_100999601 | |||
| 854 | Ga0070714_101723747 | |||
| 855 | Ga0070713_100326383 | |||
| 856 | Ga0070713_101078635 | |||
| 857 | Ga0070701_10110536 | |||
| 858 | Ga0070701_10519854 | |||
| 859 | Ga0070711_100044029 | |||
| 860 | Ga0070711_100207302 | |||
| 861 | Ga0070705_100165761 | |||
| 862 | Ga0070700_100214549 | |||
| 863 | Ga0070700_100380952 | |||
| 864 | Ga0070694_100082597 | |||
| 865 | Ga0070694_100145458 | |||
| 866 | Ga0070694_100270887 | |||
| 867 | Ga0070708_101253663 | |||
| 868 | Ga0070663_100136808 | |||
| 869 | Ga0070663_100252502 | |||
| 870 | Ga0070678_100879552 | |||
| 871 | Ga0070681_10001211 | |||
| 872 | Ga0070681_10006154 | |||
| 873 | Ga0070681_10024508 | |||
| 874 | Ga0070681_10216002 | |||
| 875 | Ga0070681_10450732 | |||
| 876 | Ga0070681_10670737 | |||
| 877 | Ga0070681_11121321 | |||
| 878 | Ga0068867_100469403 | |||
| 879 | Ga0070685_10128816 | |||
| 880 | Ga0070685_10660088 | |||
| 881 | Ga0070706_101153024 | |||
| 882 | Ga0070698_100425159 | |||
| 883 | Ga0070698_100896785 | |||
| 884 | Ga0070699_100529217 | |||
| 885 | Ga0070679_100018501 | |||
| 886 | Ga0070679_100043990 | |||
| 887 | Ga0070679_100101945 | |||
| 888 | Ga0070679_100129670 | |||
| 889 | Ga0070679_100192070 | |||
| 890 | Ga0070679_101328334 | |||
| 891 | Ga0070684_100000250 | |||
| 892 | Ga0070684_100107435 | |||
| 893 | Ga0070684_100174590 | |||
| 894 | Ga0070684_100512200 | |||
| 895 | Ga0070684_101104827 | |||
| 896 | Ga0068853_101012533 | |||
| 897 | Ga0070686_100177299 | |||
| 898 | Ga0070686_100182041 | |||
| 899 | Ga0070695_100599314 | |||
| 900 | Ga0070696_100011162 | |||
| 901 | Ga0070696_101598383 | |||
| 902 | Ga0070693_100056213 | |||
| 903 | Ga0070693_100347283 | |||
| 904 | Ga0070693_100508125 | |||
| 905 | Ga0070665_100072181 | |||
| 906 | Ga0070665_100146064 | |||
| 907 | Ga0070665_100318038 | |||
| 908 | Ga0070704_100249105 | |||
| 909 | Ga0068855_100036020 | |||
| 910 | Ga0068855_100047718 | |||
| 911 | Ga0068855_100081419 | |||
| 912 | Ga0068855_100081606 | |||
| 913 | Ga0068855_100095467 | |||
| 914 | Ga0068855_100130908 | |||
| 915 | Ga0068855_101342378 | |||
| 916 | Ga0070664_100561279 | |||
| 917 | Ga0068857_100002162 | |||
| 918 | Ga0068854_100026502 | |||
| 919 | Ga0068854_100273459 | |||
| 920 | Ga0068854_100573594 | |||
| 921 | Ga0068856_100050117 | |||
| 922 | Ga0068856_100093676 | |||
| 923 | Ga0068856_100312709 | |||
| 924 | Ga0068856_100635847 | |||
| 925 | Ga0070702_100131202 | |||
| 926 | Ga0070702_100435071 | |||
| 927 | Ga0068852_100485011 | |||
| 928 | Ga0068852_100796346 | |||
| 929 | Ga0068852_101545465 | |||
| 930 | Ga0068852_101640944 | |||
| 931 | Ga0068864_101014582 | |||
| 932 | Ga0068866_10040831 | |||
| 933 | Ga0068861_100713463 | |||
| 934 | Ga0068870_10049495 | |||
| 935 | Ga0068858_100248979 | |||
| 936 | Ga0068860_100298761 | |||
| 937 | Ga0068862_100385367 | |||
| 938 | Ga0081455_10080323 | |||
| 939 | Ga0070717_10051446 | |||
| 940 | Ga0070717_10159985 | |||
| 941 | Ga0070715_10033961 | |||
| 942 | Ga0070716_100968517 | |||
| 943 | Ga0070712_100303112 | |||
| 944 | Ga0070712_100353752 | |||
| 945 | Ga0097621_100056373 | |||
| 946 | Ga0068871_100245529 | |||
| 947 | Ga0068871_100258438 | |||
| 948 | Ga0075433_10178710 | |||
| 949 | Ga0075433_11196211 | |||
| 950 | Ga0075434_100003594 | |||
| 951 | Ga0075434_101778816 | |||
| 952 | Ga0068865_100032727 | |||
| 953 | Ga0068865_101181939 | |||
| 954 | Ga0075436_100010977 | |||
| 955 | Ga0075435_100017896 | |||
| 956 | Ga0075435_100273568 | |||
| 957 | Ga0075435_100804868 | |||
| 958 | Ga0099794_10420716 | |||
| 959 | Ga0105240_10198685 | |||
| 960 | Ga0105240_10286551 | |||
| 961 | Ga0105240_10324900 | |||
| 962 | Ga0105240_10917517 | |||
| 963 | Ga0105240_11526507 | |||
| 964 | Ga0111539_10192044 | |||
| 965 | Ga0105245_10123593 | |||
| 966 | Ga0105245_10561839 | |||
| 967 | Ga0105247_10011568 | |||
| 968 | Ga0114129_10121910 | |||
| 969 | Ga0114129_10532318 | |||
| 970 | Ga0114129_11767202 | |||
| 971 | Ga0105243_10135309 | |||
| 972 | Ga0105243_10863660 | |||
| 973 | Ga0105243_11008981 | |||
| 974 | Ga0105241_10024319 | |||
| 975 | Ga0105241_10587997 | |||
| 976 | Ga0105241_11168457 | |||
| 977 | Ga0105242_10221894 | |||
| 978 | Ga0105242_10457813 | |||
| 979 | Ga0105242_11675413 | |||
| 980 | Ga0105248_10172714 | |||
| 981 | Ga0105237_10052617 | |||
| 982 | Ga0105237_10233681 | |||
| 983 | Ga0105237_11792631 | |||
| 984 | Ga0105238_10013187 | |||
| 985 | Ga0105238_10108439 | |||
| 986 | Ga0105238_11136067 | |||
| 987 | Ga0105249_10071305 | |||
| 988 | Ga0105249_10244879 | |||
| 989 | Ga0105249_11121659 | |||
| 990 | Ga0105239_10187270 | |||
| 991 | Ga0105239_10326379 | |||
| 992 | Ga0105239_10613079 | |||
| 993 | Ga0105239_10757979 | |||
| 994 | Ga0105239_11027049 | |||
| 995 | Ga0105239_11426155 | |||
| 996 | Ga0105239_12121636 | |||
| 997 | Ga0105246_10018170 | |||
| 998 | Ga0105246_10359596 | |||
| 999 | Ga0157373_10774514 | |||
| 1000 | Ga0157373_11049168 | |||
| 1001 | Ga0157371_11372247 | |||
| 1002 | Ga0157370_10132064 | |||
| 1003 | Ga0157370_10180672 | |||
| 1004 | Ga0157370_10605480 | |||
| 1005 | Ga0157370_11120916 | |||
| 1006 | Ga0157369_10071417 | |||
| 1007 | Ga0157369_10172259 | |||
| 1008 | Ga0157369_10216570 | |||
| 1009 | Ga0157369_10222969 | |||
| 1010 | Ga0157369_10499722 | |||
| 1011 | Ga0157369_10908724 | |||
| 1012 | Ga0157374_10029908 | |||
| 1013 | Ga0157374_10669362 | |||
| 1014 | Ga0157374_11483943 | |||
| 1015 | Ga0157374_12405036 | |||
| 1016 | Ga0157378_10378171 | |||
| 1017 | Ga0157378_10466830 | |||
| 1018 | Ga0163162_12381069 | |||
| 1019 | Ga0157372_10066429 | |||
| 1020 | Ga0157372_10140424 | |||
| 1021 | Ga0157372_10165956 | |||
| 1022 | Ga0157372_10396235 | |||
| 1023 | Ga0157372_11165550 | |||
| 1024 | Ga0157375_10282868 | |||
| 1025 | Ga0157375_10725446 | |||
| 1026 | Ga0163163_10008013 | |||
| 1027 | Ga0157380_10230534 | |||
| 1028 | Ga0157377_10003132 | |||
| 1029 | Ga0157377_10145271 | |||
| 1030 | Ga0157379_10038303 | |||
| 1031 | Ga0157379_10556144 | |||
| 1032 | Ga0157376_10023167 | |||
| 1033 | Ga0157376_10086590 | |||
| 1034 | Ga0157376_11961929 | |||
| 1035 | Ga0206356_10859772 | |||
| 1036 | Ga0206356_11244172 | |||
| 1037 | Ga0206356_11453522 | |||
| 1038 | Ga0206354_10308263 | |||
| 1039 | Ga0206353_10470091 | |||
| 1040 | Ga0206353_10926494 | |||
| 1041 | Ga0213874_10103019 | |||
| 1042 | Ga0213871_10023264 | |||
| 1043 | Ga0224712_10192891 | |||
| 1044 | Ga0207692_10587043 | |||
| 1045 | Ga0207642_10162430 | |||
| 1046 | Ga0207642_10669678 | |||
| 1047 | Ga0207710_10009744 | |||
| 1048 | Ga0207688_10011879 | |||
| 1049 | Ga0207688_10259682 | |||
| 1050 | Ga0207680_10060864 | |||
| 1051 | Ga0207699_10338003 | |||
| 1052 | Ga0207654_10025331 | |||
| 1053 | Ga0207654_10385017 | |||
| 1054 | Ga0207707_10007562 | |||
| 1055 | Ga0207707_10053474 | |||
| 1056 | Ga0207707_10070905 | |||
| 1057 | Ga0207707_10328666 | |||
| 1058 | Ga0207707_10535465 | |||
| 1059 | Ga0207707_10572924 | |||
| 1060 | Ga0207707_11046170 | |||
| 1061 | Ga0207695_10171531 | |||
| 1062 | Ga0207671_10076666 | |||
| 1063 | Ga0207671_10094543 | |||
| 1064 | Ga0207671_10183310 | |||
| 1065 | Ga0207671_10591576 | |||
| 1066 | Ga0207693_10124223 | |||
| 1067 | Ga0207693_10294725 | |||
| 1068 | Ga0207693_10589030 | |||
| 1069 | Ga0207693_10651565 | |||
| 1070 | Ga0207663_10289598 | |||
| 1071 | Ga0207663_10321089 | |||
| 1072 | Ga0207663_10573623 | |||
| 1073 | Ga0207663_10752257 | |||
| 1074 | Ga0207660_10017445 | |||
| 1075 | Ga0207660_10017816 | |||
| 1076 | Ga0207660_10315680 | |||
| 1077 | Ga0207660_10807295 | |||
| 1078 | Ga0207660_10850234 | |||
| 1079 | Ga0207662_10091336 | |||
| 1080 | Ga0207657_10003977 | |||
| 1081 | Ga0207657_10005514 | |||
| 1082 | Ga0207657_10006045 | |||
| 1083 | Ga0207657_10011616 | |||
| 1084 | Ga0207657_10037356 | |||
| 1085 | Ga0207657_10645388 | |||
| 1086 | Ga0207649_10034276 | |||
| 1087 | Ga0207649_10129540 | |||
| 1088 | Ga0207649_10408685 | |||
| 1089 | Ga0207649_10672029 | |||
| 1090 | Ga0207649_11080277 | |||
| 1091 | Ga0207652_10004445 | |||
| 1092 | Ga0207652_10063362 | |||
| 1093 | Ga0207652_10111726 | |||
| 1094 | Ga0207652_10354970 | |||
| 1095 | Ga0207652_10820998 | |||
| 1096 | Ga0207652_11094366 | |||
| 1097 | Ga0207681_10951633 | |||
| 1098 | Ga0207694_10031169 | |||
| 1099 | Ga0207694_10627813 | |||
| 1100 | Ga0207694_10821555 | |||
| 1101 | Ga0207650_10378471 | |||
| 1102 | Ga0207659_10293146 | |||
| 1103 | Ga0207687_10004237 | |||
| 1104 | Ga0207687_10083146 | |||
| 1105 | Ga0207687_10938467 | |||
| 1106 | Ga0207700_10548297 | |||
| 1107 | Ga0207664_10537782 | |||
| 1108 | Ga0207664_10592432 | |||
| 1109 | Ga0207664_10761727 | |||
| 1110 | Ga0207664_11026260 | |||
| 1111 | Ga0207664_11279163 | |||
| 1112 | Ga0207644_10535388 | |||
| 1113 | Ga0207690_10035494 | |||
| 1114 | Ga0207690_10147847 | |||
| 1115 | Ga0207690_10235268 | |||
| 1116 | Ga0207690_10378482 | |||
| 1117 | Ga0207690_10416799 | |||
| 1118 | Ga0207706_10069229 | |||
| 1119 | Ga0207709_10078734 | |||
| 1120 | Ga0207670_10143722 | |||
| 1121 | Ga0207670_10630915 | |||
| 1122 | Ga0207669_10019902 | |||
| 1123 | Ga0207704_10327523 | |||
| 1124 | Ga0207665_10030025 | |||
| 1125 | Ga0207711_10860552 | |||
| 1126 | Ga0207689_10011471 | |||
| 1127 | Ga0207661_10028651 | |||
| 1128 | Ga0207661_10326308 | |||
| 1129 | Ga0207661_10580822 | |||
| 1130 | Ga0207661_10595452 | |||
| 1131 | Ga0207679_11488638 | |||
| 1132 | Ga0207667_10023514 | |||
| 1133 | Ga0207667_10048297 | |||
| 1134 | Ga0207667_10141333 | |||
| 1135 | Ga0207667_10196978 | |||
| 1136 | Ga0207667_10533182 | |||
| 1137 | Ga0207667_10612497 | |||
| 1138 | Ga0207712_10041383 | |||
| 1139 | Ga0207712_10144896 | |||
| 1140 | Ga0207668_10522944 | |||
| 1141 | Ga0207640_10043974 | |||
| 1142 | Ga0207640_10503988 | |||
| 1143 | Ga0207677_10006522 | |||
| 1144 | Ga0207677_10414514 | |||
| 1145 | Ga0207703_10070287 | |||
| 1146 | Ga0207703_11027523 | |||
| 1147 | Ga0207678_10172388 | |||
| 1148 | Ga0207678_10195005 | |||
| 1149 | Ga0207678_10618074 | |||
| 1150 | Ga0207708_10009849 | |||
| 1151 | Ga0207708_10017816 | |||
| 1152 | Ga0207702_10114925 | |||
| 1153 | Ga0207702_10374591 | |||
| 1154 | Ga0207702_10682761 | |||
| 1155 | Ga0207674_10002083 | |||
| 1156 | Ga0207674_10112588 | |||
| 1157 | Ga0207675_100602663 | |||
| 1158 | Ga0207675_100630140 | |||
| 1159 | Ga0207683_10648284 | |||
| 1160 | Ga0207698_10578362 | |||
| 1161 | Ga0207698_10747567 | |||
| 1162 | Ga0207698_11386045 | |||
| 1163 | Ga0207698_11580635 | |||
| 1164 | Ga0207428_10109758 | |||
| 1165 | Ga0268266_10055904 | |||
| 1166 | Ga0268266_10236597 | |||
| 1167 | Ga0268266_10253135 | |||
| 1168 | Ga0268265_10460456 | |||
| 1169 | Ga0268264_10130825 | |||
| 1170 | Ga0268264_10691142 | |||
| 1171 | Ga0265326_10101544 | |||
| 1172 | Ga0265334_10112907 | |||
| 1173 | Ga0265318_10017960 | |||
| 1174 | Ga0265318_10054636 | |||
| 1175 | Ga0265318_10066103 | |||
| 1176 | Ga0265322_10011308 | |||
| 1177 | Ga0265338_10013856 | |||
| 1178 | Ga0265338_10051579 | |||
| 1179 | Ga0265338_10060338 | |||
| 1180 | Ga0265338_10144842 | |||
| 1181 | Ga0265338_10342268 | |||
| 1182 | Ga0265330_10074404 | |||
| 1183 | Ga0265325_10027275 | |||
| 1184 | Ga0265340_10030522 | |||
| 1185 | Ga0265340_10172819 | |||
| 1186 | Ga0265339_10090713 | |||
| 1187 | Ga0265327_10003047 | |||
| 1188 | Ga0265327_10018739 | |||
| 1189 | Ga0265327_10055378 | |||
| 1190 | Ga0265327_10076032 | |||
| 1191 | Ga0265316_10002206 | |||
| 1192 | Ga0307408_100062840 | |||
| 1193 | Ga0265313_10061702 | |||
| 1194 | Ga0265313_10084827 | |||
| 1195 | Ga0265314_10003413 | |||
| 1196 | Ga0265314_10086123 | |||
| 1197 | Ga0265314_10174511 | |||
| 1198 | Ga0265342_10069720 | |||
| 1199 | Ga0307409_100860448 | |||
| 1200 | Ga0373926_0056892 | |||
| 1201 | Ga0373944_0056438 | |||
| 1202 | Ga0373923_0094277 | |||
| 1203 | Ga0373932_0280071 | |||
| 1204 | Ga0373936_0165745 | |||
| 1205 | Ga0373936_0493781 | |||
| 1206 | Ga0373945_0226331 | |||
| 1207 | Ga0373945_0259168 | |||
| 1208 | Ga0373954_0094483 | |||
| 1209 | Ga0373956_0212368 | |||
| 1210 | Ga0373957_0253734 | |||
| 1211 | Ga0373943_0001309 | |||
| 1212 | Ga0373943_0017100 | |||
| 1213 | Ga0373943_0042530 | |||
| 1214 | Ga0373946_0030604 | |||
| 1215 | Ga0373946_0771807 | |||
| 1216 | Ga0373924_0338841 | |||
| 1217 | Ga0373931_0239202 | |||
| 1218 | Ga0373931_0572659 | |||
| 1219 | Ga0373935_0094332 | |||
| 1220 | Ga0373927_0429531 | |||
| 1221 | Ga0373933_0018885 | |||
| 1222 | Ga0373947_0002249 | |||
| 1223 | Ga0373947_0007984 | |||
| 1224 | Ga0373947_0038780 | |||
| 1225 | Ga0373947_0390750 | |||
| 1226 | Ga0373925_0031071 | |||
| 1227 | Ga0373925_0045718 | |||
| 1228 | Ga0373925_0047599 | |||
| 1229 | Ga0373925_0571228 | |||
| 1230 | Ga0395899_0087202 | |||
| 1231 | Ga0395899_0109281 | |||
| 1232 | Ga0395899_0177516 | |||
| 1233 | Ga0395899_0625793 | |||
| 1234 | Ga0395899_0892041 | |||
| 1235 | Ga0395900_0042379 | |||
| 1236 | Ga0395900_0061702 | |||
| 1237 | Ga0395900_0066125 | |||
| 1238 | Ga0395900_0082795 | |||
| 1239 | Ga0395900_0152117 | |||
| 1240 | Ga0395900_0156960 | |||
| 1241 | Ga0395900_0419444 | |||
| 1242 | Ga0395900_0794100 | |||
| 1243 | Ga0395898_0002616 | |||
| 1244 | Ga0395898_0018106 | |||
| 1245 | Ga0395898_0059516 | |||
| 1246 | Ga0395898_0098449 | |||
| 1247 | Ga0395898_0432054 | |||
| 1248 | Ga0395898_0440983 | |||
| 1249 | Ga0395898_0500125 | |||
| 1250 | Ga0395898_1585869 | |||
| 1251 | Ga0395898_1882279 | |||
| 1252 | Ga0395905_0027769 | |||
| 1253 | Ga0395905_0147780 | |||
| 1254 | Ga0395905_0456890 | |||
| 1255 | Ga0395905_1740806 | |||
| 1256 | Ga0395905_1800849 | |||
| 1257 | Ga0436364_1344902 | |||
| 1258 | Ga0395901_0014181 | |||
| 1259 | Ga0395901_0079240 | |||
| 1260 | Ga0395901_0136216 | |||
| 1261 | Ga0395901_0265129 | |||
| 1262 | Ga0395901_0491990 | |||
| 1263 | Ga0395901_0510823 | |||
| 1264 | Ga0395901_0523408 | |||
| 1265 | Ga0436365_0024573 | |||
| 1266 | Ga0436360_0637419 | |||
| 1267 | Ga0436363_1209816 | |||
| 1268 | Ga0436363_1414311 | |||
| 1269 | Ga0436362_0655244 | |||
| 1270 | Ga0436362_0738256 | |||
| 1271 | Ga0451802_1645868 | |||
| 1272 | Ga0451806_408931 | |||
| 1273 | Ga0451839_1417588 | |||
| 1274 | Ga0451853_0611674 | |||
| 1275 | Ga0466969_0411513 | |||
| 1276 | Ga0466972_0482237 | |||
| 1277 | Ga0466966_0034771 | |||
| 1278 | Ga0466966_0090891 | |||
| 1279 | Ga0466966_0114382 | |||
| 1280 | Ga0466966_0171835 | |||
| 1281 | Ga0466966_0236749 | |||
| 1282 | Ga0466966_0296349 | |||
| 1283 | Ga0466961_0005606 | |||
| 1284 | Ga0466961_0041711 | |||
| 1285 | Ga0466961_0067154 | |||
| 1286 | Ga0466963_0001686 | |||
| 1287 | Ga0466963_0039235 | |||
| 1288 | Ga0466963_0204388 | |||
| 1289 | Ga0466963_0528750 | |||
| 1290 | Ga0466963_0814367 | |||
| 1291 | Ga0466963_0819397 | |||
| 1292 | Ga0466963_0954222 | |||
| 1293 | Ga0466964_0011257 | |||
| 1294 | Ga0466964_0064444 | |||
| 1295 | Ga0466964_0069204 | |||
| 1296 | Ga0466964_0632466 | |||
| 1297 | Ga0466971_0026907 | |||
| 1298 | Ga0466971_0030805 | |||
| 1299 | Ga0466971_0037502 | |||
| 1300 | Ga0466968_0013261 | |||
| 1301 | Ga0466968_0013361 | |||
| 1302 | Ga0466970_0051419 | |||
| 1303 | Ga0466970_0863634 | |||
| 1304 | Ga0466957_0023601 | |||
| 1305 | Ga0466957_0054182 | |||
| 1306 | Ga0466957_0172289 | |||
| 1307 | Ga0466957_1205275 | |||
| 1308 | Ga0466959_0017673 | |||
| 1309 | Ga0466959_0027523 | |||
| 1310 | Ga0466959_0048565 | |||
| 1311 | Ga0466959_0079871 | |||
| 1312 | Ga0466959_0083882 | |||
| 1313 | Ga0466959_0111240 | |||
| 1314 | Ga0451576_0331672 | |||
| 1315 | Ga0451576_1197738 | |||
| 1316 | Ga0466958_0000208 | |||
| 1317 | Ga0466958_0039817 | |||
| 1318 | Ga0466958_0091463 | |||
| 1319 | Ga0466958_0296889 | |||
| 1320 | Ga0466967_0001314 | |||
| 1321 | Ga0466967_0002552 | |||
| 1322 | Ga0466967_0006757 | |||
| 1323 | Ga0466967_0037241 | |||
| 1324 | Ga0466967_0049004 | |||
| 1325 | Ga0466967_0075564 | |||
| 1326 | Ga0466967_0099170 | |||
| 1327 | Ga0466967_0152964 | |||
| 1328 | Ga0466967_0159432 | |||
| 1329 | Ga0466967_0274409 | |||
| 1330 | Ga0466967_0313385 | |||
| 1331 | Ga0466967_0363585 | |||
| 1332 | Ga0466967_0433496 | |||
| 1333 | Ga0466967_0561556 | |||
| 1334 | Ga0466967_0644394 | |||
| 1335 | Ga0466967_1268956 | |||
| 1336 | Ga0466967_1844358 | |||
| 1337 | Ga0466967_1897917 | |||
| 1338 | Ga0495592_0024548 | |||
| 1339 | Ga0495592_0049041 | |||
| 1340 | Ga0495603_0016807 | |||
| 1341 | Ga0495603_0025289 | |||
| 1342 | Ga0495629_0076995 | |||
| 1343 | Ga0495629_0115674 | |||
| 1344 | Ga0495629_0206331 | |||
| 1345 | Ga0495629_0394377 | |||
| 1346 | Ga0495641_0008508 | |||
| 1347 | Ga0495641_0011878 | |||
| 1348 | Ga0495641_0093315 | |||
| 1349 | Ga0495641_0307005 | |||
| 1350 | Ga0495641_0377848 | |||
| 1351 | Ga0495651_0030082 | |||
| 1352 | Ga0495651_0030293 | |||
| 1353 | Ga0495651_0383970 | |||
| 1354 | Ga0495653_0043265 | |||
| 1355 | Ga0495653_0122739 | |||
| 1356 | Ga0495582_0012801 | |||
| 1357 | Ga0495582_0774602 | |||
| 1358 | Ga0495639_0023393 | |||
| 1359 | Ga0495639_0184656 | |||
| 1360 | Ga0495662_0013635 | |||
| 1361 | Ga0495662_0105815 | |||
| 1362 | Ga0495664_0007418 | |||
| 1363 | Ga0495664_0035068 | |||
| 1364 | Ga0495664_0394444 | |||
| 1365 | Ga0495594_0041068 | |||
| 1366 | Ga0495594_0757752 | |||
| 1367 | Ga0495608_0022077 | |||
| 1368 | Ga0495608_0028165 | |||
| 1369 | Ga0495608_0030660 | |||
| 1370 | Ga0495618_0100475 | |||
| 1371 | Ga0495618_0126879 | |||
| 1372 | Ga0495628_0015735 | |||
| 1373 | Ga0495628_0217343 | |||
| 1374 | Ga0495630_0002069 | |||
| 1375 | Ga0495630_0004136 | |||
| 1376 | Ga0495630_0131651 | |||
| 1377 | Ga0495630_0708237 | |||
| 1378 | Ga0495630_1190320 | |||
| 1379 | Ga0495666_0064156 | |||
| 1380 | Ga0495652_0027828 | |||
| 1381 | Ga0495652_0441047 | |||
| 1382 | Ga0495652_0513110 | |||
| 1383 | Ga0495665_0051934 | |||
| 1384 | Ga0495640_0005760 | |||
| 1385 | Ga0495640_0017637 | |||
| 1386 | Ga0495640_0169711 | |||
| 1387 | Ga0495640_0320865 | |||
| 1388 | Ga0495640_0329947 | |||
| 1389 | Ga0495640_0409897 | |||
| 1390 | Ga0495586_0378723 | |||
| 1391 | Ga0495587_0044355 | |||
| 1392 | Ga0495587_0235606 | |||
| 1393 | Ga0495587_0344116 | |||
| 1394 | Ga0495587_0394285 | |||
| 1395 | Ga0495645_0552519 | |||
| 1396 | Ga0495667_0001444 | |||
| 1397 | Ga0495667_0001994 | |||
| 1398 | Ga0495667_0013594 | |||
| 1399 | Ga0495667_0288536 | |||
| 1400 | Ga0495634_0008262 | |||
| 1401 | Ga0495634_0031500 | |||
| 1402 | Ga0495634_0056762 | |||
| 1403 | Ga0495635_0024659 | |||
| 1404 | Ga0495635_0139515 | |||
| 1405 | Ga0495635_0253415 | |||
| 1406 | Ga0495588_0270708 | |||
| 1407 | Ga0495588_0343854 | |||
| 1408 | Ga0495657_0071790 | |||
| 1409 | Ga0495657_0258476 | |||
| 1410 | Ga0495657_0285169 | |||
| 1411 | Ga0495599_0081417 | |||
| 1412 | Ga0495599_0105223 | |||
| 1413 | Ga0495599_0272701 | |||
| 1414 | Ga0495646_0150612 | |||
| 1415 | Ga0495646_0166574 | |||
| 1416 | Ga0495647_0019270 | |||
| 1417 | Ga0495658_0073103 | |||
| 1418 | Ga0495658_0302512 | |||
| 1419 | Ga0495613_0045353 | |||
| 1420 | Ga0495613_0054486 | |||
| 1421 | Ga0495613_0164409 | |||
| 1422 | Ga0495613_0888190 | |||
| 1423 | Ga0495624_0021784 | |||
| 1424 | Ga0495624_0145763 | |||
| 1425 | Ga0495624_0157242 | |||
| 1426 | Ga0495600_0001166 | |||
| 1427 | Ga0495600_0101104 | |||
| 1428 | Ga0495600_0168124 | |||
| 1429 | Ga0495581_0004109 | |||
| 1430 | Ga0495581_0212275 | |||
| 1431 | Ga0495581_0412476 | |||
| 1432 | Ga0495604_0085473 | |||
| 1433 | Ga0495604_0178215 | |||
| 1434 | Ga0495604_0379185 | |||
| 1435 | Ga0495604_0607863 | |||
| 1436 | Ga0495674_0001928 | |||
| 1437 | Ga0495674_0028248 | |||
| 1438 | Ga0495674_0055342 | |||
| 1439 | Ga0495674_0075363 | |||
| 1440 | Ga0495674_0098705 | |||
| 1441 | Ga0495674_0113547 | |||
| 1442 | Ga0495674_0120041 | |||
| 1443 | Ga0495676_0016380 | |||
| 1444 | Ga0495676_0136964 | |||
| 1445 | Ga0495676_0337744 | |||
| 1446 | Ga0495676_0356055 | |||
| 1447 | Ga0495680_0004318 | |||
| 1448 | Ga0495680_0042648 | |||
| 1449 | Ga0495680_0516712 | |||
| 1450 | Ga0495675_0075599 | |||
| 1451 | Ga0495684_0010521 | |||
| 1452 | Ga0495684_0042197 | |||
| 1453 | Ga0495684_0120732 | |||
| 1454 | Ga0495593_0093335 | |||
| 1455 | Ga0495593_0102281 | |||
| 1456 | Ga0495593_0161077 | |||
| 1457 | Ga0495602_0376265 | |||
| 1458 | Ga0495614_0137698 | |||
| 1459 | Ga0496100_0042219 | |||
| 1460 | Ga0496100_0092566 | |||
| 1461 | Ga0496100_0109415 | |||
| 1462 | Ga0496100_0161135 | |||
| 1463 | Ga0496100_0202473 | |||
| 1464 | Ga0496100_0678502 | |||
| 1465 | Ga0496100_0920642 | |||
| 1466 | Ga0496101_0001814 | |||
| 1467 | Ga0496101_0004861 | |||
| 1468 | Ga0496101_0258655 | |||
| 1469 | Ga0496101_0668979 | |||
| 1470 | Ga0496101_0767288 | |||
| 1471 | Ga0496102_0052256 | |||
| 1472 | Ga0496102_0125102 | |||
| 1473 | Ga0496102_0187419 | |||
| 1474 | Ga0496102_0304705 | |||
| 1475 | Ga0496102_0368080 | |||
| 1476 | Ga0496102_0470111 | |||
| 1477 | Ga0496102_0604213 | |||
| 1478 | Ga0496102_0764549 | |||
| 1479 | Ga0496103_0040431 | |||
| 1480 | Ga0496103_0075386 | |||
| 1481 | Ga0496103_0141998 | |||
| 1482 | Ga0496103_0753973 | |||
| 1483 | Ga0496104_0056269 | |||
| 1484 | Ga0496104_0065620 | |||
| 1485 | Ga0496104_0097950 | |||
| 1486 | Ga0496104_0335295 | |||
| 1487 | Ga0496104_0349592 | |||
| 1488 | Ga0496104_0573717 | |||
| 1489 | Ga0496104_1686676 | |||
| 1490 | Ga0496105_0007666 | |||
| 1491 | Ga0496105_0015440 | |||
| 1492 | Ga0496105_0024596 | |||
| 1493 | Ga0496105_0051065 | |||
| 1494 | Ga0496105_0056995 | |||
| 1495 | Ga0496105_0170737 | |||
| 1496 | Ga0496106_0001681 | |||
| 1497 | Ga0496106_0007513 | |||
| 1498 | Ga0496106_0037477 | |||
| 1499 | Ga0496107_0030353 | |||
| 1500 | Ga0496107_0045645 | |||
| 1501 | Ga0496107_0065477 | |||
| 1502 | Ga0496107_0086712 | |||
| 1503 | Ga0496107_0113911 | |||
| 1504 | Ga0496108_0002006 | |||
| 1505 | Ga0496108_0002053 | |||
| 1506 | Ga0496108_0049211 | |||
| 1507 | Ga0496108_0110235 | |||
| 1508 | Ga0496108_0765976 | |||
| 1509 | Ga0496108_1324558 | |||
| 1510 | Ga0496109_0013489 | |||
| 1511 | Ga0496109_0041081 | |||
| 1512 | Ga0496109_0080397 | |||
| 1513 | Ga0496109_0233345 | |||
| 1514 | Ga0496109_0442951 | |||
| 1515 | Ga0496109_0464054 | |||
| 1516 | Ga0496109_0659035 | |||
| 1517 | Ga0496110_0003922 | |||
| 1518 | Ga0496110_0049929 | |||
| 1519 | Ga0496110_0087684 | |||
| 1520 | Ga0496110_0172781 | |||
| 1521 | Ga0496110_0432359 | |||
| 1522 | Ga0496111_0005121 | |||
| 1523 | Ga0496111_0044678 | |||
| 1524 | Ga0496112_0003187 | |||
| 1525 | Ga0496112_0004509 | |||
| 1526 | Ga0496112_0009108 | |||
| 1527 | Ga0496112_0083854 | |||
| 1528 | Ga0496112_0320530 | |||
| 1529 | Ga0496112_0468186 | |||
| 1530 | Ga0496113_0009751 | |||
| 1531 | Ga0496113_0102804 | |||
| 1532 | Ga0496113_0108457 | |||
| 1533 | Ga0496113_0776731 | |||
| 1534 | Ga0496114_0025592 | |||
| 1535 | Ga0496114_0032599 | |||
| 1536 | Ga0496114_0126950 | |||
| 1537 | Ga0496114_0161879 | |||
| 1538 | Ga0496114_0213448 | |||
| 1539 | Ga0496114_0281507 | |||
| 1540 | Ga0496114_0475946 | |||
| 1541 | Ga0496115_0071906 | |||
| 1542 | Ga0496115_0298304 | |||
| 1543 | Ga0496115_0421081 | |||
| 1544 | Ga0496115_0681963 | |||
| 1545 | Ga0496115_1005816 | |||
| 1546 | Ga0501032_0483794 | |||
| 1547 | Ga0501032_1032056 | |||
| 1548 | Ga0501033_0406639 | |||
| 1549 | Ga0501034_0525358 | |||
| 1550 | Ga0501040_0097892 | |||
| 1551 | Ga0501042_0700341 | |||
| 1552 | Ga0501047_0076139 | |||
| 1553 | Ga0501047_1297281 | |||
| 1554 | Ga0501048_1047782 | |||
| 1555 | Ga0501067_0002005 | |||
| 1556 | Ga0501067_0019609 | |||
| 1557 | Ga0501067_0140496 | |||
| 1558 | Ga0501067_0177001 | |||
| 1559 | Ga0501068_0044241 | |||
| 1560 | Ga0501069_0009763 | |||
| 1561 | Ga0501069_0161480 | |||
| 1562 | Ga0501069_0387186 | |||
| 1563 | Ga0501069_0768567 | |||
| 1564 | Ga0501070_0001179 | |||
| 1565 | Ga0501070_0159385 | |||
| 1566 | Ga0501070_0780572 | |||
| 1567 | Ga0501072_0269873 | |||
| 1568 | Ga0501074_0036483 | |||
| 1569 | Ga0501074_0334577 | |||
| 1570 | Ga0501074_0526728 | |||
| 1571 | Ga0501077_0025788 | |||
| 1572 | Ga0501077_0868837 | |||
| 1573 | Ga0501080_0778410 | |||
| 1574 | Ga0501080_1006032 | |||
| 1575 | Ga0501035_0385255 | |||
| 1576 | Ga0501044_0831342 | |||
| 1577 | Ga0501045_0105902 | |||
| 1578 | nmdc:mga05p37_250174_c1 | |||
| 1579 | nmdc:mga05p37_759631_c1 | |||
| 1580 | nmdc:mga08y16_120588_c1 | |||
| 1581 | nmdc:mga0n895_21702_c1 | |||
| 1582 | nmdc:mga0n895_533388_c1 | |||
| 1583 | nmdc:mga0n895_59212_c1 | |||
| 1584 | nmdc:mga0rr50_25457_c1 | |||
| 1585 | nmdc:mga08x19_32023_c1 | |||
| 1586 | nmdc:mga0a205_259530_c1 | |||
| 1587 | Ga0495601_0020691 | |||
| 1588 | Ga0495601_0102510 | |||
| 1589 | Ga0495601_0202891 | |||
| 1590 | Ga0495601_0238466 | |||
| 1591 | Ga0495601_0605104 | |||
| 1592 | Ga0495612_0010120 | |||
| 1593 | Ga0495612_0056444 | |||
| 1594 | Ga0495612_0279825 | |||
| 1595 | Ga0495595_0004918 | |||
| 1596 | Ga0495595_0145899 | |||
| 1597 | Ga0495619_0003192 | |||
| 1598 | Ga0495619_0120128 | |||
| 1599 | Ga0495619_0473024 | |||
| 1600 | Ga0501084_0860749 | |||
| 1601 | Ga0466962_0016201 | |||
| 1602 | Ga0466962_0184731 | |||
| 1603 | Ga0466962_0338224 | |||
| 1604 | Ga0530510_0048768 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dku-assembly8.cif.gz_H | crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1 | 0.7685 | 1 | 121 |
| 5gp0-assembly1.cif.gz_I | crystal structure of geraniol-nudx1 complex | 0.7367 | 1 | 124 |
| 5wy6-assembly1.cif.gz_A | crystal structure of atnudx1 (e56a) | 0.7362 | 1 | 124 |
| 8dwd-assembly1.cif.gz_A | adenine glycosylase muty variant e43s in complex with dna containing d(8-oxo-g) paired with an ap site generated by the enzyme acting on purine | 0.7279 | 1 | 111 |
| 2b0v-assembly1.cif.gz_A | nudix hydrolase from nitrosomonas europaea. | 0.7181 | 2 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YDV4_172_318_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.7446 | 2 | 113 | 3.90.79.10 |
| 5wwdA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.726 | 1 | 127 | 3.90.79.10 |
| 2b0vA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.7181 | 2 | 120 | 3.90.79.10 |
| af_Q54N32_273_457_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.7049 | 1 | 106 | 3.90.79.10 |
| 3gz8B01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.7037 | 6 | 111 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0QJW2-F1-model_v4 | NUDIX hydrolase | 0.9188 | 1 | 137 |
GO:0016787
|
| AF-A0A7W0QJW2-F1-model_v4 | NUDIX hydrolase | 0.9124 | 1 | 137 |
GO:0016787
|
| AF-A0A538BMJ1-F1-model_v4 | NUDIX domain-containing protein | 0.9071 | 1 | 114 |
GO:0016787
|
| AF-A0A1Q7VK63-F1-model_v4 | Nudix hydrolase domain-containing protein | 0.8889 | 1 | 133 |
GO:0016787
|
| AF-A0A7W0UEC5-F1-model_v4 | NUDIX hydrolase | 0.8856 | 18 | 137 |
GO:0016787
|