F481142
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 795 | 259 | 795 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0134579|Ga0373937_0134579_1252_2115 |
| Length | 287 |
| Sequence | VEKDIMHPIPVVKSRRPLRALTVGLAALMCVSPLAFAQAGGKPGGASAQPATATSAQPASPEIAGIRKSLEAKFPGADIKHIAKTDYLGLYEVMLDDNLVYTDPKVAYIFVGALYDTATKQNLTDARTRRLNRVALDKLPYELAFKRVKGDGSRKLVLFSDADCPFCHRLETELKGLDNVTIYTFLFPIDQLHPDAARKSKQIWCAPDKVKAWDEFFASGKVPDNKGDCGDPVAKTQALGNSLKINATPTLVFADGTMIPGALPLPQLEKEMATAEIEARKIAAAPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.16 |
| Rhizosphere | 94.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10009827 | 3300005327 | Bacteria | 7687 |
| 2 | Ga0070658_10030463 | 3300005327 | Bacteria | 4334 |
| 3 | Ga0070658_10284103 | 3300005327 | Bacteria | 1409 |
| 4 | Ga0070676_10055232 | 3300005328 | Bacteria | 2343 |
| 5 | Ga0070676_10066188 | 3300005328 | Bacteria | 2159 |
| 6 | Ga0070676_10091947 | 3300005328 | Bacteria | 1860 |
| 7 | Ga0070676_10207265 | 3300005328 | Bacteria | 1288 |
| 8 | Ga0070683_100007878 | 3300005329 | Bacteria | 9026 |
| 9 | Ga0070683_100031286 | 3300005329 | Bacteria | 4838 |
| 10 | Ga0070683_100036305 | 3300005329 | Bacteria | 4509 |
| 11 | Ga0070683_100084263 | 3300005329 | Bacteria | 2978 |
| 12 | Ga0070683_100494874 | 3300005329 | Bacteria | 1168 |
| 13 | Ga0070690_100003383 | 3300005330 | Bacteria | 8712 |
| 14 | Ga0070690_100060297 | 3300005330 | Bacteria | 2441 |
| 15 | Ga0070690_100077990 | 3300005330 | Bacteria | 2164 |
| 16 | Ga0070690_100126540 | 3300005330 | Bacteria | 1721 |
| 17 | Ga0070670_100006016 | 3300005331 | Bacteria | 10260 |
| 18 | Ga0070670_100011869 | 3300005331 | Bacteria | 7450 |
| 19 | Ga0070670_100022732 | 3300005331 | Bacteria | 5395 |
| 20 | Ga0070670_100024174 | 3300005331 | Bacteria | 5228 |
| 21 | Ga0070670_100053533 | 3300005331 | Bacteria | 3466 |
| 22 | Ga0070670_100394836 | 3300005331 | Bacteria | 1220 |
| 23 | Ga0070677_10006409 | 3300005333 | Bacteria | 3909 |
| 24 | Ga0068869_100002165 | 3300005334 | Bacteria | 11817 |
| 25 | Ga0068869_100008302 | 3300005334 | Bacteria | 6689 |
| 26 | Ga0068869_100010630 | 3300005334 | Bacteria | 6007 |
| 27 | Ga0068869_100025032 | 3300005334 | Bacteria | 4140 |
| 28 | Ga0068869_100106314 | 3300005334 | Bacteria | 2129 |
| 29 | Ga0068869_100293763 | 3300005334 | Bacteria | 1310 |
| 30 | Ga0070666_10068755 | 3300005335 | Bacteria | 2407 |
| 31 | Ga0070666_10085648 | 3300005335 | Unclassified | 2158 |
| 32 | Ga0070666_10089480 | 3300005335 | Bacteria | 2113 |
| 33 | Ga0070666_10142138 | 3300005335 | Bacteria | 1672 |
| 34 | Ga0070680_100078176 | 3300005336 | Bacteria | 2725 |
| 35 | Ga0070680_100125440 | 3300005336 | Bacteria | 2145 |
| 36 | Ga0070682_100068279 | 3300005337 | Bacteria | 2267 |
| 37 | Ga0068868_100000774 | 3300005338 | Bacteria | 21630 |
| 38 | Ga0068868_100025470 | 3300005338 | Bacteria | 4500 |
| 39 | Ga0068868_100027999 | 3300005338 | Bacteria | 4303 |
| 40 | Ga0068868_100150233 | 3300005338 | Bacteria | 1918 |
| 41 | Ga0068868_100245656 | 3300005338 | Bacteria | 1505 |
| 42 | Ga0070660_100007823 | 3300005339 | Bacteria | 7454 |
| 43 | Ga0070660_100030182 | 3300005339 | Bacteria | 4066 |
| 44 | Ga0070660_100044893 | 3300005339 | Bacteria | 3381 |
| 45 | Ga0070660_100087563 | 3300005339 | Bacteria | 2451 |
| 46 | Ga0070660_100096973 | 3300005339 | Bacteria | 2332 |
| 47 | Ga0070660_100167942 | 3300005339 | Bacteria | 1771 |
| 48 | Ga0070660_100258794 | 3300005339 | Bacteria | 1421 |
| 49 | Ga0070689_100001808 | 3300005340 | Bacteria | 13750 |
| 50 | Ga0070689_100024846 | 3300005340 | Bacteria | 4498 |
| 51 | Ga0070689_100080408 | 3300005340 | Bacteria | 2557 |
| 52 | Ga0070689_100084407 | 3300005340 | Bacteria | 2496 |
| 53 | Ga0070691_10078918 | 3300005341 | Bacteria | 1608 |
| 54 | Ga0070691_10085439 | 3300005341 | Bacteria | 1550 |
| 55 | Ga0070687_100001561 | 3300005343 | Bacteria | 8134 |
| 56 | Ga0070687_100007131 | 3300005343 | Bacteria | 4633 |
| 57 | Ga0070661_100001548 | 3300005344 | Bacteria | 15981 |
| 58 | Ga0070661_100015097 | 3300005344 | Bacteria | 5449 |
| 59 | Ga0070661_100022392 | 3300005344 | Bacteria | 4524 |
| 60 | Ga0070661_100029753 | 3300005344 | Bacteria | 3943 |
| 61 | Ga0070661_100033672 | 3300005344 | Bacteria | 3712 |
| 62 | Ga0070661_100073531 | 3300005344 | Bacteria | 2517 |
| 63 | Ga0070661_100138528 | 3300005344 | Bacteria | 1832 |
| 64 | Ga0070668_100001676 | 3300005347 | Bacteria | 16053 |
| 65 | Ga0070668_100008748 | 3300005347 | Bacteria | 7521 |
| 66 | Ga0070668_100032153 | 3300005347 | Bacteria | 3993 |
| 67 | Ga0070668_100204128 | 3300005347 | Bacteria | 1623 |
| 68 | Ga0070668_100379566 | 3300005347 | Bacteria | 1202 |
| 69 | Ga0070669_100001056 | 3300005353 | Bacteria | 20146 |
| 70 | Ga0070669_100195686 | 3300005353 | Bacteria | 1588 |
| 71 | Ga0070669_100227429 | 3300005353 | Bacteria | 1477 |
| 72 | Ga0070669_100340996 | 3300005353 | Bacteria | 1214 |
| 73 | Ga0070675_100007513 | 3300005354 | Bacteria | 8422 |
| 74 | Ga0070675_100009354 | 3300005354 | Bacteria | 7622 |
| 75 | Ga0070675_100089321 | 3300005354 | Bacteria | 2580 |
| 76 | Ga0070675_100127743 | 3300005354 | Bacteria | 2164 |
| 77 | Ga0070675_100174029 | 3300005354 | Bacteria | 1858 |
| 78 | Ga0070675_100208989 | 3300005354 | Bacteria | 1696 |
| 79 | Ga0070675_100486603 | 3300005354 | Unclassified | 1110 |
| 80 | Ga0070671_100004251 | 3300005355 | Bacteria | 11332 |
| 81 | Ga0070671_100010164 | 3300005355 | Bacteria | 7553 |
| 82 | Ga0070671_100010609 | 3300005355 | Bacteria | 7397 |
| 83 | Ga0070671_100041804 | 3300005355 | Bacteria | 3809 |
| 84 | Ga0070671_100097929 | 3300005355 | Bacteria | 2460 |
| 85 | Ga0070674_100023151 | 3300005356 | Bacteria | 4015 |
| 86 | Ga0070674_100063712 | 3300005356 | Bacteria | 2581 |
| 87 | Ga0070674_100066301 | 3300005356 | Bacteria | 2536 |
| 88 | Ga0070674_100077228 | 3300005356 | Bacteria | 2370 |
| 89 | Ga0070674_100134875 | 3300005356 | Bacteria | 1845 |
| 90 | Ga0070673_100002518 | 3300005364 | Bacteria | 11189 |
| 91 | Ga0070673_100004580 | 3300005364 | Bacteria | 8764 |
| 92 | Ga0070673_100026489 | 3300005364 | Bacteria | 4283 |
| 93 | Ga0070673_100027621 | 3300005364 | Bacteria | 4209 |
| 94 | Ga0070673_100035130 | 3300005364 | Bacteria | 3798 |
| 95 | Ga0070673_100284403 | 3300005364 | Bacteria | 1451 |
| 96 | Ga0070673_100338072 | 3300005364 | Bacteria | 1334 |
| 97 | Ga0070688_100001156 | 3300005365 | Bacteria | 13175 |
| 98 | Ga0070688_100015810 | 3300005365 | Bacteria | 4301 |
| 99 | Ga0070688_100056869 | 3300005365 | Bacteria | 2457 |
| 100 | Ga0070659_100001467 | 3300005366 | Bacteria | 16988 |
| 101 | Ga0070659_100003884 | 3300005366 | Bacteria | 10646 |
| 102 | Ga0070659_100004493 | 3300005366 | Bacteria | 9963 |
| 103 | Ga0070659_100194963 | 3300005366 | Bacteria | 1666 |
| 104 | Ga0070659_100252064 | 3300005366 | Bacteria | 1463 |
| 105 | Ga0070667_100030206 | 3300005367 | Bacteria | 4519 |
| 106 | Ga0070667_100032230 | 3300005367 | Bacteria | 4371 |
| 107 | Ga0070667_100087187 | 3300005367 | Bacteria | 2679 |
| 108 | Ga0070667_100245787 | 3300005367 | Bacteria | 1599 |
| 109 | Ga0070709_10050520 | 3300005434 | Bacteria | 2606 |
| 110 | Ga0070709_10135747 | 3300005434 | Bacteria | 1685 |
| 111 | Ga0070709_10154229 | 3300005434 | Bacteria | 1590 |
| 112 | Ga0070709_10265460 | 3300005434 | Bacteria | 1242 |
| 113 | Ga0070714_100012896 | 3300005435 | Bacteria | 6682 |
| 114 | Ga0070714_100340993 | 3300005435 | Bacteria | 1406 |
| 115 | Ga0070714_100561651 | 3300005435 | Bacteria | 1093 |
| 116 | Ga0070713_100004189 | 3300005436 | Bacteria | 9623 |
| 117 | Ga0070713_100015240 | 3300005436 | Bacteria | 5735 |
| 118 | Ga0070713_100295283 | 3300005436 | Bacteria | 1490 |
| 119 | Ga0070711_100008712 | 3300005439 | Bacteria | 6224 |
| 120 | Ga0070711_100385820 | 3300005439 | Bacteria | 1134 |
| 121 | Ga0070711_100489154 | 3300005439 | Bacteria | 1013 |
| 122 | Ga0070700_100021682 | 3300005441 | Bacteria | 3737 |
| 123 | Ga0070708_100106282 | 3300005445 | Bacteria | 2576 |
| 124 | Ga0070663_100008052 | 3300005455 | Bacteria | 6463 |
| 125 | Ga0070663_100084983 | 3300005455 | Bacteria | 2334 |
| 126 | Ga0070663_100250141 | 3300005455 | Bacteria | 1402 |
| 127 | Ga0070663_100257205 | 3300005455 | Bacteria | 1384 |
| 128 | Ga0070678_100003815 | 3300005456 | Bacteria | 8455 |
| 129 | Ga0070678_100009548 | 3300005456 | Bacteria | 5884 |
| 130 | Ga0070678_100324932 | 3300005456 | Bacteria | 1315 |
| 131 | Ga0070678_100480951 | 3300005456 | Bacteria | 1093 |
| 132 | Ga0070662_100000514 | 3300005457 | Bacteria | 23259 |
| 133 | Ga0070662_100001751 | 3300005457 | Bacteria | 13369 |
| 134 | Ga0070662_100031526 | 3300005457 | Bacteria | 3721 |
| 135 | Ga0070662_100056698 | 3300005457 | Bacteria | 2845 |
| 136 | Ga0070681_10007078 | 3300005458 | Bacteria | 10921 |
| 137 | Ga0070681_10041982 | 3300005458 | Bacteria | 4584 |
| 138 | Ga0070681_10302223 | 3300005458 | Bacteria | 1510 |
| 139 | Ga0068867_100002175 | 3300005459 | Bacteria | 13763 |
| 140 | Ga0068867_100136723 | 3300005459 | Bacteria | 1911 |
| 141 | Ga0068867_100223386 | 3300005459 | Bacteria | 1519 |
| 142 | Ga0068867_100373023 | 3300005459 | Bacteria | 1197 |
| 143 | Ga0068867_100501901 | 3300005459 | Bacteria | 1043 |
| 144 | Ga0070685_10002325 | 3300005466 | Bacteria | 9797 |
| 145 | Ga0070685_10004300 | 3300005466 | Bacteria | 7190 |
| 146 | Ga0070706_100014830 | 3300005467 | Bacteria | 7203 |
| 147 | Ga0070707_100027782 | 3300005468 | Bacteria | 5383 |
| 148 | Ga0070707_100052046 | 3300005468 | Bacteria | 3925 |
| 149 | Ga0070698_100016516 | 3300005471 | Bacteria | 7788 |
| 150 | Ga0070698_100103814 | 3300005471 | Bacteria | 2812 |
| 151 | Ga0070698_100532084 | 3300005471 | Bacteria | 1114 |
| 152 | Ga0070699_100126402 | 3300005518 | Bacteria | 2251 |
| 153 | Ga0070699_100807487 | 3300005518 | Bacteria | 858 |
| 154 | Ga0070679_100130273 | 3300005530 | Bacteria | 2496 |
| 155 | Ga0070684_100003343 | 3300005535 | Bacteria | 12011 |
| 156 | Ga0070684_100025170 | 3300005535 | Bacteria | 5000 |
| 157 | Ga0070684_100153991 | 3300005535 | Bacteria | 2084 |
| 158 | Ga0070684_100186839 | 3300005535 | Bacteria | 1885 |
| 159 | Ga0070697_100012939 | 3300005536 | Bacteria | 6538 |
| 160 | Ga0070697_100127368 | 3300005536 | Bacteria | 2133 |
| 161 | Ga0068853_100005058 | 3300005539 | Bacteria | 10289 |
| 162 | Ga0068853_100006454 | 3300005539 | Bacteria | 9326 |
| 163 | Ga0068853_100025368 | 3300005539 | Bacteria | 4973 |
| 164 | Ga0068853_100226132 | 3300005539 | Bacteria | 1710 |
| 165 | Ga0068853_100288594 | 3300005539 | Bacteria | 1514 |
| 166 | Ga0068853_100448099 | 3300005539 | Bacteria | 1214 |
| 167 | Ga0068853_100764847 | 3300005539 | Bacteria | 924 |
| 168 | Ga0070672_100004277 | 3300005543 | Bacteria | 9333 |
| 169 | Ga0070672_100007539 | 3300005543 | Bacteria | 7392 |
| 170 | Ga0070672_100024607 | 3300005543 | Bacteria | 4453 |
| 171 | Ga0070672_100037494 | 3300005543 | Bacteria | 3699 |
| 172 | Ga0070672_100045986 | 3300005543 | Bacteria | 3380 |
| 173 | Ga0070672_100423683 | 3300005543 | Bacteria | 1143 |
| 174 | Ga0070686_100003848 | 3300005544 | Bacteria | 8258 |
| 175 | Ga0070686_100062993 | 3300005544 | Bacteria | 2401 |
| 176 | Ga0070695_100088738 | 3300005545 | Bacteria | 2060 |
| 177 | Ga0070695_100441127 | 3300005545 | Unclassified | 995 |
| 178 | Ga0070696_100060402 | 3300005546 | Bacteria | 2651 |
| 179 | Ga0070693_100003077 | 3300005547 | Bacteria | 7741 |
| 180 | Ga0070693_100268951 | 3300005547 | Bacteria | 1137 |
| 181 | Ga0070693_100366083 | 3300005547 | Bacteria | 990 |
| 182 | Ga0070665_100010753 | 3300005548 | Bacteria | 9259 |
| 183 | Ga0070665_100016809 | 3300005548 | Bacteria | 7335 |
| 184 | Ga0070665_100073634 | 3300005548 | Bacteria | 3421 |
| 185 | Ga0070665_100132605 | 3300005548 | Bacteria | 2493 |
| 186 | Ga0070665_100502904 | 3300005548 | Bacteria | 1223 |
| 187 | Ga0070704_100012983 | 3300005549 | Bacteria | 5154 |
| 188 | Ga0070704_100028431 | 3300005549 | Bacteria | 3719 |
| 189 | Ga0070704_100350105 | 3300005549 | Bacteria | 1247 |
| 190 | Ga0068855_100002141 | 3300005563 | Bacteria | 24434 |
| 191 | Ga0068855_100007236 | 3300005563 | Bacteria | 13458 |
| 192 | Ga0068855_100055069 | 3300005563 | Bacteria | 4673 |
| 193 | Ga0068855_100168104 | 3300005563 | Bacteria | 2485 |
| 194 | Ga0068855_100232327 | 3300005563 | Bacteria | 2064 |
| 195 | Ga0068855_100280116 | 3300005563 | Bacteria | 1852 |
| 196 | Ga0068855_100318761 | 3300005563 | Bacteria | 1719 |
| 197 | Ga0068855_100540155 | 3300005563 | Bacteria | 1263 |
| 198 | Ga0068855_100690281 | 3300005563 | Bacteria | 1093 |
| 199 | Ga0070664_100000603 | 3300005564 | Bacteria | 27498 |
| 200 | Ga0070664_100010118 | 3300005564 | Bacteria | 7645 |
| 201 | Ga0070664_100019423 | 3300005564 | Bacteria | 5591 |
| 202 | Ga0070664_100039826 | 3300005564 | Bacteria | 3961 |
| 203 | Ga0070664_100125443 | 3300005564 | Bacteria | 2251 |
| 204 | Ga0070664_100157090 | 3300005564 | Bacteria | 2010 |
| 205 | Ga0068857_100000165 | 3300005577 | Bacteria | 41423 |
| 206 | Ga0068857_100010811 | 3300005577 | Bacteria | 7946 |
| 207 | Ga0068857_100043571 | 3300005577 | Bacteria | 3980 |
| 208 | Ga0068854_100001226 | 3300005578 | Bacteria | 15394 |
| 209 | Ga0068854_100002702 | 3300005578 | Bacteria | 10993 |
| 210 | Ga0068854_100097481 | 3300005578 | Bacteria | 2198 |
| 211 | Ga0068854_100149633 | 3300005578 | Bacteria | 1799 |
| 212 | Ga0068856_100000375 | 3300005614 | Bacteria | 49163 |
| 213 | Ga0068856_100006811 | 3300005614 | Bacteria | 11183 |
| 214 | Ga0068856_100054107 | 3300005614 | Bacteria | 3958 |
| 215 | Ga0068856_100259851 | 3300005614 | Unclassified | 1752 |
| 216 | Ga0070702_100014400 | 3300005615 | Bacteria | 4011 |
| 217 | Ga0070702_100056723 | 3300005615 | Bacteria | 2263 |
| 218 | Ga0068852_100000473 | 3300005616 | Bacteria | 26391 |
| 219 | Ga0068852_100004904 | 3300005616 | Bacteria | 9502 |
| 220 | Ga0068852_100009159 | 3300005616 | Bacteria | 7332 |
| 221 | Ga0068852_100043121 | 3300005616 | Bacteria | 3825 |
| 222 | Ga0068859_100000538 | 3300005617 | Bacteria | 37506 |
| 223 | Ga0068859_100002241 | 3300005617 | Bacteria | 19618 |
| 224 | Ga0068859_100102571 | 3300005617 | Bacteria | 2918 |
| 225 | Ga0068859_100149437 | 3300005617 | Bacteria | 2412 |
| 226 | Ga0068859_100187599 | 3300005617 | Bacteria | 2152 |
| 227 | Ga0068859_100653473 | 3300005617 | Bacteria | 1143 |
| 228 | Ga0068864_100000221 | 3300005618 | Bacteria | 51532 |
| 229 | Ga0068864_100000566 | 3300005618 | Bacteria | 31533 |
| 230 | Ga0068864_100001675 | 3300005618 | Bacteria | 18239 |
| 231 | Ga0068864_100009639 | 3300005618 | Bacteria | 7967 |
| 232 | Ga0068864_100037672 | 3300005618 | Bacteria | 4128 |
| 233 | Ga0068864_100050789 | 3300005618 | Bacteria | 3570 |
| 234 | Ga0068864_100055270 | 3300005618 | Bacteria | 3427 |
| 235 | Ga0068864_100111849 | 3300005618 | Bacteria | 2434 |
| 236 | Ga0068864_100344446 | 3300005618 | Bacteria | 1405 |
| 237 | Ga0068864_100433989 | 3300005618 | Bacteria | 1254 |
| 238 | Ga0068866_10002966 | 3300005718 | Bacteria | 7006 |
| 239 | Ga0068866_10016521 | 3300005718 | Bacteria | 3300 |
| 240 | Ga0068866_10062873 | 3300005718 | Unclassified | 1933 |
| 241 | Ga0068866_10144944 | 3300005718 | Bacteria | 1368 |
| 242 | Ga0068861_100003091 | 3300005719 | Bacteria | 11000 |
| 243 | Ga0068861_100046826 | 3300005719 | Bacteria | 3262 |
| 244 | Ga0068861_100114407 | 3300005719 | Bacteria | 2166 |
| 245 | Ga0068861_100241662 | 3300005719 | Bacteria | 1536 |
| 246 | Ga0068861_100297833 | 3300005719 | Bacteria | 1396 |
| 247 | Ga0068851_10000426 | 3300005834 | Bacteria | 18827 |
| 248 | Ga0068851_10002987 | 3300005834 | Bacteria | 7472 |
| 249 | Ga0068851_10019199 | 3300005834 | Bacteria | 3301 |
| 250 | Ga0068870_10001530 | 3300005840 | Bacteria | 9389 |
| 251 | Ga0068870_10002508 | 3300005840 | Bacteria | 7661 |
| 252 | Ga0068870_10354188 | 3300005840 | Bacteria | 943 |
| 253 | Ga0068863_100001174 | 3300005841 | Bacteria | 26150 |
| 254 | Ga0068863_100001288 | 3300005841 | Bacteria | 25037 |
| 255 | Ga0068863_100042055 | 3300005841 | Bacteria | 4343 |
| 256 | Ga0068863_100066651 | 3300005841 | Bacteria | 3405 |
| 257 | Ga0068863_100083587 | 3300005841 | Bacteria | 3025 |
| 258 | Ga0068863_100138251 | 3300005841 | Bacteria | 2327 |
| 259 | Ga0068863_100449999 | 3300005841 | Bacteria | 1264 |
| 260 | Ga0068863_100748589 | 3300005841 | Bacteria | 973 |
| 261 | Ga0068863_100819936 | 3300005841 | Bacteria | 928 |
| 262 | Ga0068858_100004050 | 3300005842 | Bacteria | 14449 |
| 263 | Ga0068858_100011271 | 3300005842 | Bacteria | 8448 |
| 264 | Ga0068858_100051795 | 3300005842 | Bacteria | 3798 |
| 265 | Ga0068858_100070407 | 3300005842 | Bacteria | 3242 |
| 266 | Ga0068858_100102579 | 3300005842 | Bacteria | 2668 |
| 267 | Ga0068858_100392942 | 3300005842 | Bacteria | 1332 |
| 268 | Ga0068860_100001659 | 3300005843 | Bacteria | 23813 |
| 269 | Ga0068860_100002991 | 3300005843 | Bacteria | 17457 |
| 270 | Ga0068860_100003223 | 3300005843 | Bacteria | 16827 |
| 271 | Ga0068860_100008441 | 3300005843 | Bacteria | 10261 |
| 272 | Ga0068860_100009595 | 3300005843 | Bacteria | 9617 |
| 273 | Ga0068860_100038199 | 3300005843 | Bacteria | 4594 |
| 274 | Ga0068860_100059599 | 3300005843 | Bacteria | 3628 |
| 275 | Ga0068862_100031290 | 3300005844 | Bacteria | 4491 |
| 276 | Ga0068862_100138809 | 3300005844 | Bacteria | 2156 |
| 277 | Ga0068862_100279792 | 3300005844 | Bacteria | 1529 |
| 278 | Ga0070715_10014259 | 3300006163 | Bacteria | 2940 |
| 279 | Ga0070716_100077653 | 3300006173 | Bacteria | 1971 |
| 280 | Ga0070716_100086414 | 3300006173 | Bacteria | 1886 |
| 281 | Ga0070712_100019900 | 3300006175 | Bacteria | 4388 |
| 282 | Ga0070712_100064311 | 3300006175 | Bacteria | 2601 |
| 283 | Ga0097621_100039465 | 3300006237 | Bacteria | 3792 |
| 284 | Ga0097621_100044014 | 3300006237 | Bacteria | 3601 |
| 285 | Ga0097621_100184539 | 3300006237 | Bacteria | 1804 |
| 286 | Ga0097621_100217437 | 3300006237 | Bacteria | 1664 |
| 287 | Ga0097621_100404521 | 3300006237 | Bacteria | 1223 |
| 288 | Ga0068871_100007334 | 3300006358 | Bacteria | 7869 |
| 289 | Ga0068871_100033693 | 3300006358 | Bacteria | 4058 |
| 290 | Ga0068871_100068352 | 3300006358 | Bacteria | 2917 |
| 291 | Ga0068871_100133841 | 3300006358 | Bacteria | 2104 |
| 292 | Ga0068871_100273771 | 3300006358 | Bacteria | 1475 |
| 293 | Ga0075428_100880926 | 3300006844 | Bacteria | 950 |
| 294 | Ga0075433_10030161 | 3300006852 | Bacteria | 4626 |
| 295 | Ga0075434_100079351 | 3300006871 | Bacteria | 3279 |
| 296 | Ga0075434_100087139 | 3300006871 | Bacteria | 3123 |
| 297 | Ga0075434_100660136 | 3300006871 | Unclassified | 1064 |
| 298 | Ga0068865_100019734 | 3300006881 | Bacteria | 4364 |
| 299 | Ga0068865_100051841 | 3300006881 | Bacteria | 2842 |
| 300 | Ga0068865_100072564 | 3300006881 | Bacteria | 2445 |
| 301 | Ga0097620_100000538 | 3300006931 | Bacteria | 37506 |
| 302 | Ga0097620_100002241 | 3300006931 | Bacteria | 19618 |
| 303 | Ga0097620_100102574 | 3300006931 | Bacteria | 2918 |
| 304 | Ga0097620_100149437 | 3300006931 | Bacteria | 2412 |
| 305 | Ga0097620_100187602 | 3300006931 | Bacteria | 2152 |
| 306 | Ga0097620_100653476 | 3300006931 | Bacteria | 1143 |
| 307 | Ga0075435_100078850 | 3300007076 | Bacteria | 2702 |
| 308 | Ga0105240_10000555 | 3300009093 | Bacteria | 69184 |
| 309 | Ga0105240_10079605 | 3300009093 | Bacteria | 4032 |
| 310 | Ga0111539_10013935 | 3300009094 | Bacteria | 10051 |
| 311 | Ga0105245_10004136 | 3300009098 | Bacteria | 12888 |
| 312 | Ga0105247_10005328 | 3300009101 | Bacteria | 8107 |
| 313 | Ga0114129_10113469 | 3300009147 | Bacteria | 3737 |
| 314 | Ga0105243_10050943 | 3300009148 | Bacteria | 3272 |
| 315 | Ga0105243_10170986 | 3300009148 | Bacteria | 1882 |
| 316 | Ga0105243_10223486 | 3300009148 | Bacteria | 1666 |
| 317 | Ga0105243_10331703 | 3300009148 | Bacteria | 1390 |
| 318 | Ga0105241_10016536 | 3300009174 | Bacteria | 5411 |
| 319 | Ga0105241_10154028 | 3300009174 | Bacteria | 1883 |
| 320 | Ga0105242_10014406 | 3300009176 | Bacteria | 6127 |
| 321 | Ga0105242_10067456 | 3300009176 | Bacteria | 2958 |
| 322 | Ga0105242_10120603 | 3300009176 | Bacteria | 2250 |
| 323 | Ga0105248_10000874 | 3300009177 | Bacteria | 33787 |
| 324 | Ga0105248_10018853 | 3300009177 | Bacteria | 7631 |
| 325 | Ga0105248_10084067 | 3300009177 | Bacteria | 3580 |
| 326 | Ga0105248_10093968 | 3300009177 | Bacteria | 3377 |
| 327 | Ga0105248_10130372 | 3300009177 | Bacteria | 2836 |
| 328 | Ga0105237_10095861 | 3300009545 | Bacteria | 2957 |
| 329 | Ga0105237_10177310 | 3300009545 | Bacteria | 2132 |
| 330 | Ga0105237_10212814 | 3300009545 | Bacteria | 1932 |
| 331 | Ga0105238_10004888 | 3300009551 | Bacteria | 13255 |
| 332 | Ga0105238_10074440 | 3300009551 | Bacteria | 3388 |
| 333 | Ga0105238_10125099 | 3300009551 | Bacteria | 2550 |
| 334 | Ga0105249_10146192 | 3300009553 | Bacteria | 2272 |
| 335 | Ga0105249_10309883 | 3300009553 | Bacteria | 1586 |
| 336 | Ga0105239_10005432 | 3300010375 | Bacteria | 14957 |
| 337 | Ga0105239_10116379 | 3300010375 | Bacteria | 2966 |
| 338 | Ga0105239_10303532 | 3300010375 | Bacteria | 1798 |
| 339 | Ga0105246_10031481 | 3300011119 | Bacteria | 3511 |
| 340 | Ga0105246_10043977 | 3300011119 | Bacteria | 3033 |
| 341 | Ga0157373_10001627 | 3300013100 | Bacteria | 17144 |
| 342 | Ga0157373_10001779 | 3300013100 | Bacteria | 16390 |
| 343 | Ga0157373_10023685 | 3300013100 | Bacteria | 4450 |
| 344 | Ga0157373_10160433 | 3300013100 | Bacteria | 1582 |
| 345 | Ga0157373_10294651 | 3300013100 | Bacteria | 1151 |
| 346 | Ga0157371_10000614 | 3300013102 | Bacteria | 42414 |
| 347 | Ga0157371_10193486 | 3300013102 | Bacteria | 1457 |
| 348 | Ga0157371_10214942 | 3300013102 | Bacteria | 1380 |
| 349 | Ga0157370_10002272 | 3300013104 | Bacteria | 23306 |
| 350 | Ga0157370_10019529 | 3300013104 | Bacteria | 6792 |
| 351 | Ga0157370_10021376 | 3300013104 | Bacteria | 6448 |
| 352 | Ga0157370_10025093 | 3300013104 | Bacteria | 5901 |
| 353 | Ga0157370_10028265 | 3300013104 | Bacteria | 5519 |
| 354 | Ga0157370_10096370 | 3300013104 | Bacteria | 2776 |
| 355 | Ga0157370_10107004 | 3300013104 | Bacteria | 2617 |
| 356 | Ga0157370_10320849 | 3300013104 | Bacteria | 1429 |
| 357 | Ga0157369_10006469 | 3300013105 | Bacteria | 13577 |
| 358 | Ga0157369_10020274 | 3300013105 | Bacteria | 7431 |
| 359 | Ga0157369_10052080 | 3300013105 | Bacteria | 4430 |
| 360 | Ga0157369_10061683 | 3300013105 | Bacteria | 4041 |
| 361 | Ga0157369_10076187 | 3300013105 | Bacteria | 3595 |
| 362 | Ga0157369_10125063 | 3300013105 | Bacteria | 2727 |
| 363 | Ga0157369_10250757 | 3300013105 | Bacteria | 1847 |
| 364 | Ga0157374_10000346 | 3300013296 | Bacteria | 42858 |
| 365 | Ga0157374_10007812 | 3300013296 | Bacteria | 9132 |
| 366 | Ga0157378_10085099 | 3300013297 | Bacteria | 2864 |
| 367 | Ga0157378_10200853 | 3300013297 | Bacteria | 1885 |
| 368 | Ga0157378_10430777 | 3300013297 | Bacteria | 1305 |
| 369 | Ga0163162_10004891 | 3300013306 | Bacteria | 12917 |
| 370 | Ga0163162_10012637 | 3300013306 | Bacteria | 8244 |
| 371 | Ga0163162_10323313 | 3300013306 | Bacteria | 1675 |
| 372 | Ga0157372_10005628 | 3300013307 | Bacteria | 13321 |
| 373 | Ga0157372_10124136 | 3300013307 | Bacteria | 2968 |
| 374 | Ga0157372_10293587 | 3300013307 | Bacteria | 1890 |
| 375 | Ga0157372_10369990 | 3300013307 | Bacteria | 1670 |
| 376 | Ga0157375_10006699 | 3300013308 | Bacteria | 10033 |
| 377 | Ga0157375_10028302 | 3300013308 | Bacteria | 5251 |
| 378 | Ga0157375_10038782 | 3300013308 | Bacteria | 4577 |
| 379 | Ga0157375_10071036 | 3300013308 | Bacteria | 3493 |
| 380 | Ga0157375_10097017 | 3300013308 | Bacteria | 3021 |
| 381 | Ga0157375_10412710 | 3300013308 | Bacteria | 1516 |
| 382 | Ga0157375_10423734 | 3300013308 | Bacteria | 1497 |
| 383 | Ga0163163_10000834 | 3300014325 | Bacteria | 26217 |
| 384 | Ga0163163_10007776 | 3300014325 | Bacteria | 9473 |
| 385 | Ga0163163_10252072 | 3300014325 | Bacteria | 1816 |
| 386 | Ga0163163_10798953 | 3300014325 | Bacteria | 1007 |
| 387 | Ga0157380_10005009 | 3300014326 | Bacteria | 9236 |
| 388 | Ga0157380_10170274 | 3300014326 | Bacteria | 1902 |
| 389 | Ga0157380_10232326 | 3300014326 | Bacteria | 1657 |
| 390 | Ga0157380_10656824 | 3300014326 | Bacteria | 1047 |
| 391 | Ga0157377_10019007 | 3300014745 | Bacteria | 3583 |
| 392 | Ga0157379_10000063 | 3300014968 | Bacteria | 68139 |
| 393 | Ga0157379_10006330 | 3300014968 | Bacteria | 10194 |
| 394 | Ga0157379_10029616 | 3300014968 | Bacteria | 4867 |
| 395 | Ga0157379_10050077 | 3300014968 | Bacteria | 3728 |
| 396 | Ga0157379_10192171 | 3300014968 | Bacteria | 1845 |
| 397 | Ga0157379_10286523 | 3300014968 | Bacteria | 1499 |
| 398 | Ga0157376_10005094 | 3300014969 | Bacteria | 9156 |
| 399 | Ga0157376_10126952 | 3300014969 | Bacteria | 2270 |
| 400 | Ga0163161_10008971 | 3300017792 | Bacteria | 6917 |
| 401 | Ga0163161_10054808 | 3300017792 | Bacteria | 2894 |
| 402 | Ga0163161_10111351 | 3300017792 | Bacteria | 2047 |
| 403 | Ga0206356_10998087 | 3300020070 | Bacteria | 2815 |
| 404 | Ga0206353_11578615 | 3300020082 | Bacteria | 3176 |
| 405 | Ga0207697_10000020 | 3300025315 | Bacteria | 55999 |
| 406 | Ga0207697_10012830 | 3300025315 | Bacteria | 3504 |
| 407 | Ga0207656_10004889 | 3300025321 | Bacteria | 4702 |
| 408 | Ga0207682_10000288 | 3300025893 | Bacteria | 22923 |
| 409 | Ga0207692_10030021 | 3300025898 | Bacteria | 2588 |
| 410 | Ga0207642_10019101 | 3300025899 | Bacteria | 2646 |
| 411 | Ga0207642_10027163 | 3300025899 | Unclassified | 2340 |
| 412 | Ga0207642_10118967 | 3300025899 | Bacteria | 1359 |
| 413 | Ga0207710_10084046 | 3300025900 | Bacteria | 1481 |
| 414 | Ga0207680_10020719 | 3300025903 | Bacteria | 3547 |
| 415 | Ga0207680_10042020 | 3300025903 | Bacteria | 2671 |
| 416 | Ga0207680_10046820 | 3300025903 | Bacteria | 2559 |
| 417 | Ga0207680_10053505 | 3300025903 | Bacteria | 2424 |
| 418 | Ga0207680_10056433 | 3300025903 | Bacteria | 2372 |
| 419 | Ga0207680_10265463 | 3300025903 | Bacteria | 1189 |
| 420 | Ga0207680_10376029 | 3300025903 | Bacteria | 1001 |
| 421 | Ga0207647_10077221 | 3300025904 | Bacteria | 2002 |
| 422 | Ga0207685_10007960 | 3300025905 | Bacteria | 2989 |
| 423 | Ga0207699_10281538 | 3300025906 | Bacteria | 1156 |
| 424 | Ga0207699_10439694 | 3300025906 | Bacteria | 934 |
| 425 | Ga0207645_10000353 | 3300025907 | Bacteria | 38206 |
| 426 | Ga0207645_10004764 | 3300025907 | Bacteria | 9974 |
| 427 | Ga0207645_10023878 | 3300025907 | Bacteria | 3969 |
| 428 | Ga0207645_10038013 | 3300025907 | Bacteria | 3088 |
| 429 | Ga0207645_10039290 | 3300025907 | Bacteria | 3032 |
| 430 | Ga0207645_10089388 | 3300025907 | Bacteria | 1981 |
| 431 | Ga0207645_10270973 | 3300025907 | Bacteria | 1126 |
| 432 | Ga0207643_10000131 | 3300025908 | Bacteria | 50934 |
| 433 | Ga0207643_10002024 | 3300025908 | Bacteria | 11195 |
| 434 | Ga0207643_10007598 | 3300025908 | Bacteria | 5822 |
| 435 | Ga0207643_10099912 | 3300025908 | Bacteria | 1701 |
| 436 | Ga0207705_10012689 | 3300025909 | Bacteria | 6080 |
| 437 | Ga0207705_10049275 | 3300025909 | Bacteria | 3032 |
| 438 | Ga0207705_10193168 | 3300025909 | Bacteria | 1540 |
| 439 | Ga0207705_10305618 | 3300025909 | Bacteria | 1220 |
| 440 | Ga0207705_10320243 | 3300025909 | Bacteria | 1191 |
| 441 | Ga0207684_10155916 | 3300025910 | Bacteria | 1965 |
| 442 | Ga0207684_10250545 | 3300025910 | Bacteria | 1528 |
| 443 | Ga0207654_10006442 | 3300025911 | Bacteria | 5910 |
| 444 | Ga0207654_10057481 | 3300025911 | Bacteria | 2261 |
| 445 | Ga0207707_10022803 | 3300025912 | Bacteria | 5474 |
| 446 | Ga0207707_10026302 | 3300025912 | Bacteria | 5086 |
| 447 | Ga0207707_10046973 | 3300025912 | Bacteria | 3760 |
| 448 | Ga0207707_10079382 | 3300025912 | Bacteria | 2865 |
| 449 | Ga0207695_10010003 | 3300025913 | Bacteria | 11651 |
| 450 | Ga0207695_10044873 | 3300025913 | Bacteria | 4698 |
| 451 | Ga0207695_10377756 | 3300025913 | Bacteria | 1303 |
| 452 | Ga0207671_10052659 | 3300025914 | Bacteria | 3016 |
| 453 | Ga0207671_10155656 | 3300025914 | Bacteria | 1767 |
| 454 | Ga0207671_10363711 | 3300025914 | Unclassified | 1148 |
| 455 | Ga0207671_10379959 | 3300025914 | Unclassified | 1122 |
| 456 | Ga0207693_10003162 | 3300025915 | Bacteria | 14146 |
| 457 | Ga0207693_10012564 | 3300025915 | Bacteria | 6840 |
| 458 | Ga0207693_10017226 | 3300025915 | Bacteria | 5762 |
| 459 | Ga0207663_10166190 | 3300025916 | Bacteria | 1563 |
| 460 | Ga0207663_10217211 | 3300025916 | Bacteria | 1389 |
| 461 | Ga0207663_10278123 | 3300025916 | Bacteria | 1242 |
| 462 | Ga0207660_10016156 | 3300025917 | Bacteria | 4937 |
| 463 | Ga0207660_10058817 | 3300025917 | Bacteria | 2757 |
| 464 | Ga0207662_10003213 | 3300025918 | Bacteria | 8366 |
| 465 | Ga0207662_10019927 | 3300025918 | Bacteria | 3822 |
| 466 | Ga0207657_10000838 | 3300025919 | Bacteria | 32510 |
| 467 | Ga0207657_10001142 | 3300025919 | Bacteria | 28211 |
| 468 | Ga0207657_10005375 | 3300025919 | Bacteria | 13408 |
| 469 | Ga0207657_10006434 | 3300025919 | Bacteria | 12178 |
| 470 | Ga0207657_10007848 | 3300025919 | Bacteria | 10894 |
| 471 | Ga0207657_10014488 | 3300025919 | Bacteria | 7694 |
| 472 | Ga0207657_10024869 | 3300025919 | Bacteria | 5536 |
| 473 | Ga0207657_10333476 | 3300025919 | Bacteria | 1198 |
| 474 | Ga0207649_10021892 | 3300025920 | Bacteria | 3688 |
| 475 | Ga0207649_10031977 | 3300025920 | Bacteria | 3132 |
| 476 | Ga0207649_10045147 | 3300025920 | Bacteria | 2700 |
| 477 | Ga0207652_10025106 | 3300025921 | Bacteria | 4951 |
| 478 | Ga0207652_10031346 | 3300025921 | Bacteria | 4464 |
| 479 | Ga0207652_10507958 | 3300025921 | Bacteria | 1085 |
| 480 | Ga0207646_10005882 | 3300025922 | Bacteria | 12809 |
| 481 | Ga0207646_10351090 | 3300025922 | Bacteria | 1333 |
| 482 | Ga0207646_10564925 | 3300025922 | Bacteria | 1022 |
| 483 | Ga0207681_10001804 | 3300025923 | Bacteria | 13734 |
| 484 | Ga0207681_10165285 | 3300025923 | Bacteria | 1672 |
| 485 | Ga0207694_10002716 | 3300025924 | Bacteria | 14316 |
| 486 | Ga0207694_10020858 | 3300025924 | Bacteria | 4960 |
| 487 | Ga0207650_10002600 | 3300025925 | Bacteria | 12491 |
| 488 | Ga0207650_10004277 | 3300025925 | Bacteria | 9744 |
| 489 | Ga0207650_10012394 | 3300025925 | Bacteria | 5886 |
| 490 | Ga0207650_10030171 | 3300025925 | Bacteria | 3903 |
| 491 | Ga0207650_10142504 | 3300025925 | Bacteria | 1885 |
| 492 | Ga0207650_10279858 | 3300025925 | Bacteria | 1358 |
| 493 | Ga0207659_10006674 | 3300025926 | Bacteria | 7091 |
| 494 | Ga0207659_10009437 | 3300025926 | Bacteria | 6097 |
| 495 | Ga0207659_10029974 | 3300025926 | Bacteria | 3712 |
| 496 | Ga0207659_10045840 | 3300025926 | Bacteria | 3085 |
| 497 | Ga0207659_10094727 | 3300025926 | Bacteria | 2238 |
| 498 | Ga0207659_10152880 | 3300025926 | Bacteria | 1804 |
| 499 | Ga0207687_10003789 | 3300025927 | Bacteria | 10161 |
| 500 | Ga0207687_10004961 | 3300025927 | Bacteria | 8830 |
| 501 | Ga0207687_10026635 | 3300025927 | Bacteria | 3873 |
| 502 | Ga0207700_10012983 | 3300025928 | Bacteria | 5398 |
| 503 | Ga0207664_10010569 | 3300025929 | Bacteria | 6520 |
| 504 | Ga0207664_10013621 | 3300025929 | Bacteria | 5845 |
| 505 | Ga0207664_10089677 | 3300025929 | Bacteria | 2518 |
| 506 | Ga0207644_10004041 | 3300025931 | Bacteria | 9515 |
| 507 | Ga0207644_10015731 | 3300025931 | Bacteria | 5083 |
| 508 | Ga0207644_10022542 | 3300025931 | Bacteria | 4303 |
| 509 | Ga0207644_10060477 | 3300025931 | Bacteria | 2741 |
| 510 | Ga0207644_10099000 | 3300025931 | Bacteria | 2187 |
| 511 | Ga0207690_10000802 | 3300025932 | Bacteria | 20178 |
| 512 | Ga0207690_10044895 | 3300025932 | Bacteria | 2916 |
| 513 | Ga0207690_10141935 | 3300025932 | Bacteria | 1771 |
| 514 | Ga0207690_10267604 | 3300025932 | Unclassified | 1326 |
| 515 | Ga0207706_10000052 | 3300025933 | Bacteria | 115553 |
| 516 | Ga0207706_10002570 | 3300025933 | Bacteria | 17702 |
| 517 | Ga0207706_10006651 | 3300025933 | Bacteria | 10690 |
| 518 | Ga0207706_10150777 | 3300025933 | Bacteria | 2044 |
| 519 | Ga0207706_10156752 | 3300025933 | Bacteria | 2002 |
| 520 | Ga0207686_10022739 | 3300025934 | Bacteria | 3613 |
| 521 | Ga0207686_10282444 | 3300025934 | Bacteria | 1226 |
| 522 | Ga0207709_10150528 | 3300025935 | Bacteria | 1611 |
| 523 | Ga0207709_10225641 | 3300025935 | Bacteria | 1354 |
| 524 | Ga0207670_10009886 | 3300025936 | Bacteria | 5464 |
| 525 | Ga0207670_10146943 | 3300025936 | Bacteria | 1744 |
| 526 | Ga0207670_10208822 | 3300025936 | Bacteria | 1488 |
| 527 | Ga0207670_10627296 | 3300025936 | Bacteria | 884 |
| 528 | Ga0207669_10084951 | 3300025937 | Bacteria | 2041 |
| 529 | Ga0207669_10110440 | 3300025937 | Bacteria | 1841 |
| 530 | Ga0207669_10175210 | 3300025937 | Bacteria | 1531 |
| 531 | Ga0207669_10238061 | 3300025937 | Bacteria | 1347 |
| 532 | Ga0207704_10019940 | 3300025938 | Bacteria | 3535 |
| 533 | Ga0207665_10015079 | 3300025939 | Bacteria | 5075 |
| 534 | Ga0207665_10021340 | 3300025939 | Bacteria | 4258 |
| 535 | Ga0207665_10035099 | 3300025939 | Bacteria | 3327 |
| 536 | Ga0207691_10007196 | 3300025940 | Bacteria | 10734 |
| 537 | Ga0207691_10010390 | 3300025940 | Bacteria | 8930 |
| 538 | Ga0207691_10012433 | 3300025940 | Bacteria | 8161 |
| 539 | Ga0207691_10028016 | 3300025940 | Bacteria | 5278 |
| 540 | Ga0207691_10038833 | 3300025940 | Bacteria | 4405 |
| 541 | Ga0207691_10040366 | 3300025940 | Bacteria | 4312 |
| 542 | Ga0207691_10228966 | 3300025940 | Bacteria | 1610 |
| 543 | Ga0207691_10479099 | 3300025940 | Bacteria | 1058 |
| 544 | Ga0207711_10000741 | 3300025941 | Bacteria | 32019 |
| 545 | Ga0207711_10002533 | 3300025941 | Bacteria | 16274 |
| 546 | Ga0207711_10043796 | 3300025941 | Bacteria | 3819 |
| 547 | Ga0207711_10087248 | 3300025941 | Bacteria | 2737 |
| 548 | Ga0207711_10163969 | 3300025941 | Bacteria | 2013 |
| 549 | Ga0207711_10446067 | 3300025941 | Bacteria | 1204 |
| 550 | Ga0207711_10581691 | 3300025941 | Bacteria | 1045 |
| 551 | Ga0207689_10000091 | 3300025942 | Bacteria | 73260 |
| 552 | Ga0207689_10000116 | 3300025942 | Bacteria | 65521 |
| 553 | Ga0207689_10011986 | 3300025942 | Bacteria | 7432 |
| 554 | Ga0207689_10032909 | 3300025942 | Bacteria | 4309 |
| 555 | Ga0207689_10357700 | 3300025942 | Bacteria | 1214 |
| 556 | Ga0207661_10256591 | 3300025944 | Bacteria | 1556 |
| 557 | Ga0207679_10004806 | 3300025945 | Bacteria | 8417 |
| 558 | Ga0207679_10020060 | 3300025945 | Bacteria | 4505 |
| 559 | Ga0207667_10000257 | 3300025949 | Bacteria | 74952 |
| 560 | Ga0207667_10008794 | 3300025949 | Bacteria | 11956 |
| 561 | Ga0207667_10009201 | 3300025949 | Bacteria | 11669 |
| 562 | Ga0207667_10067872 | 3300025949 | Bacteria | 3714 |
| 563 | Ga0207667_10180698 | 3300025949 | Bacteria | 2167 |
| 564 | Ga0207667_10212173 | 3300025949 | Bacteria | 1984 |
| 565 | Ga0207667_10229175 | 3300025949 | Bacteria | 1903 |
| 566 | Ga0207667_10563560 | 3300025949 | Bacteria | 1151 |
| 567 | Ga0207651_10003828 | 3300025960 | Bacteria | 7458 |
| 568 | Ga0207651_10010539 | 3300025960 | Bacteria | 5128 |
| 569 | Ga0207651_10015691 | 3300025960 | Bacteria | 4412 |
| 570 | Ga0207651_10069851 | 3300025960 | Bacteria | 2482 |
| 571 | Ga0207651_10201751 | 3300025960 | Bacteria | 1594 |
| 572 | Ga0207651_10434216 | 3300025960 | Bacteria | 1123 |
| 573 | Ga0207651_10454584 | 3300025960 | Bacteria | 1099 |
| 574 | Ga0207712_10102483 | 3300025961 | Bacteria | 2131 |
| 575 | Ga0207668_10010200 | 3300025972 | Bacteria | 5669 |
| 576 | Ga0207668_10093761 | 3300025972 | Bacteria | 2212 |
| 577 | Ga0207668_10286968 | 3300025972 | Bacteria | 1352 |
| 578 | Ga0207640_10016901 | 3300025981 | Bacteria | 4255 |
| 579 | Ga0207640_10033821 | 3300025981 | Bacteria | 3184 |
| 580 | Ga0207658_10015481 | 3300025986 | Bacteria | 5231 |
| 581 | Ga0207658_10070171 | 3300025986 | Bacteria | 2650 |
| 582 | Ga0207658_10084275 | 3300025986 | Bacteria | 2445 |
| 583 | Ga0207658_10106416 | 3300025986 | Bacteria | 2208 |
| 584 | Ga0207658_10159105 | 3300025986 | Bacteria | 1849 |
| 585 | Ga0207677_10000945 | 3300026023 | Bacteria | 16205 |
| 586 | Ga0207677_10003049 | 3300026023 | Bacteria | 8859 |
| 587 | Ga0207677_10036394 | 3300026023 | Bacteria | 3208 |
| 588 | Ga0207677_10138521 | 3300026023 | Bacteria | 1859 |
| 589 | Ga0207677_10204930 | 3300026023 | Bacteria | 1571 |
| 590 | Ga0207703_10003554 | 3300026035 | Bacteria | 13030 |
| 591 | Ga0207703_10003665 | 3300026035 | Bacteria | 12803 |
| 592 | Ga0207703_10078779 | 3300026035 | Bacteria | 2739 |
| 593 | Ga0207703_10160732 | 3300026035 | Bacteria | 1967 |
| 594 | Ga0207703_10200916 | 3300026035 | Bacteria | 1771 |
| 595 | Ga0207639_10011492 | 3300026041 | Bacteria | 6152 |
| 596 | Ga0207639_10020442 | 3300026041 | Bacteria | 4739 |
| 597 | Ga0207639_10030799 | 3300026041 | Bacteria | 3937 |
| 598 | Ga0207639_10114920 | 3300026041 | Bacteria | 2200 |
| 599 | Ga0207639_10381607 | 3300026041 | Bacteria | 1266 |
| 600 | Ga0207639_10567850 | 3300026041 | Bacteria | 1043 |
| 601 | Ga0207678_10000257 | 3300026067 | Bacteria | 48122 |
| 602 | Ga0207678_10121935 | 3300026067 | Bacteria | 2225 |
| 603 | Ga0207678_10138861 | 3300026067 | Bacteria | 2074 |
| 604 | Ga0207678_10144086 | 3300026067 | Bacteria | 2033 |
| 605 | Ga0207678_10192050 | 3300026067 | Bacteria | 1745 |
| 606 | Ga0207678_10212249 | 3300026067 | Bacteria | 1656 |
| 607 | Ga0207708_10001876 | 3300026075 | Bacteria | 15504 |
| 608 | Ga0207708_10045574 | 3300026075 | Bacteria | 3342 |
| 609 | Ga0207702_10001528 | 3300026078 | Bacteria | 22893 |
| 610 | Ga0207702_10012390 | 3300026078 | Bacteria | 7101 |
| 611 | Ga0207702_10012902 | 3300026078 | Bacteria | 6949 |
| 612 | Ga0207702_10158973 | 3300026078 | Bacteria | 2062 |
| 613 | Ga0207702_10181992 | 3300026078 | Bacteria | 1936 |
| 614 | Ga0207702_10474978 | 3300026078 | Bacteria | 1216 |
| 615 | Ga0207702_10750647 | 3300026078 | Bacteria | 963 |
| 616 | Ga0207641_10004463 | 3300026088 | Bacteria | 12119 |
| 617 | Ga0207641_10008459 | 3300026088 | Bacteria | 8505 |
| 618 | Ga0207641_10013789 | 3300026088 | Bacteria | 6627 |
| 619 | Ga0207641_10076457 | 3300026088 | Bacteria | 2894 |
| 620 | Ga0207648_10000306 | 3300026089 | Bacteria | 53612 |
| 621 | Ga0207648_10000415 | 3300026089 | Bacteria | 47449 |
| 622 | Ga0207648_10131514 | 3300026089 | Bacteria | 2203 |
| 623 | Ga0207648_10427272 | 3300026089 | Bacteria | 1204 |
| 624 | Ga0207648_10487201 | 3300026089 | Bacteria | 1127 |
| 625 | Ga0207676_10000576 | 3300026095 | Bacteria | 30160 |
| 626 | Ga0207676_10005098 | 3300026095 | Bacteria | 9298 |
| 627 | Ga0207676_10019358 | 3300026095 | Bacteria | 4964 |
| 628 | Ga0207676_10032258 | 3300026095 | Bacteria | 3945 |
| 629 | Ga0207676_10055696 | 3300026095 | Bacteria | 3106 |
| 630 | Ga0207676_10117739 | 3300026095 | Bacteria | 2235 |
| 631 | Ga0207676_10123779 | 3300026095 | Bacteria | 2185 |
| 632 | Ga0207674_10000180 | 3300026116 | Bacteria | 77710 |
| 633 | Ga0207674_10011211 | 3300026116 | Bacteria | 10076 |
| 634 | Ga0207674_10011959 | 3300026116 | Bacteria | 9727 |
| 635 | Ga0207674_10011962 | 3300026116 | Bacteria | 9726 |
| 636 | Ga0207674_10057938 | 3300026116 | Bacteria | 3926 |
| 637 | Ga0207674_10116219 | 3300026116 | Bacteria | 2646 |
| 638 | Ga0207674_10139657 | 3300026116 | Bacteria | 2383 |
| 639 | Ga0207675_100002147 | 3300026118 | Bacteria | 19586 |
| 640 | Ga0207675_100002299 | 3300026118 | Bacteria | 18975 |
| 641 | Ga0207675_100190804 | 3300026118 | Bacteria | 1965 |
| 642 | Ga0207675_100307472 | 3300026118 | Bacteria | 1545 |
| 643 | Ga0207683_10000661 | 3300026121 | Bacteria | 31642 |
| 644 | Ga0207683_10016177 | 3300026121 | Bacteria | 6349 |
| 645 | Ga0207683_10433641 | 3300026121 | Bacteria | 1211 |
| 646 | Ga0207683_10532777 | 3300026121 | Bacteria | 1085 |
| 647 | Ga0207698_10003033 | 3300026142 | Bacteria | 10063 |
| 648 | Ga0207698_10018680 | 3300026142 | Bacteria | 4730 |
| 649 | Ga0207698_10114013 | 3300026142 | Bacteria | 2273 |
| 650 | Ga0207698_10654572 | 3300026142 | Bacteria | 1041 |
| 651 | Ga0209999_1006505 | 3300027543 | Bacteria | 2098 |
| 652 | Ga0209983_1024780 | 3300027665 | Bacteria | 1265 |
| 653 | Ga0209971_1002855 | 3300027682 | Bacteria | 4128 |
| 654 | Ga0209974_10018043 | 3300027876 | Bacteria | 2340 |
| 655 | Ga0268266_10040289 | 3300028379 | Bacteria | 3981 |
| 656 | Ga0268266_10052156 | 3300028379 | Bacteria | 3512 |
| 657 | Ga0268266_10244360 | 3300028379 | Bacteria | 1658 |
| 658 | Ga0268266_10254006 | 3300028379 | Bacteria | 1627 |
| 659 | Ga0268265_10010772 | 3300028380 | Bacteria | 6173 |
| 660 | Ga0268265_10013552 | 3300028380 | Bacteria | 5541 |
| 661 | Ga0268265_10128036 | 3300028380 | Bacteria | 2105 |
| 662 | Ga0268265_10172035 | 3300028380 | Bacteria | 1852 |
| 663 | Ga0268265_10550067 | 3300028380 | Bacteria | 1095 |
| 664 | Ga0268264_10000599 | 3300028381 | Bacteria | 43601 |
| 665 | Ga0268264_10002914 | 3300028381 | Bacteria | 14861 |
| 666 | Ga0268264_10006545 | 3300028381 | Bacteria | 9808 |
| 667 | Ga0268264_10021391 | 3300028381 | Bacteria | 5282 |
| 668 | Ga0268264_10021523 | 3300028381 | Bacteria | 5264 |
| 669 | Ga0307408_100013930 | 3300031548 | Bacteria | 5340 |
| 670 | Ga0307408_100411236 | 3300031548 | Bacteria | 1164 |
| 671 | Ga0307405_10022171 | 3300031731 | Bacteria | 3586 |
| 672 | Ga0307405_10134498 | 3300031731 | Bacteria | 1714 |
| 673 | Ga0307413_10017211 | 3300031824 | Bacteria | 3759 |
| 674 | Ga0307410_10001025 | 3300031852 | Bacteria | 12119 |
| 675 | Ga0307410_10090206 | 3300031852 | Bacteria | 2174 |
| 676 | Ga0307406_10011580 | 3300031901 | Bacteria | 5011 |
| 677 | Ga0307407_10002673 | 3300031903 | Bacteria | 7063 |
| 678 | Ga0307412_10027267 | 3300031911 | Bacteria | 3559 |
| 679 | Ga0307409_100077893 | 3300031995 | Bacteria | 2664 |
| 680 | Ga0307409_100272864 | 3300031995 | Bacteria | 1558 |
| 681 | Ga0307416_100008111 | 3300032002 | Bacteria | 6742 |
| 682 | Ga0307416_100495034 | 3300032002 | Bacteria | 1285 |
| 683 | Ga0307416_100991439 | 3300032002 | Unclassified | 943 |
| 684 | Ga0307414_10007478 | 3300032004 | Bacteria | 6137 |
| 685 | Ga0307414_10135432 | 3300032004 | Bacteria | 1920 |
| 686 | Ga0307411_10001635 | 3300032005 | Bacteria | 9350 |
| 687 | Ga0307411_10026811 | 3300032005 | Bacteria | 3475 |
| 688 | Ga0307411_10288275 | 3300032005 | Bacteria | 1310 |
| 689 | Ga0307415_100009598 | 3300032126 | Bacteria | 5436 |
| 690 | Ga0373934_0008635 | 3300035086 | Bacteria | 3799 |
| 691 | Ga0373923_0008271 | 3300035111 | Bacteria | 3702 |
| 692 | Ga0373923_0137666 | 3300035111 | Bacteria | 1102 |
| 693 | Ga0373939_0038262 | 3300035114 | Bacteria | 1430 |
| 694 | Ga0373945_0028518 | 3300035116 | Bacteria | 1956 |
| 695 | Ga0373953_0011491 | 3300035117 | Bacteria | 3109 |
| 696 | Ga0373954_0026942 | 3300035118 | Bacteria | 2636 |
| 697 | Ga0373956_0006099 | 3300035119 | Bacteria | 4821 |
| 698 | Ga0373957_0004355 | 3300035120 | Bacteria | 4300 |
| 699 | Ga0373957_0053941 | 3300035120 | Bacteria | 1543 |
| 700 | Ga0373943_0013793 | 3300035170 | Bacteria | 3654 |
| 701 | Ga0373943_0022232 | 3300035170 | Bacteria | 2936 |
| 702 | Ga0373946_0013246 | 3300035171 | Bacteria | 3097 |
| 703 | Ga0373955_0006260 | 3300035172 | Bacteria | 5416 |
| 704 | Ga0373955_0012521 | 3300035172 | Bacteria | 4077 |
| 705 | Ga0373955_0163496 | 3300035172 | Bacteria | 1315 |
| 706 | Ga0373931_0070508 | 3300035691 | Bacteria | 1907 |
| 707 | Ga0373935_0014581 | 3300035692 | Bacteria | 4743 |
| 708 | Ga0373927_0176731 | 3300035695 | Bacteria | 1400 |
| 709 | Ga0373933_0005336 | 3300035724 | Bacteria | 7005 |
| 710 | Ga0373933_0040116 | 3300035724 | Bacteria | 2757 |
| 711 | Ga0373933_0245393 | 3300035724 | Bacteria | 1152 |
| 712 | Ga0373947_0238111 | 3300035725 | Bacteria | 1200 |
| 713 | Ga0373937_0005753 | 3300036401 | Bacteria | 10653 |
| 714 | Ga0373937_0037694 | 3300036401 | Bacteria | 4406 |
| 715 | Ga0373937_0134579 | 3300036401 | Bacteria | 2310 |
| 716 | Ga0373925_0071423 | 3300037068 | Bacteria | 2625 |
| 717 | Ga0373925_0138667 | 3300037068 | Bacteria | 1902 |
| 718 | Ga0373925_0438822 | 3300037068 | Bacteria | 1068 |
| 719 | Ga0395899_0131810 | 3300037312 | Bacteria | 1784 |
| 720 | Ga0395900_0494649 | 3300037418 | Bacteria | 1174 |
| 721 | Ga0395901_0045268 | 3300038443 | Bacteria | 4566 |
| 722 | Ga0451853_1018540 | 3300041512 | Bacteria | 1624 |
| 723 | Ga0466967_0241150 | 3300045976 | Bacteria | 1725 |
| 724 | Ga0466967_0979988 | 3300045976 | Bacteria | 842 |
| 725 | Ga0495662_0113393 | 3300046476 | Bacteria | 1329 |
| 726 | Ga0495664_0044588 | 3300046477 | Bacteria | 2628 |
| 727 | Ga0495608_0255529 | 3300046511 | Bacteria | 1092 |
| 728 | Ga0495630_0154444 | 3300046517 | Bacteria | 1747 |
| 729 | Ga0495663_0060283 | 3300046525 | Bacteria | 1192 |
| 730 | Ga0495621_0001838 | 3300046539 | Bacteria | 5582 |
| 731 | Ga0495645_0006508 | 3300046543 | Bacteria | 8112 |
| 732 | Ga0495645_0181773 | 3300046543 | Bacteria | 1440 |
| 733 | Ga0495635_0093885 | 3300046663 | Bacteria | 2051 |
| 734 | Ga0495623_0071625 | 3300046679 | Bacteria | 2156 |
| 735 | Ga0495669_0193979 | 3300046684 | Bacteria | 970 |
| 736 | Ga0495674_0068559 | 3300047319 | Bacteria | 3070 |
| 737 | Ga0495602_0082816 | 3300048088 | Bacteria | 2691 |
| 738 | Ga0496100_0025850 | 3300048903 | Bacteria | 3593 |
| 739 | Ga0496100_0132250 | 3300048903 | Bacteria | 1759 |
| 740 | Ga0496100_0385492 | 3300048903 | Unclassified | 1065 |
| 741 | Ga0496101_0012964 | 3300048904 | Bacteria | 5576 |
| 742 | Ga0496101_0125400 | 3300048904 | Bacteria | 1945 |
| 743 | Ga0496101_0189478 | 3300048904 | Bacteria | 1587 |
| 744 | Ga0496101_0285086 | 3300048904 | Bacteria | 1292 |
| 745 | Ga0496102_0046701 | 3300048905 | Bacteria | 3933 |
| 746 | Ga0496102_0071380 | 3300048905 | Bacteria | 3188 |
| 747 | Ga0496102_0095244 | 3300048905 | Bacteria | 2759 |
| 748 | Ga0496102_0403235 | 3300048905 | Bacteria | 1285 |
| 749 | Ga0496103_0007843 | 3300048906 | Bacteria | 6345 |
| 750 | Ga0496104_0003498 | 3300048907 | Bacteria | 13546 |
| 751 | Ga0496104_0020188 | 3300048907 | Bacteria | 6104 |
| 752 | Ga0496105_0093814 | 3300048908 | Bacteria | 2479 |
| 753 | Ga0496105_0171595 | 3300048908 | Bacteria | 1778 |
| 754 | Ga0496106_0027195 | 3300048909 | Bacteria | 4260 |
| 755 | Ga0496106_0075957 | 3300048909 | Bacteria | 2574 |
| 756 | Ga0496107_0006584 | 3300048910 | Bacteria | 7995 |
| 757 | Ga0496107_0089582 | 3300048910 | Bacteria | 2247 |
| 758 | Ga0496107_0183841 | 3300048910 | Bacteria | 1552 |
| 759 | Ga0496108_0014945 | 3300048911 | Bacteria | 6336 |
| 760 | Ga0496108_0027429 | 3300048911 | Bacteria | 4703 |
| 761 | Ga0496108_0057427 | 3300048911 | Bacteria | 3270 |
| 762 | Ga0496109_0004927 | 3300048912 | Bacteria | 11142 |
| 763 | Ga0496109_0009581 | 3300048912 | Bacteria | 8261 |
| 764 | Ga0496109_0044266 | 3300048912 | Bacteria | 4038 |
| 765 | Ga0496109_0161442 | 3300048912 | Bacteria | 2100 |
| 766 | Ga0496110_0003478 | 3300048913 | Bacteria | 12080 |
| 767 | Ga0496110_0052969 | 3300048913 | Bacteria | 3566 |
| 768 | Ga0496111_0030710 | 3300048914 | Bacteria | 3822 |
| 769 | Ga0496112_0001998 | 3300048915 | Bacteria | 16138 |
| 770 | Ga0496112_0020364 | 3300048915 | Bacteria | 6287 |
| 771 | Ga0496112_0090231 | 3300048915 | Bacteria | 3034 |
| 772 | Ga0496113_0362424 | 3300048916 | Unclassified | 1163 |
| 773 | Ga0496113_0462969 | 3300048916 | Bacteria | 1019 |
| 774 | Ga0496114_0020599 | 3300048917 | Bacteria | 5353 |
| 775 | Ga0496114_0065480 | 3300048917 | Bacteria | 3045 |
| 776 | Ga0496114_0209004 | 3300048917 | Bacteria | 1711 |
| 777 | Ga0496115_0026872 | 3300048918 | Bacteria | 4497 |
| 778 | Ga0496115_0585826 | 3300048918 | Bacteria | 888 |
| 779 | Ga0501042_0173769 | 3300049578 | Bacteria | 1554 |
| 780 | Ga0501075_0380459 | 3300049591 | Bacteria | 1076 |
| 781 | Ga0501075_0560511 | 3300049591 | Bacteria | 872 |
| 782 | Ga0501045_0291363 | 3300049824 | Bacteria | 1215 |
| 783 | nmdc:mga05p37_90987_c1 | 3300050507 | Bacteria | 3760 |
| 784 | nmdc:mga08y16_25446_c1 | 3300050511 | Bacteria | 6242 |
| 785 | nmdc:mga0n895_167293_c1 | 3300050512 | Bacteria | 2230 |
| 786 | nmdc:mga0n895_83391_c1 | 3300050512 | Bacteria | 3188 |
| 787 | nmdc:mga0rr50_106851_c1 | 3300050513 | Bacteria | 2209 |
| 788 | nmdc:mga08x19_226839_c1 | 3300050514 | Bacteria | 1285 |
| 789 | nmdc:mga08x19_271192_c1 | 3300050514 | Bacteria | 1174 |
| 790 | nmdc:mga08x19_85961_c1 | 3300050514 | Bacteria | 2070 |
| 791 | nmdc:mga0a205_167339_c1 | 3300050515 | Bacteria | 2094 |
| 792 | nmdc:mga0a205_49770_c1 | 3300050515 | Bacteria | 4046 |
| 793 | Ga0495601_0029882 | 3300053077 | Bacteria | 3383 |
| 794 | Ga0495595_0026173 | 3300053084 | Bacteria | 2591 |
| 795 | Ga0501082_0220292 | 3300060353 | Bacteria | 1651 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10170986 | Ga0105243_101709862 | 206 |
| 2 | 3300013105 | Ga0157369_10250757 | Ga0157369_102507572 | 218 |
| 3 | 3300005330 | Ga0070690_100077990 | Ga0070690_1000779902 | 219 |
| 4 | 3300005334 | Ga0068869_100106314 | Ga0068869_1001063142 | 219 |
| 5 | 3300005340 | Ga0070689_100080408 | Ga0070689_1000804083 | 219 |
| 6 | 3300005356 | Ga0070674_100077228 | Ga0070674_1000772282 | 219 |
| 7 | 3300005544 | Ga0070686_100062993 | Ga0070686_1000629932 | 219 |
| 8 | 3300005617 | Ga0068859_100187599 | Ga0068859_1001875992 | 219 |
| 9 | 3300005618 | Ga0068864_100055270 | Ga0068864_1000552702 | 219 |
| 10 | 3300005841 | Ga0068863_100066651 | Ga0068863_1000666513 | 219 |
| 11 | 3300005842 | Ga0068858_100102579 | Ga0068858_1001025792 | 219 |
| 12 | 3300005844 | Ga0068862_100138809 | Ga0068862_1001388092 | 219 |
| 13 | 3300006237 | Ga0097621_100404521 | Ga0097621_1004045212 | 219 |
| 14 | 3300006931 | Ga0097620_100187602 | Ga0097620_1001876022 | 219 |
| 15 | 3300009148 | Ga0105243_10050943 | Ga0105243_100509433 | 219 |
| 16 | 3300009176 | Ga0105242_10014406 | Ga0105242_100144064 | 219 |
| 17 | 3300013297 | Ga0157378_10085099 | Ga0157378_100850994 | 219 |
| 18 | 3300013306 | Ga0163162_10323313 | Ga0163162_103233132 | 219 |
| 19 | 3300013308 | Ga0157375_10412710 | Ga0157375_104127102 | 219 |
| 20 | 3300014326 | Ga0157380_10005009 | Ga0157380_100050099 | 219 |
| 21 | 3300006871 | Ga0075434_100660136 | Ga0075434_1006601361 | 222 |
| 22 | 3300009147 | Ga0114129_10113469 | Ga0114129_101134694 | 222 |
| 23 | 3300025935 | Ga0207709_10150528 | Ga0207709_101505282 | 222 |
| 24 | 3300025937 | Ga0207669_10175210 | Ga0207669_101752102 | 222 |
| 25 | 3300025942 | Ga0207689_10011986 | Ga0207689_100119862 | 222 |
| 26 | 3300026035 | Ga0207703_10160732 | Ga0207703_101607322 | 222 |
| 27 | 3300026075 | Ga0207708_10045574 | Ga0207708_100455742 | 222 |
| 28 | 3300026089 | Ga0207648_10427272 | Ga0207648_104272722 | 222 |
| 29 | 3300028380 | Ga0268265_10172035 | Ga0268265_101720352 | 222 |
| 30 | 3300050507 | nmdc:mga05p37_90987_c1 | nmdc:mga05p37_90987_c1_312_1115 | 222 |
| 31 | 3300035695 | Ga0373927_0176731 | Ga0373927_0176731_430_1209 | 224 |
| 32 | 3300013104 | Ga0157370_10025093 | Ga0157370_100250934 | 225 |
| 33 | 3300013307 | Ga0157372_10293587 | Ga0157372_102935872 | 225 |
| 34 | 3300017792 | Ga0163161_10111351 | Ga0163161_101113512 | 225 |
| 35 | 3300049591 | Ga0501075_0560511 | Ga0501075_0560511_12_794 | 225 |
| 36 | 3300050515 | nmdc:mga0a205_167339_c1 | nmdc:mga0a205_167339_c1_681_1454 | 225 |
| 37 | 3300013100 | Ga0157373_10001627 | Ga0157373_1000162711 | 226 |
| 38 | 3300013102 | Ga0157371_10000614 | Ga0157371_1000061444 | 226 |
| 39 | 3300013105 | Ga0157369_10061683 | Ga0157369_100616833 | 226 |
| 40 | 3300013307 | Ga0157372_10005628 | Ga0157372_100056288 | 226 |
| 41 | 3300035691 | Ga0373931_0070508 | Ga0373931_0070508_486_1274 | 226 |
| 42 | 3300045976 | Ga0466967_0979988 | Ga0466967_0979988_82_804 | 226 |
| 43 | 3300048903 | Ga0496100_0132250 | Ga0496100_0132250_929_1732 | 226 |
| 44 | 3300048904 | Ga0496101_0285086 | Ga0496101_0285086_203_1006 | 226 |
| 45 | 3300048905 | Ga0496102_0046701 | Ga0496102_0046701_2313_3116 | 226 |
| 46 | 3300048909 | Ga0496106_0075957 | Ga0496106_0075957_26_829 | 226 |
| 47 | 3300005331 | Ga0070670_100006016 | Ga0070670_1000060169 | 227 |
| 48 | 3300005334 | Ga0068869_100002165 | Ga0068869_1000021657 | 227 |
| 49 | 3300005340 | Ga0070689_100084407 | Ga0070689_1000844073 | 227 |
| 50 | 3300005347 | Ga0070668_100204128 | Ga0070668_1002041282 | 227 |
| 51 | 3300005353 | Ga0070669_100195686 | Ga0070669_1001956862 | 227 |
| 52 | 3300005364 | Ga0070673_100004580 | Ga0070673_1000045805 | 227 |
| 53 | 3300005364 | Ga0070673_100284403 | Ga0070673_1002844032 | 227 |
| 54 | 3300005367 | Ga0070667_100032230 | Ga0070667_1000322305 | 227 |
| 55 | 3300005539 | Ga0068853_100288594 | Ga0068853_1002885942 | 227 |
| 56 | 3300005543 | Ga0070672_100007539 | Ga0070672_1000075399 | 227 |
| 57 | 3300005543 | Ga0070672_100045986 | Ga0070672_1000459864 | 227 |
| 58 | 3300005545 | Ga0070695_100088738 | Ga0070695_1000887382 | 227 |
| 59 | 3300005564 | Ga0070664_100157090 | Ga0070664_1001570902 | 227 |
| 60 | 3300005577 | Ga0068857_100010811 | Ga0068857_1000108114 | 227 |
| 61 | 3300005617 | Ga0068859_100000538 | Ga0068859_10000053837 | 227 |
| 62 | 3300005618 | Ga0068864_100000566 | Ga0068864_10000056621 | 227 |
| 63 | 3300005718 | Ga0068866_10062873 | Ga0068866_100628732 | 227 |
| 64 | 3300005719 | Ga0068861_100003091 | Ga0068861_1000030916 | 227 |
| 65 | 3300005840 | Ga0068870_10002508 | Ga0068870_100025089 | 227 |
| 66 | 3300005841 | Ga0068863_100001288 | Ga0068863_1000012888 | 227 |
| 67 | 3300005842 | Ga0068858_100004050 | Ga0068858_1000040509 | 227 |
| 68 | 3300005843 | Ga0068860_100001659 | Ga0068860_1000016598 | 227 |
| 69 | 3300005844 | Ga0068862_100031290 | Ga0068862_1000312904 | 227 |
| 70 | 3300006931 | Ga0097620_100000538 | Ga0097620_1000005388 | 227 |
| 71 | 3300009177 | Ga0105248_10018853 | Ga0105248_100188538 | 227 |
| 72 | 3300009545 | Ga0105237_10212814 | Ga0105237_102128142 | 227 |
| 73 | 3300013104 | Ga0157370_10107004 | Ga0157370_101070043 | 227 |
| 74 | 3300013308 | Ga0157375_10097017 | Ga0157375_100970172 | 227 |
| 75 | 3300014325 | Ga0163163_10007776 | Ga0163163_1000777612 | 227 |
| 76 | 3300014968 | Ga0157379_10000063 | Ga0157379_1000006319 | 227 |
| 77 | 3300025899 | Ga0207642_10027163 | Ga0207642_100271632 | 227 |
| 78 | 3300025903 | Ga0207680_10376029 | Ga0207680_103760291 | 227 |
| 79 | 3300025908 | Ga0207643_10002024 | Ga0207643_1000202414 | 227 |
| 80 | 3300025914 | Ga0207671_10155656 | Ga0207671_101556562 | 227 |
| 81 | 3300025923 | Ga0207681_10165285 | Ga0207681_101652852 | 227 |
| 82 | 3300025925 | Ga0207650_10004277 | Ga0207650_100042779 | 227 |
| 83 | 3300025936 | Ga0207670_10208822 | Ga0207670_102088222 | 227 |
| 84 | 3300025941 | Ga0207711_10446067 | Ga0207711_104460672 | 227 |
| 85 | 3300025942 | Ga0207689_10000116 | Ga0207689_100001162 | 227 |
| 86 | 3300025960 | Ga0207651_10015691 | Ga0207651_100156914 | 227 |
| 87 | 3300026023 | Ga0207677_10036394 | Ga0207677_100363942 | 227 |
| 88 | 3300026035 | Ga0207703_10003554 | Ga0207703_100035549 | 227 |
| 89 | 3300026088 | Ga0207641_10008459 | Ga0207641_100084599 | 227 |
| 90 | 3300026095 | Ga0207676_10005098 | Ga0207676_100050984 | 227 |
| 91 | 3300026116 | Ga0207674_10011962 | Ga0207674_100119624 | 227 |
| 92 | 3300026118 | Ga0207675_100002147 | Ga0207675_1000021477 | 227 |
| 93 | 3300028380 | Ga0268265_10010772 | Ga0268265_100107724 | 227 |
| 94 | 3300028381 | Ga0268264_10000599 | Ga0268264_100005999 | 227 |
| 95 | 3300035172 | Ga0373955_0006260 | Ga0373955_0006260_2644_3426 | 227 |
| 96 | 3300035724 | Ga0373933_0245393 | Ga0373933_0245393_61_843 | 227 |
| 97 | 3300036401 | Ga0373937_0005753 | Ga0373937_0005753_2830_3612 | 227 |
| 98 | 3300037312 | Ga0395899_0131810 | Ga0395899_0131810_25_798 | 227 |
| 99 | 3300048905 | Ga0496102_0071380 | Ga0496102_0071380_1197_2012 | 227 |
| 100 | 3300048906 | Ga0496103_0007843 | Ga0496103_0007843_3385_4200 | 227 |
| 101 | 3300048911 | Ga0496108_0027429 | Ga0496108_0027429_2732_3547 | 227 |
| 102 | 3300048912 | Ga0496109_0009581 | Ga0496109_0009581_3856_4671 | 227 |
| 103 | 3300050514 | nmdc:mga08x19_271192_c1 | nmdc:mga08x19_271192_c1_444_1163 | 227 |
| 104 | 3300005336 | Ga0070680_100078176 | Ga0070680_1000781762 | 228 |
| 105 | 3300005434 | Ga0070709_10154229 | Ga0070709_101542291 | 228 |
| 106 | 3300005436 | Ga0070713_100295283 | Ga0070713_1002952832 | 228 |
| 107 | 3300005439 | Ga0070711_100489154 | Ga0070711_1004891542 | 228 |
| 108 | 3300005468 | Ga0070707_100027782 | Ga0070707_1000277824 | 228 |
| 109 | 3300005471 | Ga0070698_100532084 | Ga0070698_1005320841 | 228 |
| 110 | 3300005539 | Ga0068853_100226132 | Ga0068853_1002261322 | 228 |
| 111 | 3300005549 | Ga0070704_100028431 | Ga0070704_1000284313 | 228 |
| 112 | 3300005616 | Ga0068852_100009159 | Ga0068852_1000091591 | 228 |
| 113 | 3300013104 | Ga0157370_10021376 | Ga0157370_100213763 | 228 |
| 114 | 3300013307 | Ga0157372_10369990 | Ga0157372_103699901 | 228 |
| 115 | 3300025915 | Ga0207693_10012564 | Ga0207693_100125646 | 228 |
| 116 | 3300025916 | Ga0207663_10166190 | Ga0207663_101661902 | 228 |
| 117 | 3300025919 | Ga0207657_10005375 | Ga0207657_100053755 | 228 |
| 118 | 3300025922 | Ga0207646_10564925 | Ga0207646_105649251 | 228 |
| 119 | 3300025927 | Ga0207687_10026635 | Ga0207687_100266352 | 228 |
| 120 | 3300025933 | Ga0207706_10156752 | Ga0207706_101567522 | 228 |
| 121 | 3300025941 | Ga0207711_10581691 | Ga0207711_105816911 | 228 |
| 122 | 3300026041 | Ga0207639_10381607 | Ga0207639_103816072 | 228 |
| 123 | 3300050514 | nmdc:mga08x19_85961_c1 | nmdc:mga08x19_85961_c1_425_1201 | 228 |
| 124 | 3300005336 | Ga0070680_100125440 | Ga0070680_1001254401 | 229 |
| 125 | 3300005339 | Ga0070660_100030182 | Ga0070660_1000301825 | 229 |
| 126 | 3300005344 | Ga0070661_100001548 | Ga0070661_1000015489 | 229 |
| 127 | 3300005366 | Ga0070659_100003884 | Ga0070659_10000388412 | 229 |
| 128 | 3300005435 | Ga0070714_100012896 | Ga0070714_1000128965 | 229 |
| 129 | 3300005445 | Ga0070708_100106282 | Ga0070708_1001062822 | 229 |
| 130 | 3300005455 | Ga0070663_100084983 | Ga0070663_1000849832 | 229 |
| 131 | 3300005458 | Ga0070681_10041982 | Ga0070681_100419824 | 229 |
| 132 | 3300005467 | Ga0070706_100014830 | Ga0070706_1000148308 | 229 |
| 133 | 3300005468 | Ga0070707_100052046 | Ga0070707_1000520464 | 229 |
| 134 | 3300005471 | Ga0070698_100103814 | Ga0070698_1001038142 | 229 |
| 135 | 3300005518 | Ga0070699_100126402 | Ga0070699_1001264022 | 229 |
| 136 | 3300005518 | Ga0070699_100807487 | Ga0070699_1008074871 | 229 |
| 137 | 3300005535 | Ga0070684_100025170 | Ga0070684_1000251705 | 229 |
| 138 | 3300005536 | Ga0070697_100012939 | Ga0070697_1000129393 | 229 |
| 139 | 3300005536 | Ga0070697_100127368 | Ga0070697_1001273681 | 229 |
| 140 | 3300005539 | Ga0068853_100005058 | Ga0068853_1000050584 | 229 |
| 141 | 3300005549 | Ga0070704_100012983 | Ga0070704_1000129835 | 229 |
| 142 | 3300005563 | Ga0068855_100007236 | Ga0068855_10000723614 | 229 |
| 143 | 3300005564 | Ga0070664_100039826 | Ga0070664_1000398264 | 229 |
| 144 | 3300005577 | Ga0068857_100000165 | Ga0068857_10000016511 | 229 |
| 145 | 3300005578 | Ga0068854_100001226 | Ga0068854_1000012269 | 229 |
| 146 | 3300005614 | Ga0068856_100000375 | Ga0068856_10000037546 | 229 |
| 147 | 3300005616 | Ga0068852_100000473 | Ga0068852_1000004739 | 229 |
| 148 | 3300005834 | Ga0068851_10019199 | Ga0068851_100191993 | 229 |
| 149 | 3300006173 | Ga0070716_100086414 | Ga0070716_1000864142 | 229 |
| 150 | 3300006852 | Ga0075433_10030161 | Ga0075433_100301612 | 229 |
| 151 | 3300006871 | Ga0075434_100079351 | Ga0075434_1000793513 | 229 |
| 152 | 3300006871 | Ga0075434_100087139 | Ga0075434_1000871392 | 229 |
| 153 | 3300007076 | Ga0075435_100078850 | Ga0075435_1000788502 | 229 |
| 154 | 3300009093 | Ga0105240_10000555 | Ga0105240_1000055554 | 229 |
| 155 | 3300009545 | Ga0105237_10177310 | Ga0105237_101773102 | 229 |
| 156 | 3300009551 | Ga0105238_10004888 | Ga0105238_100048885 | 229 |
| 157 | 3300013100 | Ga0157373_10023685 | Ga0157373_100236855 | 229 |
| 158 | 3300013104 | Ga0157370_10096370 | Ga0157370_100963702 | 229 |
| 159 | 3300013105 | Ga0157369_10006469 | Ga0157369_100064694 | 229 |
| 160 | 3300025909 | Ga0207705_10049275 | Ga0207705_100492753 | 229 |
| 161 | 3300025910 | Ga0207684_10155916 | Ga0207684_101559162 | 229 |
| 162 | 3300025912 | Ga0207707_10079382 | Ga0207707_100793822 | 229 |
| 163 | 3300025913 | Ga0207695_10010003 | Ga0207695_100100033 | 229 |
| 164 | 3300025914 | Ga0207671_10363711 | Ga0207671_103637111 | 229 |
| 165 | 3300025917 | Ga0207660_10058817 | Ga0207660_100588171 | 229 |
| 166 | 3300025919 | Ga0207657_10007848 | Ga0207657_100078489 | 229 |
| 167 | 3300025922 | Ga0207646_10005882 | Ga0207646_100058829 | 229 |
| 168 | 3300025924 | Ga0207694_10002716 | Ga0207694_100027165 | 229 |
| 169 | 3300025929 | Ga0207664_10089677 | Ga0207664_100896772 | 229 |
| 170 | 3300025932 | Ga0207690_10267604 | Ga0207690_102676042 | 229 |
| 171 | 3300025939 | Ga0207665_10021340 | Ga0207665_100213402 | 229 |
| 172 | 3300025945 | Ga0207679_10004806 | Ga0207679_100048069 | 229 |
| 173 | 3300025949 | Ga0207667_10009201 | Ga0207667_100092019 | 229 |
| 174 | 3300025981 | Ga0207640_10016901 | Ga0207640_100169014 | 229 |
| 175 | 3300026041 | Ga0207639_10030799 | Ga0207639_100307994 | 229 |
| 176 | 3300026067 | Ga0207678_10138861 | Ga0207678_101388612 | 229 |
| 177 | 3300026078 | Ga0207702_10012390 | Ga0207702_100123905 | 229 |
| 178 | 3300026116 | Ga0207674_10000180 | Ga0207674_1000018087 | 229 |
| 179 | 3300026142 | Ga0207698_10003033 | Ga0207698_100030334 | 229 |
| 180 | 3300032002 | Ga0307416_100991439 | Ga0307416_1009914391 | 229 |
| 181 | 3300035725 | Ga0373947_0238111 | Ga0373947_0238111_230_1018 | 229 |
| 182 | 3300050512 | nmdc:mga0n895_83391_c1 | nmdc:mga0n895_83391_c1_1022_1810 | 229 |
| 183 | 3300050513 | nmdc:mga0rr50_106851_c1 | nmdc:mga0rr50_106851_c1_276_1064 | 229 |
| 184 | 3300050514 | nmdc:mga08x19_226839_c1 | nmdc:mga08x19_226839_c1_342_1130 | 229 |
| 185 | 3300050515 | nmdc:mga0a205_49770_c1 | nmdc:mga0a205_49770_c1_1377_2165 | 229 |
| 186 | 3300060353 | Ga0501082_0220292 | Ga0501082_0220292_32_811 | 229 |
| 187 | 3300005328 | Ga0070676_10066188 | Ga0070676_100661882 | 230 |
| 188 | 3300005329 | Ga0070683_100084263 | Ga0070683_1000842632 | 230 |
| 189 | 3300005330 | Ga0070690_100003383 | Ga0070690_10000338310 | 230 |
| 190 | 3300005331 | Ga0070670_100011869 | Ga0070670_1000118699 | 230 |
| 191 | 3300005334 | Ga0068869_100010630 | Ga0068869_1000106304 | 230 |
| 192 | 3300005338 | Ga0068868_100025470 | Ga0068868_1000254704 | 230 |
| 193 | 3300005338 | Ga0068868_100150233 | Ga0068868_1001502332 | 230 |
| 194 | 3300005339 | Ga0070660_100096973 | Ga0070660_1000969732 | 230 |
| 195 | 3300005340 | Ga0070689_100001808 | Ga0070689_1000018081 | 230 |
| 196 | 3300005341 | Ga0070691_10078918 | Ga0070691_100789182 | 230 |
| 197 | 3300005343 | Ga0070687_100007131 | Ga0070687_1000071312 | 230 |
| 198 | 3300005355 | Ga0070671_100041804 | Ga0070671_1000418042 | 230 |
| 199 | 3300005356 | Ga0070674_100066301 | Ga0070674_1000663012 | 230 |
| 200 | 3300005364 | Ga0070673_100035130 | Ga0070673_1000351302 | 230 |
| 201 | 3300005365 | Ga0070688_100001156 | Ga0070688_1000011563 | 230 |
| 202 | 3300005434 | Ga0070709_10050520 | Ga0070709_100505203 | 230 |
| 203 | 3300005436 | Ga0070713_100004189 | Ga0070713_1000041894 | 230 |
| 204 | 3300005439 | Ga0070711_100008712 | Ga0070711_1000087122 | 230 |
| 205 | 3300005439 | Ga0070711_100385820 | Ga0070711_1003858202 | 230 |
| 206 | 3300005455 | Ga0070663_100257205 | Ga0070663_1002572052 | 230 |
| 207 | 3300005456 | Ga0070678_100009548 | Ga0070678_1000095488 | 230 |
| 208 | 3300005457 | Ga0070662_100001751 | Ga0070662_1000017512 | 230 |
| 209 | 3300005459 | Ga0068867_100223386 | Ga0068867_1002233862 | 230 |
| 210 | 3300005466 | Ga0070685_10002325 | Ga0070685_100023258 | 230 |
| 211 | 3300005535 | Ga0070684_100186839 | Ga0070684_1001868392 | 230 |
| 212 | 3300005539 | Ga0068853_100764847 | Ga0068853_1007648471 | 230 |
| 213 | 3300005545 | Ga0070695_100441127 | Ga0070695_1004411272 | 230 |
| 214 | 3300005547 | Ga0070693_100003077 | Ga0070693_1000030779 | 230 |
| 215 | 3300005548 | Ga0070665_100010753 | Ga0070665_1000107536 | 230 |
| 216 | 3300005549 | Ga0070704_100350105 | Ga0070704_1003501051 | 230 |
| 217 | 3300005563 | Ga0068855_100690281 | Ga0068855_1006902812 | 230 |
| 218 | 3300005614 | Ga0068856_100259851 | Ga0068856_1002598511 | 230 |
| 219 | 3300005615 | Ga0070702_100056723 | Ga0070702_1000567232 | 230 |
| 220 | 3300005617 | Ga0068859_100102571 | Ga0068859_1001025712 | 230 |
| 221 | 3300005618 | Ga0068864_100001675 | Ga0068864_10000167516 | 230 |
| 222 | 3300005718 | Ga0068866_10016521 | Ga0068866_100165215 | 230 |
| 223 | 3300005719 | Ga0068861_100241662 | Ga0068861_1002416622 | 230 |
| 224 | 3300005841 | Ga0068863_100001174 | Ga0068863_10000117418 | 230 |
| 225 | 3300005842 | Ga0068858_100051795 | Ga0068858_1000517952 | 230 |
| 226 | 3300005843 | Ga0068860_100008441 | Ga0068860_1000084419 | 230 |
| 227 | 3300005843 | Ga0068860_100059599 | Ga0068860_1000595995 | 230 |
| 228 | 3300006163 | Ga0070715_10014259 | Ga0070715_100142592 | 230 |
| 229 | 3300006173 | Ga0070716_100077653 | Ga0070716_1000776532 | 230 |
| 230 | 3300006175 | Ga0070712_100064311 | Ga0070712_1000643113 | 230 |
| 231 | 3300006358 | Ga0068871_100033693 | Ga0068871_1000336932 | 230 |
| 232 | 3300006931 | Ga0097620_100102574 | Ga0097620_1001025744 | 230 |
| 233 | 3300009098 | Ga0105245_10004136 | Ga0105245_100041369 | 230 |
| 234 | 3300009101 | Ga0105247_10005328 | Ga0105247_100053289 | 230 |
| 235 | 3300009176 | Ga0105242_10120603 | Ga0105242_101206032 | 230 |
| 236 | 3300009177 | Ga0105248_10093968 | Ga0105248_100939683 | 230 |
| 237 | 3300009551 | Ga0105238_10125099 | Ga0105238_101250992 | 230 |
| 238 | 3300010375 | Ga0105239_10303532 | Ga0105239_103035322 | 230 |
| 239 | 3300011119 | Ga0105246_10031481 | Ga0105246_100314814 | 230 |
| 240 | 3300011119 | Ga0105246_10043977 | Ga0105246_100439772 | 230 |
| 241 | 3300013100 | Ga0157373_10160433 | Ga0157373_101604332 | 230 |
| 242 | 3300013100 | Ga0157373_10294651 | Ga0157373_102946512 | 230 |
| 243 | 3300013102 | Ga0157371_10193486 | Ga0157371_101934862 | 230 |
| 244 | 3300013105 | Ga0157369_10052080 | Ga0157369_100520802 | 230 |
| 245 | 3300013296 | Ga0157374_10007812 | Ga0157374_100078129 | 230 |
| 246 | 3300013306 | Ga0163162_10004891 | Ga0163162_100048919 | 230 |
| 247 | 3300013308 | Ga0157375_10006699 | Ga0157375_1000669911 | 230 |
| 248 | 3300014325 | Ga0163163_10000834 | Ga0163163_1000083418 | 230 |
| 249 | 3300014969 | Ga0157376_10005094 | Ga0157376_100050943 | 230 |
| 250 | 3300017792 | Ga0163161_10054808 | Ga0163161_100548082 | 230 |
| 251 | 3300025900 | Ga0207710_10084046 | Ga0207710_100840462 | 230 |
| 252 | 3300025903 | Ga0207680_10056433 | Ga0207680_100564333 | 230 |
| 253 | 3300025903 | Ga0207680_10265463 | Ga0207680_102654632 | 230 |
| 254 | 3300025905 | Ga0207685_10007960 | Ga0207685_100079602 | 230 |
| 255 | 3300025906 | Ga0207699_10439694 | Ga0207699_104396942 | 230 |
| 256 | 3300025907 | Ga0207645_10038013 | Ga0207645_100380133 | 230 |
| 257 | 3300025911 | Ga0207654_10057481 | Ga0207654_100574813 | 230 |
| 258 | 3300025912 | Ga0207707_10046973 | Ga0207707_100469734 | 230 |
| 259 | 3300025915 | Ga0207693_10003162 | Ga0207693_100031629 | 230 |
| 260 | 3300025916 | Ga0207663_10217211 | Ga0207663_102172112 | 230 |
| 261 | 3300025916 | Ga0207663_10278123 | Ga0207663_102781232 | 230 |
| 262 | 3300025918 | Ga0207662_10019927 | Ga0207662_100199272 | 230 |
| 263 | 3300025927 | Ga0207687_10003789 | Ga0207687_100037892 | 230 |
| 264 | 3300025927 | Ga0207687_10004961 | Ga0207687_100049618 | 230 |
| 265 | 3300025928 | Ga0207700_10012983 | Ga0207700_100129834 | 230 |
| 266 | 3300025929 | Ga0207664_10013621 | Ga0207664_100136212 | 230 |
| 267 | 3300025931 | Ga0207644_10022542 | Ga0207644_100225424 | 230 |
| 268 | 3300025933 | Ga0207706_10006651 | Ga0207706_1000665110 | 230 |
| 269 | 3300025934 | Ga0207686_10022739 | Ga0207686_100227395 | 230 |
| 270 | 3300025936 | Ga0207670_10627296 | Ga0207670_106272961 | 230 |
| 271 | 3300025937 | Ga0207669_10110440 | Ga0207669_101104402 | 230 |
| 272 | 3300025939 | Ga0207665_10015079 | Ga0207665_100150795 | 230 |
| 273 | 3300025939 | Ga0207665_10035099 | Ga0207665_100350994 | 230 |
| 274 | 3300025940 | Ga0207691_10228966 | Ga0207691_102289661 | 230 |
| 275 | 3300025941 | Ga0207711_10000741 | Ga0207711_1000074121 | 230 |
| 276 | 3300025942 | Ga0207689_10032909 | Ga0207689_100329092 | 230 |
| 277 | 3300025944 | Ga0207661_10256591 | Ga0207661_102565911 | 230 |
| 278 | 3300025949 | Ga0207667_10563560 | Ga0207667_105635602 | 230 |
| 279 | 3300025960 | Ga0207651_10003828 | Ga0207651_100038284 | 230 |
| 280 | 3300025986 | Ga0207658_10159105 | Ga0207658_101591052 | 230 |
| 281 | 3300026023 | Ga0207677_10000945 | Ga0207677_100009459 | 230 |
| 282 | 3300026023 | Ga0207677_10138521 | Ga0207677_101385212 | 230 |
| 283 | 3300026035 | Ga0207703_10003665 | Ga0207703_100036652 | 230 |
| 284 | 3300026041 | Ga0207639_10114920 | Ga0207639_101149202 | 230 |
| 285 | 3300026067 | Ga0207678_10212249 | Ga0207678_102122492 | 230 |
| 286 | 3300026078 | Ga0207702_10158973 | Ga0207702_101589732 | 230 |
| 287 | 3300026078 | Ga0207702_10474978 | Ga0207702_104749781 | 230 |
| 288 | 3300026088 | Ga0207641_10004463 | Ga0207641_1000446311 | 230 |
| 289 | 3300026089 | Ga0207648_10131514 | Ga0207648_101315142 | 230 |
| 290 | 3300026095 | Ga0207676_10000576 | Ga0207676_1000057615 | 230 |
| 291 | 3300026142 | Ga0207698_10654572 | Ga0207698_106545722 | 230 |
| 292 | 3300028379 | Ga0268266_10040289 | Ga0268266_100402894 | 230 |
| 293 | 3300028381 | Ga0268264_10006545 | Ga0268264_100065454 | 230 |
| 294 | 3300028381 | Ga0268264_10021391 | Ga0268264_100213914 | 230 |
| 295 | 3300035086 | Ga0373934_0008635 | Ga0373934_0008635_2546_3337 | 230 |
| 296 | 3300035111 | Ga0373923_0008271 | Ga0373923_0008271_433_1224 | 230 |
| 297 | 3300035116 | Ga0373945_0028518 | Ga0373945_0028518_698_1489 | 230 |
| 298 | 3300035117 | Ga0373953_0011491 | Ga0373953_0011491_1751_2542 | 230 |
| 299 | 3300035118 | Ga0373954_0026942 | Ga0373954_0026942_217_1008 | 230 |
| 300 | 3300035119 | Ga0373956_0006099 | Ga0373956_0006099_3929_4720 | 230 |
| 301 | 3300035120 | Ga0373957_0004355 | Ga0373957_0004355_1649_2440 | 230 |
| 302 | 3300035170 | Ga0373943_0022232 | Ga0373943_0022232_227_1018 | 230 |
| 303 | 3300035171 | Ga0373946_0013246 | Ga0373946_0013246_1565_2356 | 230 |
| 304 | 3300035172 | Ga0373955_0012521 | Ga0373955_0012521_1662_2453 | 230 |
| 305 | 3300035692 | Ga0373935_0014581 | Ga0373935_0014581_2738_3529 | 230 |
| 306 | 3300035724 | Ga0373933_0005336 | Ga0373933_0005336_940_1731 | 230 |
| 307 | 3300037068 | Ga0373925_0071423 | Ga0373925_0071423_820_1611 | 230 |
| 308 | 3300037068 | Ga0373925_0138667 | Ga0373925_0138667_806_1597 | 230 |
| 309 | 3300046476 | Ga0495662_0113393 | Ga0495662_0113393_93_884 | 230 |
| 310 | 3300046477 | Ga0495664_0044588 | Ga0495664_0044588_783_1574 | 230 |
| 311 | 3300046511 | Ga0495608_0255529 | Ga0495608_0255529_291_1082 | 230 |
| 312 | 3300046517 | Ga0495630_0154444 | Ga0495630_0154444_882_1673 | 230 |
| 313 | 3300046525 | Ga0495663_0060283 | Ga0495663_0060283_89_880 | 230 |
| 314 | 3300046543 | Ga0495645_0006508 | Ga0495645_0006508_457_1248 | 230 |
| 315 | 3300046543 | Ga0495645_0181773 | Ga0495645_0181773_630_1421 | 230 |
| 316 | 3300046663 | Ga0495635_0093885 | Ga0495635_0093885_281_1072 | 230 |
| 317 | 3300046679 | Ga0495623_0071625 | Ga0495623_0071625_1325_2116 | 230 |
| 318 | 3300046684 | Ga0495669_0193979 | Ga0495669_0193979_92_883 | 230 |
| 319 | 3300047319 | Ga0495674_0068559 | Ga0495674_0068559_1146_1937 | 230 |
| 320 | 3300048088 | Ga0495602_0082816 | Ga0495602_0082816_1057_1848 | 230 |
| 321 | 3300048904 | Ga0496101_0012964 | Ga0496101_0012964_502_1293 | 230 |
| 322 | 3300048904 | Ga0496101_0189478 | Ga0496101_0189478_257_1072 | 230 |
| 323 | 3300048905 | Ga0496102_0403235 | Ga0496102_0403235_389_1183 | 230 |
| 324 | 3300048907 | Ga0496104_0020188 | Ga0496104_0020188_815_1606 | 230 |
| 325 | 3300048908 | Ga0496105_0093814 | Ga0496105_0093814_22_813 | 230 |
| 326 | 3300048910 | Ga0496107_0006584 | Ga0496107_0006584_462_1253 | 230 |
| 327 | 3300048911 | Ga0496108_0057427 | Ga0496108_0057427_1881_2672 | 230 |
| 328 | 3300048912 | Ga0496109_0044266 | Ga0496109_0044266_2511_3302 | 230 |
| 329 | 3300048915 | Ga0496112_0001998 | Ga0496112_0001998_8465_9256 | 230 |
| 330 | 3300048917 | Ga0496114_0209004 | Ga0496114_0209004_155_946 | 230 |
| 331 | 3300048918 | Ga0496115_0026872 | Ga0496115_0026872_1942_2733 | 230 |
| 332 | 3300048918 | Ga0496115_0585826 | Ga0496115_0585826_46_834 | 230 |
| 333 | 3300050512 | nmdc:mga0n895_167293_c1 | nmdc:mga0n895_167293_c1_1127_1918 | 230 |
| 334 | 3300053077 | Ga0495601_0029882 | Ga0495601_0029882_1519_2310 | 230 |
| 335 | 3300005334 | Ga0068869_100293763 | Ga0068869_1002937631 | 231 |
| 336 | 3300005366 | Ga0070659_100252064 | Ga0070659_1002520641 | 231 |
| 337 | 3300025898 | Ga0207692_10030021 | Ga0207692_100300213 | 231 |
| 338 | 3300025908 | Ga0207643_10007598 | Ga0207643_100075984 | 231 |
| 339 | 3300025910 | Ga0207684_10250545 | Ga0207684_102505452 | 231 |
| 340 | 3300025922 | Ga0207646_10351090 | Ga0207646_103510901 | 231 |
| 341 | 3300025926 | Ga0207659_10045840 | Ga0207659_100458402 | 231 |
| 342 | 3300025934 | Ga0207686_10282444 | Ga0207686_102824442 | 231 |
| 343 | 3300025940 | Ga0207691_10040366 | Ga0207691_100403662 | 231 |
| 344 | 3300026116 | Ga0207674_10139657 | Ga0207674_101396572 | 231 |
| 345 | 3300031548 | Ga0307408_100411236 | Ga0307408_1004112362 | 231 |
| 346 | 3300031731 | Ga0307405_10134498 | Ga0307405_101344982 | 231 |
| 347 | 3300031852 | Ga0307410_10090206 | Ga0307410_100902062 | 231 |
| 348 | 3300031995 | Ga0307409_100272864 | Ga0307409_1002728642 | 231 |
| 349 | 3300032002 | Ga0307416_100495034 | Ga0307416_1004950342 | 231 |
| 350 | 3300032004 | Ga0307414_10135432 | Ga0307414_101354322 | 231 |
| 351 | 3300032005 | Ga0307411_10026811 | Ga0307411_100268112 | 231 |
| 352 | 3300032005 | Ga0307411_10288275 | Ga0307411_102882752 | 231 |
| 353 | 3300048914 | Ga0496111_0030710 | Ga0496111_0030710_56_787 | 231 |
| 354 | 3300005335 | Ga0070666_10089480 | Ga0070666_100894802 | 233 |
| 355 | 3300005355 | Ga0070671_100004251 | Ga0070671_1000042515 | 233 |
| 356 | 3300005364 | Ga0070673_100027621 | Ga0070673_1000276215 | 233 |
| 357 | 3300005434 | Ga0070709_10265460 | Ga0070709_102654602 | 233 |
| 358 | 3300005456 | Ga0070678_100324932 | Ga0070678_1003249322 | 233 |
| 359 | 3300005543 | Ga0070672_100037494 | Ga0070672_1000374942 | 233 |
| 360 | 3300006237 | Ga0097621_100217437 | Ga0097621_1002174372 | 233 |
| 361 | 3300006358 | Ga0068871_100273771 | Ga0068871_1002737712 | 233 |
| 362 | 3300009177 | Ga0105248_10000874 | Ga0105248_1000087438 | 233 |
| 363 | 3300013104 | Ga0157370_10002272 | Ga0157370_1000227219 | 233 |
| 364 | 3300013308 | Ga0157375_10038782 | Ga0157375_100387823 | 233 |
| 365 | 3300025903 | Ga0207680_10020719 | Ga0207680_100207193 | 233 |
| 366 | 3300025906 | Ga0207699_10281538 | Ga0207699_102815382 | 233 |
| 367 | 3300025931 | Ga0207644_10004041 | Ga0207644_100040416 | 233 |
| 368 | 3300025940 | Ga0207691_10038833 | Ga0207691_100388335 | 233 |
| 369 | 3300025941 | Ga0207711_10002533 | Ga0207711_100025337 | 233 |
| 370 | 3300025960 | Ga0207651_10010539 | Ga0207651_100105396 | 233 |
| 371 | 3300026121 | Ga0207683_10433641 | Ga0207683_104336411 | 233 |
| 372 | 3300026121 | Ga0207683_10532777 | Ga0207683_105327772 | 233 |
| 373 | 3300027543 | Ga0209999_1006505 | Ga0209999_10065052 | 233 |
| 374 | 3300005327 | Ga0070658_10030463 | Ga0070658_100304632 | 234 |
| 375 | 3300005329 | Ga0070683_100007878 | Ga0070683_1000078789 | 234 |
| 376 | 3300005337 | Ga0070682_100068279 | Ga0070682_1000682792 | 234 |
| 377 | 3300005339 | Ga0070660_100087563 | Ga0070660_1000875631 | 234 |
| 378 | 3300005341 | Ga0070691_10085439 | Ga0070691_100854392 | 234 |
| 379 | 3300005344 | Ga0070661_100022392 | Ga0070661_1000223924 | 234 |
| 380 | 3300005347 | Ga0070668_100379566 | Ga0070668_1003795662 | 234 |
| 381 | 3300005354 | Ga0070675_100007513 | Ga0070675_1000075134 | 234 |
| 382 | 3300005364 | Ga0070673_100026489 | Ga0070673_1000264893 | 234 |
| 383 | 3300005364 | Ga0070673_100338072 | Ga0070673_1003380721 | 234 |
| 384 | 3300005366 | Ga0070659_100001467 | Ga0070659_10000146718 | 234 |
| 385 | 3300005434 | Ga0070709_10135747 | Ga0070709_101357472 | 234 |
| 386 | 3300005435 | Ga0070714_100561651 | Ga0070714_1005616511 | 234 |
| 387 | 3300005455 | Ga0070663_100250141 | Ga0070663_1002501411 | 234 |
| 388 | 3300005535 | Ga0070684_100003343 | Ga0070684_10000334312 | 234 |
| 389 | 3300005539 | Ga0068853_100025368 | Ga0068853_1000253682 | 234 |
| 390 | 3300005547 | Ga0070693_100366083 | Ga0070693_1003660831 | 234 |
| 391 | 3300005564 | Ga0070664_100010118 | Ga0070664_1000101185 | 234 |
| 392 | 3300005578 | Ga0068854_100002702 | Ga0068854_1000027025 | 234 |
| 393 | 3300005614 | Ga0068856_100054107 | Ga0068856_1000541073 | 234 |
| 394 | 3300005618 | Ga0068864_100433989 | Ga0068864_1004339892 | 234 |
| 395 | 3300005834 | Ga0068851_10000426 | Ga0068851_1000042610 | 234 |
| 396 | 3300009174 | Ga0105241_10016536 | Ga0105241_100165362 | 234 |
| 397 | 3300009551 | Ga0105238_10074440 | Ga0105238_100744403 | 234 |
| 398 | 3300010375 | Ga0105239_10005432 | Ga0105239_100054327 | 234 |
| 399 | 3300013100 | Ga0157373_10001779 | Ga0157373_100017792 | 234 |
| 400 | 3300014325 | Ga0163163_10798953 | Ga0163163_107989531 | 234 |
| 401 | 3300020082 | Ga0206353_11578615 | Ga0206353_115786154 | 234 |
| 402 | 3300025908 | Ga0207643_10099912 | Ga0207643_100999122 | 234 |
| 403 | 3300025909 | Ga0207705_10012689 | Ga0207705_100126892 | 234 |
| 404 | 3300025911 | Ga0207654_10006442 | Ga0207654_100064422 | 234 |
| 405 | 3300025912 | Ga0207707_10026302 | Ga0207707_100263026 | 234 |
| 406 | 3300025913 | Ga0207695_10044873 | Ga0207695_100448736 | 234 |
| 407 | 3300025917 | Ga0207660_10016156 | Ga0207660_100161566 | 234 |
| 408 | 3300025919 | Ga0207657_10006434 | Ga0207657_100064345 | 234 |
| 409 | 3300025920 | Ga0207649_10031977 | Ga0207649_100319772 | 234 |
| 410 | 3300025921 | Ga0207652_10025106 | Ga0207652_100251062 | 234 |
| 411 | 3300025924 | Ga0207694_10020858 | Ga0207694_100208582 | 234 |
| 412 | 3300025926 | Ga0207659_10009437 | Ga0207659_100094373 | 234 |
| 413 | 3300025940 | Ga0207691_10479099 | Ga0207691_104790992 | 234 |
| 414 | 3300025949 | Ga0207667_10008794 | Ga0207667_100087945 | 234 |
| 415 | 3300025972 | Ga0207668_10286968 | Ga0207668_102869681 | 234 |
| 416 | 3300025981 | Ga0207640_10033821 | Ga0207640_100338213 | 234 |
| 417 | 3300026023 | Ga0207677_10204930 | Ga0207677_102049302 | 234 |
| 418 | 3300026041 | Ga0207639_10020442 | Ga0207639_100204425 | 234 |
| 419 | 3300026067 | Ga0207678_10144086 | Ga0207678_101440862 | 234 |
| 420 | 3300026078 | Ga0207702_10750647 | Ga0207702_107506471 | 234 |
| 421 | 3300026095 | Ga0207676_10117739 | Ga0207676_101177392 | 234 |
| 422 | 3300026116 | Ga0207674_10011211 | Ga0207674_100112116 | 234 |
| 423 | 3300026142 | Ga0207698_10018680 | Ga0207698_100186805 | 234 |
| 424 | 3300048910 | Ga0496107_0089582 | Ga0496107_0089582_884_1699 | 234 |
| 425 | 3300005328 | Ga0070676_10091947 | Ga0070676_100919472 | 235 |
| 426 | 3300005339 | Ga0070660_100044893 | Ga0070660_1000448933 | 235 |
| 427 | 3300005339 | Ga0070660_100167942 | Ga0070660_1001679421 | 235 |
| 428 | 3300005344 | Ga0070661_100033672 | Ga0070661_1000336724 | 235 |
| 429 | 3300005353 | Ga0070669_100340996 | Ga0070669_1003409961 | 235 |
| 430 | 3300005436 | Ga0070713_100015240 | Ga0070713_1000152402 | 235 |
| 431 | 3300005530 | Ga0070679_100130273 | Ga0070679_1001302732 | 235 |
| 432 | 3300005563 | Ga0068855_100280116 | Ga0068855_1002801162 | 235 |
| 433 | 3300005617 | Ga0068859_100149437 | Ga0068859_1001494372 | 235 |
| 434 | 3300005618 | Ga0068864_100344446 | Ga0068864_1003444462 | 235 |
| 435 | 3300006931 | Ga0097620_100149437 | Ga0097620_1001494372 | 235 |
| 436 | 3300009148 | Ga0105243_10331703 | Ga0105243_103317031 | 235 |
| 437 | 3300009553 | Ga0105249_10146192 | Ga0105249_101461922 | 235 |
| 438 | 3300013105 | Ga0157369_10125063 | Ga0157369_101250631 | 235 |
| 439 | 3300014968 | Ga0157379_10286523 | Ga0157379_102865232 | 235 |
| 440 | 3300020070 | Ga0206356_10998087 | Ga0206356_109980873 | 235 |
| 441 | 3300025907 | Ga0207645_10089388 | Ga0207645_100893882 | 235 |
| 442 | 3300025909 | Ga0207705_10305618 | Ga0207705_103056181 | 235 |
| 443 | 3300025913 | Ga0207695_10377756 | Ga0207695_103777562 | 235 |
| 444 | 3300025914 | Ga0207671_10379959 | Ga0207671_103799591 | 235 |
| 445 | 3300025921 | Ga0207652_10507958 | Ga0207652_105079582 | 235 |
| 446 | 3300025949 | Ga0207667_10067872 | Ga0207667_100678722 | 235 |
| 447 | 3300035111 | Ga0373923_0137666 | Ga0373923_0137666_32_832 | 235 |
| 448 | 3300035120 | Ga0373957_0053941 | Ga0373957_0053941_582_1382 | 235 |
| 449 | 3300035172 | Ga0373955_0163496 | Ga0373955_0163496_497_1297 | 235 |
| 450 | 3300036401 | Ga0373937_0037694 | Ga0373937_0037694_1817_2617 | 235 |
| 451 | 3300048915 | Ga0496112_0020364 | Ga0496112_0020364_192_1022 | 235 |
| 452 | 3300048915 | Ga0496112_0090231 | Ga0496112_0090231_654_1517 | 235 |
| 453 | 3300048916 | Ga0496113_0362424 | Ga0496113_0362424_237_1100 | 235 |
| 454 | 3300005365 | Ga0070688_100056869 | Ga0070688_1000568692 | 236 |
| 455 | 3300028380 | Ga0268265_10550067 | Ga0268265_105500671 | 236 |
| 456 | 3300045976 | Ga0466967_0241150 | Ga0466967_0241150_42_944 | 236 |
| 457 | 3300049578 | Ga0501042_0173769 | Ga0501042_0173769_327_1127 | 236 |
| 458 | 3300049591 | Ga0501075_0380459 | Ga0501075_0380459_181_981 | 236 |
| 459 | 3300049824 | Ga0501045_0291363 | Ga0501045_0291363_254_1054 | 236 |
| 460 | 3300005327 | Ga0070658_10284103 | Ga0070658_102841032 | 237 |
| 461 | 3300005328 | Ga0070676_10055232 | Ga0070676_100552322 | 237 |
| 462 | 3300005328 | Ga0070676_10207265 | Ga0070676_102072651 | 237 |
| 463 | 3300005335 | Ga0070666_10142138 | Ga0070666_101421382 | 237 |
| 464 | 3300005339 | Ga0070660_100258794 | Ga0070660_1002587942 | 237 |
| 465 | 3300005344 | Ga0070661_100015097 | Ga0070661_1000150976 | 237 |
| 466 | 3300005344 | Ga0070661_100073531 | Ga0070661_1000735312 | 237 |
| 467 | 3300005344 | Ga0070661_100138528 | Ga0070661_1001385282 | 237 |
| 468 | 3300005353 | Ga0070669_100227429 | Ga0070669_1002274292 | 237 |
| 469 | 3300005354 | Ga0070675_100174029 | Ga0070675_1001740292 | 237 |
| 470 | 3300005355 | Ga0070671_100010164 | Ga0070671_1000101643 | 237 |
| 471 | 3300005366 | Ga0070659_100004493 | Ga0070659_1000044936 | 237 |
| 472 | 3300005367 | Ga0070667_100087187 | Ga0070667_1000871872 | 237 |
| 473 | 3300005367 | Ga0070667_100245787 | Ga0070667_1002457871 | 237 |
| 474 | 3300005456 | Ga0070678_100480951 | Ga0070678_1004809512 | 237 |
| 475 | 3300005457 | Ga0070662_100000514 | Ga0070662_10000051414 | 237 |
| 476 | 3300005458 | Ga0070681_10302223 | Ga0070681_103022232 | 237 |
| 477 | 3300005471 | Ga0070698_100016516 | Ga0070698_1000165168 | 237 |
| 478 | 3300005539 | Ga0068853_100006454 | Ga0068853_1000064545 | 237 |
| 479 | 3300005539 | Ga0068853_100448099 | Ga0068853_1004480991 | 237 |
| 480 | 3300005543 | Ga0070672_100024607 | Ga0070672_1000246073 | 237 |
| 481 | 3300005563 | Ga0068855_100002141 | Ga0068855_1000021412 | 237 |
| 482 | 3300005564 | Ga0070664_100000603 | Ga0070664_10000060315 | 237 |
| 483 | 3300005564 | Ga0070664_100125443 | Ga0070664_1001254433 | 237 |
| 484 | 3300005578 | Ga0068854_100149633 | Ga0068854_1001496332 | 237 |
| 485 | 3300005614 | Ga0068856_100006811 | Ga0068856_1000068117 | 237 |
| 486 | 3300005616 | Ga0068852_100043121 | Ga0068852_1000431212 | 237 |
| 487 | 3300005841 | Ga0068863_100748589 | Ga0068863_1007485891 | 237 |
| 488 | 3300005841 | Ga0068863_100819936 | Ga0068863_1008199361 | 237 |
| 489 | 3300006175 | Ga0070712_100019900 | Ga0070712_1000199005 | 237 |
| 490 | 3300006237 | Ga0097621_100184539 | Ga0097621_1001845392 | 237 |
| 491 | 3300006358 | Ga0068871_100133841 | Ga0068871_1001338412 | 237 |
| 492 | 3300006844 | Ga0075428_100880926 | Ga0075428_1008809261 | 237 |
| 493 | 3300009545 | Ga0105237_10095861 | Ga0105237_100958612 | 237 |
| 494 | 3300013104 | Ga0157370_10320849 | Ga0157370_103208491 | 237 |
| 495 | 3300013105 | Ga0157369_10076187 | Ga0157369_100761874 | 237 |
| 496 | 3300013297 | Ga0157378_10200853 | Ga0157378_102008532 | 237 |
| 497 | 3300014326 | Ga0157380_10656824 | Ga0157380_106568242 | 237 |
| 498 | 3300025903 | Ga0207680_10046820 | Ga0207680_100468202 | 237 |
| 499 | 3300025907 | Ga0207645_10023878 | Ga0207645_100238783 | 237 |
| 500 | 3300025907 | Ga0207645_10039290 | Ga0207645_100392903 | 237 |
| 501 | 3300025907 | Ga0207645_10270973 | Ga0207645_102709731 | 237 |
| 502 | 3300025909 | Ga0207705_10320243 | Ga0207705_103202432 | 237 |
| 503 | 3300025914 | Ga0207671_10052659 | Ga0207671_100526592 | 237 |
| 504 | 3300025915 | Ga0207693_10017226 | Ga0207693_100172264 | 237 |
| 505 | 3300025919 | Ga0207657_10000838 | Ga0207657_1000083815 | 237 |
| 506 | 3300025919 | Ga0207657_10333476 | Ga0207657_103334762 | 237 |
| 507 | 3300025920 | Ga0207649_10021892 | Ga0207649_100218923 | 237 |
| 508 | 3300025920 | Ga0207649_10045147 | Ga0207649_100451472 | 237 |
| 509 | 3300025926 | Ga0207659_10094727 | Ga0207659_100947272 | 237 |
| 510 | 3300025929 | Ga0207664_10010569 | Ga0207664_100105693 | 237 |
| 511 | 3300025931 | Ga0207644_10060477 | Ga0207644_100604773 | 237 |
| 512 | 3300025932 | Ga0207690_10000802 | Ga0207690_1000080218 | 237 |
| 513 | 3300025932 | Ga0207690_10141935 | Ga0207690_101419351 | 237 |
| 514 | 3300025933 | Ga0207706_10000052 | Ga0207706_1000005269 | 237 |
| 515 | 3300025933 | Ga0207706_10150777 | Ga0207706_101507772 | 237 |
| 516 | 3300025940 | Ga0207691_10028016 | Ga0207691_100280163 | 237 |
| 517 | 3300025945 | Ga0207679_10020060 | Ga0207679_100200602 | 237 |
| 518 | 3300025949 | Ga0207667_10000257 | Ga0207667_100002574 | 237 |
| 519 | 3300025960 | Ga0207651_10069851 | Ga0207651_100698512 | 237 |
| 520 | 3300025960 | Ga0207651_10454584 | Ga0207651_104545841 | 237 |
| 521 | 3300025986 | Ga0207658_10070171 | Ga0207658_100701712 | 237 |
| 522 | 3300026041 | Ga0207639_10011492 | Ga0207639_100114923 | 237 |
| 523 | 3300026067 | Ga0207678_10192050 | Ga0207678_101920502 | 237 |
| 524 | 3300026078 | Ga0207702_10001528 | Ga0207702_1000152814 | 237 |
| 525 | 3300026078 | Ga0207702_10181992 | Ga0207702_101819922 | 237 |
| 526 | 3300026116 | Ga0207674_10057938 | Ga0207674_100579383 | 237 |
| 527 | 3300027665 | Ga0209983_1024780 | Ga0209983_10247802 | 237 |
| 528 | 3300027876 | Ga0209974_10018043 | Ga0209974_100180432 | 237 |
| 529 | 3300028379 | Ga0268266_10244360 | Ga0268266_102443602 | 237 |
| 530 | 3300031548 | Ga0307408_100013930 | Ga0307408_1000139303 | 237 |
| 531 | 3300031731 | Ga0307405_10022171 | Ga0307405_100221712 | 237 |
| 532 | 3300031824 | Ga0307413_10017211 | Ga0307413_100172114 | 237 |
| 533 | 3300031852 | Ga0307410_10001025 | Ga0307410_100010259 | 237 |
| 534 | 3300031901 | Ga0307406_10011580 | Ga0307406_100115803 | 237 |
| 535 | 3300031903 | Ga0307407_10002673 | Ga0307407_100026737 | 237 |
| 536 | 3300031911 | Ga0307412_10027267 | Ga0307412_100272674 | 237 |
| 537 | 3300031995 | Ga0307409_100077893 | Ga0307409_1000778932 | 237 |
| 538 | 3300032002 | Ga0307416_100008111 | Ga0307416_1000081112 | 237 |
| 539 | 3300032004 | Ga0307414_10007478 | Ga0307414_100074784 | 237 |
| 540 | 3300032005 | Ga0307411_10001635 | Ga0307411_100016358 | 237 |
| 541 | 3300032126 | Ga0307415_100009598 | Ga0307415_1000095984 | 237 |
| 542 | 3300035114 | Ga0373939_0038262 | Ga0373939_0038262_248_1099 | 237 |
| 543 | 3300035170 | Ga0373943_0013793 | Ga0373943_0013793_921_1805 | 237 |
| 544 | 3300037068 | Ga0373925_0438822 | Ga0373925_0438822_185_1054 | 237 |
| 545 | 3300048909 | Ga0496106_0027195 | Ga0496106_0027195_3332_4183 | 237 |
| 546 | 3300048913 | Ga0496110_0003478 | Ga0496110_0003478_10006_10857 | 237 |
| 547 | 3300005330 | Ga0070690_100060297 | Ga0070690_1000602972 | 238 |
| 548 | 3300005330 | Ga0070690_100126540 | Ga0070690_1001265402 | 238 |
| 549 | 3300005331 | Ga0070670_100022732 | Ga0070670_1000227321 | 238 |
| 550 | 3300005331 | Ga0070670_100053533 | Ga0070670_1000535332 | 238 |
| 551 | 3300005331 | Ga0070670_100394836 | Ga0070670_1003948361 | 238 |
| 552 | 3300005334 | Ga0068869_100025032 | Ga0068869_1000250324 | 238 |
| 553 | 3300005335 | Ga0070666_10068755 | Ga0070666_100687552 | 238 |
| 554 | 3300005335 | Ga0070666_10085648 | Ga0070666_100856482 | 238 |
| 555 | 3300005338 | Ga0068868_100000774 | Ga0068868_10000077414 | 238 |
| 556 | 3300005338 | Ga0068868_100245656 | Ga0068868_1002456561 | 238 |
| 557 | 3300005340 | Ga0070689_100024846 | Ga0070689_1000248462 | 238 |
| 558 | 3300005343 | Ga0070687_100001561 | Ga0070687_1000015612 | 238 |
| 559 | 3300005347 | Ga0070668_100001676 | Ga0070668_1000016766 | 238 |
| 560 | 3300005347 | Ga0070668_100008748 | Ga0070668_1000087483 | 238 |
| 561 | 3300005347 | Ga0070668_100032153 | Ga0070668_1000321532 | 238 |
| 562 | 3300005353 | Ga0070669_100001056 | Ga0070669_1000010568 | 238 |
| 563 | 3300005354 | Ga0070675_100009354 | Ga0070675_1000093548 | 238 |
| 564 | 3300005354 | Ga0070675_100208989 | Ga0070675_1002089891 | 238 |
| 565 | 3300005354 | Ga0070675_100486603 | Ga0070675_1004866032 | 238 |
| 566 | 3300005355 | Ga0070671_100010609 | Ga0070671_1000106099 | 238 |
| 567 | 3300005355 | Ga0070671_100097929 | Ga0070671_1000979293 | 238 |
| 568 | 3300005356 | Ga0070674_100023151 | Ga0070674_1000231512 | 238 |
| 569 | 3300005356 | Ga0070674_100063712 | Ga0070674_1000637122 | 238 |
| 570 | 3300005356 | Ga0070674_100134875 | Ga0070674_1001348751 | 238 |
| 571 | 3300005364 | Ga0070673_100002518 | Ga0070673_1000025182 | 238 |
| 572 | 3300005365 | Ga0070688_100015810 | Ga0070688_1000158104 | 238 |
| 573 | 3300005367 | Ga0070667_100030206 | Ga0070667_1000302061 | 238 |
| 574 | 3300005441 | Ga0070700_100021682 | Ga0070700_1000216822 | 238 |
| 575 | 3300005456 | Ga0070678_100003815 | Ga0070678_1000038158 | 238 |
| 576 | 3300005457 | Ga0070662_100031526 | Ga0070662_1000315261 | 238 |
| 577 | 3300005459 | Ga0068867_100002175 | Ga0068867_1000021755 | 238 |
| 578 | 3300005459 | Ga0068867_100136723 | Ga0068867_1001367232 | 238 |
| 579 | 3300005459 | Ga0068867_100373023 | Ga0068867_1003730232 | 238 |
| 580 | 3300005459 | Ga0068867_100501901 | Ga0068867_1005019012 | 238 |
| 581 | 3300005543 | Ga0070672_100004277 | Ga0070672_1000042779 | 238 |
| 582 | 3300005543 | Ga0070672_100423683 | Ga0070672_1004236832 | 238 |
| 583 | 3300005544 | Ga0070686_100003848 | Ga0070686_1000038482 | 238 |
| 584 | 3300005548 | Ga0070665_100016809 | Ga0070665_1000168098 | 238 |
| 585 | 3300005548 | Ga0070665_100132605 | Ga0070665_1001326052 | 238 |
| 586 | 3300005548 | Ga0070665_100502904 | Ga0070665_1005029041 | 238 |
| 587 | 3300005563 | Ga0068855_100232327 | Ga0068855_1002323272 | 238 |
| 588 | 3300005563 | Ga0068855_100540155 | Ga0068855_1005401552 | 238 |
| 589 | 3300005617 | Ga0068859_100002241 | Ga0068859_10000224122 | 238 |
| 590 | 3300005618 | Ga0068864_100000221 | Ga0068864_10000022167 | 238 |
| 591 | 3300005618 | Ga0068864_100009639 | Ga0068864_10000963910 | 238 |
| 592 | 3300005618 | Ga0068864_100111849 | Ga0068864_1001118491 | 238 |
| 593 | 3300005718 | Ga0068866_10002966 | Ga0068866_100029662 | 238 |
| 594 | 3300005718 | Ga0068866_10144944 | Ga0068866_101449442 | 238 |
| 595 | 3300005719 | Ga0068861_100046826 | Ga0068861_1000468263 | 238 |
| 596 | 3300005719 | Ga0068861_100297833 | Ga0068861_1002978332 | 238 |
| 597 | 3300005840 | Ga0068870_10354188 | Ga0068870_103541881 | 238 |
| 598 | 3300005841 | Ga0068863_100042055 | Ga0068863_1000420552 | 238 |
| 599 | 3300005841 | Ga0068863_100083587 | Ga0068863_1000835873 | 238 |
| 600 | 3300005841 | Ga0068863_100138251 | Ga0068863_1001382513 | 238 |
| 601 | 3300005841 | Ga0068863_100449999 | Ga0068863_1004499992 | 238 |
| 602 | 3300005842 | Ga0068858_100011271 | Ga0068858_1000112719 | 238 |
| 603 | 3300005842 | Ga0068858_100392942 | Ga0068858_1003929422 | 238 |
| 604 | 3300005843 | Ga0068860_100002991 | Ga0068860_10000299112 | 238 |
| 605 | 3300005843 | Ga0068860_100003223 | Ga0068860_1000032236 | 238 |
| 606 | 3300005843 | Ga0068860_100009595 | Ga0068860_1000095952 | 238 |
| 607 | 3300005844 | Ga0068862_100279792 | Ga0068862_1002797922 | 238 |
| 608 | 3300006237 | Ga0097621_100039465 | Ga0097621_1000394653 | 238 |
| 609 | 3300006237 | Ga0097621_100044014 | Ga0097621_1000440144 | 238 |
| 610 | 3300006358 | Ga0068871_100007334 | Ga0068871_1000073348 | 238 |
| 611 | 3300006358 | Ga0068871_100068352 | Ga0068871_1000683522 | 238 |
| 612 | 3300006881 | Ga0068865_100051841 | Ga0068865_1000518412 | 238 |
| 613 | 3300006881 | Ga0068865_100072564 | Ga0068865_1000725642 | 238 |
| 614 | 3300006931 | Ga0097620_100002241 | Ga0097620_10000224122 | 238 |
| 615 | 3300009148 | Ga0105243_10223486 | Ga0105243_102234861 | 238 |
| 616 | 3300009177 | Ga0105248_10084067 | Ga0105248_100840673 | 238 |
| 617 | 3300009177 | Ga0105248_10130372 | Ga0105248_101303723 | 238 |
| 618 | 3300009553 | Ga0105249_10309883 | Ga0105249_103098832 | 238 |
| 619 | 3300013102 | Ga0157371_10214942 | Ga0157371_102149422 | 238 |
| 620 | 3300013296 | Ga0157374_10000346 | Ga0157374_1000034628 | 238 |
| 621 | 3300013297 | Ga0157378_10430777 | Ga0157378_104307772 | 238 |
| 622 | 3300013306 | Ga0163162_10012637 | Ga0163162_100126372 | 238 |
| 623 | 3300013308 | Ga0157375_10028302 | Ga0157375_100283024 | 238 |
| 624 | 3300013308 | Ga0157375_10071036 | Ga0157375_100710364 | 238 |
| 625 | 3300013308 | Ga0157375_10423734 | Ga0157375_104237342 | 238 |
| 626 | 3300014325 | Ga0163163_10252072 | Ga0163163_102520722 | 238 |
| 627 | 3300014326 | Ga0157380_10232326 | Ga0157380_102323262 | 238 |
| 628 | 3300014968 | Ga0157379_10006330 | Ga0157379_100063302 | 238 |
| 629 | 3300014968 | Ga0157379_10050077 | Ga0157379_100500774 | 238 |
| 630 | 3300014968 | Ga0157379_10192171 | Ga0157379_101921712 | 238 |
| 631 | 3300014969 | Ga0157376_10126952 | Ga0157376_101269523 | 238 |
| 632 | 3300025315 | Ga0207697_10012830 | Ga0207697_100128302 | 238 |
| 633 | 3300025899 | Ga0207642_10019101 | Ga0207642_100191011 | 238 |
| 634 | 3300025899 | Ga0207642_10118967 | Ga0207642_101189672 | 238 |
| 635 | 3300025903 | Ga0207680_10042020 | Ga0207680_100420203 | 238 |
| 636 | 3300025903 | Ga0207680_10053505 | Ga0207680_100535052 | 238 |
| 637 | 3300025907 | Ga0207645_10000353 | Ga0207645_100003532 | 238 |
| 638 | 3300025918 | Ga0207662_10003213 | Ga0207662_100032132 | 238 |
| 639 | 3300025919 | Ga0207657_10001142 | Ga0207657_1000114210 | 238 |
| 640 | 3300025919 | Ga0207657_10024869 | Ga0207657_100248696 | 238 |
| 641 | 3300025923 | Ga0207681_10001804 | Ga0207681_1000180415 | 238 |
| 642 | 3300025925 | Ga0207650_10012394 | Ga0207650_100123945 | 238 |
| 643 | 3300025925 | Ga0207650_10030171 | Ga0207650_100301712 | 238 |
| 644 | 3300025925 | Ga0207650_10142504 | Ga0207650_101425042 | 238 |
| 645 | 3300025926 | Ga0207659_10029974 | Ga0207659_100299744 | 238 |
| 646 | 3300025926 | Ga0207659_10152880 | Ga0207659_101528802 | 238 |
| 647 | 3300025931 | Ga0207644_10015731 | Ga0207644_100157312 | 238 |
| 648 | 3300025931 | Ga0207644_10099000 | Ga0207644_100990001 | 238 |
| 649 | 3300025935 | Ga0207709_10225641 | Ga0207709_102256412 | 238 |
| 650 | 3300025936 | Ga0207670_10146943 | Ga0207670_101469432 | 238 |
| 651 | 3300025937 | Ga0207669_10084951 | Ga0207669_100849512 | 238 |
| 652 | 3300025937 | Ga0207669_10238061 | Ga0207669_102380611 | 238 |
| 653 | 3300025938 | Ga0207704_10019940 | Ga0207704_100199402 | 238 |
| 654 | 3300025940 | Ga0207691_10007196 | Ga0207691_100071968 | 238 |
| 655 | 3300025940 | Ga0207691_10010390 | Ga0207691_100103908 | 238 |
| 656 | 3300025940 | Ga0207691_10012433 | Ga0207691_100124332 | 238 |
| 657 | 3300025941 | Ga0207711_10043796 | Ga0207711_100437964 | 238 |
| 658 | 3300025941 | Ga0207711_10087248 | Ga0207711_100872483 | 238 |
| 659 | 3300025941 | Ga0207711_10163969 | Ga0207711_101639692 | 238 |
| 660 | 3300025960 | Ga0207651_10201751 | Ga0207651_102017512 | 238 |
| 661 | 3300025960 | Ga0207651_10434216 | Ga0207651_104342161 | 238 |
| 662 | 3300025961 | Ga0207712_10102483 | Ga0207712_101024832 | 238 |
| 663 | 3300025972 | Ga0207668_10010200 | Ga0207668_100102002 | 238 |
| 664 | 3300025972 | Ga0207668_10093761 | Ga0207668_100937612 | 238 |
| 665 | 3300025986 | Ga0207658_10084275 | Ga0207658_100842752 | 238 |
| 666 | 3300025986 | Ga0207658_10106416 | Ga0207658_101064162 | 238 |
| 667 | 3300026023 | Ga0207677_10003049 | Ga0207677_100030498 | 238 |
| 668 | 3300026035 | Ga0207703_10200916 | Ga0207703_102009162 | 238 |
| 669 | 3300026041 | Ga0207639_10567850 | Ga0207639_105678501 | 238 |
| 670 | 3300026075 | Ga0207708_10001876 | Ga0207708_1000187616 | 238 |
| 671 | 3300026088 | Ga0207641_10013789 | Ga0207641_100137898 | 238 |
| 672 | 3300026089 | Ga0207648_10000306 | Ga0207648_1000030634 | 238 |
| 673 | 3300026089 | Ga0207648_10000415 | Ga0207648_1000041512 | 238 |
| 674 | 3300026089 | Ga0207648_10487201 | Ga0207648_104872012 | 238 |
| 675 | 3300026095 | Ga0207676_10019358 | Ga0207676_100193584 | 238 |
| 676 | 3300026095 | Ga0207676_10055696 | Ga0207676_100556962 | 238 |
| 677 | 3300026095 | Ga0207676_10123779 | Ga0207676_101237792 | 238 |
| 678 | 3300026118 | Ga0207675_100190804 | Ga0207675_1001908042 | 238 |
| 679 | 3300026118 | Ga0207675_100307472 | Ga0207675_1003074722 | 238 |
| 680 | 3300026121 | Ga0207683_10000661 | Ga0207683_100006612 | 238 |
| 681 | 3300026121 | Ga0207683_10016177 | Ga0207683_100161774 | 238 |
| 682 | 3300027682 | Ga0209971_1002855 | Ga0209971_10028554 | 238 |
| 683 | 3300028379 | Ga0268266_10052156 | Ga0268266_100521563 | 238 |
| 684 | 3300028379 | Ga0268266_10254006 | Ga0268266_102540062 | 238 |
| 685 | 3300028380 | Ga0268265_10013552 | Ga0268265_100135527 | 238 |
| 686 | 3300028380 | Ga0268265_10128036 | Ga0268265_101280362 | 238 |
| 687 | 3300028381 | Ga0268264_10002914 | Ga0268264_100029148 | 238 |
| 688 | 3300028381 | Ga0268264_10021523 | Ga0268264_100215233 | 238 |
| 689 | 3300035724 | Ga0373933_0040116 | Ga0373933_0040116_176_976 | 238 |
| 690 | 3300037418 | Ga0395900_0494649 | Ga0395900_0494649_290_1120 | 238 |
| 691 | 3300038443 | Ga0395901_0045268 | Ga0395901_0045268_1177_2007 | 238 |
| 692 | 3300041512 | Ga0451853_1018540 | Ga0451853_1018540_60_878 | 238 |
| 693 | 3300048903 | Ga0496100_0385492 | Ga0496100_0385492_40_840 | 238 |
| 694 | 3300048908 | Ga0496105_0171595 | Ga0496105_0171595_800_1615 | 238 |
| 695 | 3300048912 | Ga0496109_0161442 | Ga0496109_0161442_857_1675 | 238 |
| 696 | 3300048913 | Ga0496110_0052969 | Ga0496110_0052969_587_1402 | 238 |
| 697 | 3300048916 | Ga0496113_0462969 | Ga0496113_0462969_13_831 | 238 |
| 698 | 3300048917 | Ga0496114_0065480 | Ga0496114_0065480_336_1151 | 238 |
| 699 | 3300005327 | Ga0070658_10009827 | Ga0070658_100098278 | 239 |
| 700 | 3300005329 | Ga0070683_100031286 | Ga0070683_1000312863 | 239 |
| 701 | 3300005329 | Ga0070683_100036305 | Ga0070683_1000363052 | 239 |
| 702 | 3300005329 | Ga0070683_100494874 | Ga0070683_1004948741 | 239 |
| 703 | 3300005331 | Ga0070670_100024174 | Ga0070670_1000241744 | 239 |
| 704 | 3300005333 | Ga0070677_10006409 | Ga0070677_100064093 | 239 |
| 705 | 3300005334 | Ga0068869_100008302 | Ga0068869_1000083025 | 239 |
| 706 | 3300005338 | Ga0068868_100027999 | Ga0068868_1000279992 | 239 |
| 707 | 3300005339 | Ga0070660_100007823 | Ga0070660_1000078238 | 239 |
| 708 | 3300005344 | Ga0070661_100029753 | Ga0070661_1000297533 | 239 |
| 709 | 3300005354 | Ga0070675_100089321 | Ga0070675_1000893213 | 239 |
| 710 | 3300005354 | Ga0070675_100127743 | Ga0070675_1001277432 | 239 |
| 711 | 3300005366 | Ga0070659_100194963 | Ga0070659_1001949632 | 239 |
| 712 | 3300005435 | Ga0070714_100340993 | Ga0070714_1003409932 | 239 |
| 713 | 3300005455 | Ga0070663_100008052 | Ga0070663_1000080524 | 239 |
| 714 | 3300005457 | Ga0070662_100056698 | Ga0070662_1000566983 | 239 |
| 715 | 3300005458 | Ga0070681_10007078 | Ga0070681_100070786 | 239 |
| 716 | 3300005466 | Ga0070685_10004300 | Ga0070685_100043004 | 239 |
| 717 | 3300005535 | Ga0070684_100153991 | Ga0070684_1001539912 | 239 |
| 718 | 3300005546 | Ga0070696_100060402 | Ga0070696_1000604021 | 239 |
| 719 | 3300005547 | Ga0070693_100268951 | Ga0070693_1002689511 | 239 |
| 720 | 3300005548 | Ga0070665_100073634 | Ga0070665_1000736342 | 239 |
| 721 | 3300005563 | Ga0068855_100055069 | Ga0068855_1000550693 | 239 |
| 722 | 3300005563 | Ga0068855_100168104 | Ga0068855_1001681042 | 239 |
| 723 | 3300005563 | Ga0068855_100318761 | Ga0068855_1003187612 | 239 |
| 724 | 3300005564 | Ga0070664_100019423 | Ga0070664_1000194234 | 239 |
| 725 | 3300005577 | Ga0068857_100043571 | Ga0068857_1000435712 | 239 |
| 726 | 3300005578 | Ga0068854_100097481 | Ga0068854_1000974812 | 239 |
| 727 | 3300005615 | Ga0070702_100014400 | Ga0070702_1000144004 | 239 |
| 728 | 3300005616 | Ga0068852_100004904 | Ga0068852_1000049046 | 239 |
| 729 | 3300005617 | Ga0068859_100653473 | Ga0068859_1006534732 | 239 |
| 730 | 3300005618 | Ga0068864_100037672 | Ga0068864_1000376722 | 239 |
| 731 | 3300005618 | Ga0068864_100050789 | Ga0068864_1000507893 | 239 |
| 732 | 3300005719 | Ga0068861_100114407 | Ga0068861_1001144072 | 239 |
| 733 | 3300005834 | Ga0068851_10002987 | Ga0068851_100029877 | 239 |
| 734 | 3300005840 | Ga0068870_10001530 | Ga0068870_100015308 | 239 |
| 735 | 3300005842 | Ga0068858_100070407 | Ga0068858_1000704072 | 239 |
| 736 | 3300005843 | Ga0068860_100038199 | Ga0068860_1000381992 | 239 |
| 737 | 3300006881 | Ga0068865_100019734 | Ga0068865_1000197343 | 239 |
| 738 | 3300006931 | Ga0097620_100653476 | Ga0097620_1006534762 | 239 |
| 739 | 3300009093 | Ga0105240_10079605 | Ga0105240_100796052 | 239 |
| 740 | 3300009094 | Ga0111539_10013935 | Ga0111539_100139358 | 239 |
| 741 | 3300009174 | Ga0105241_10154028 | Ga0105241_101540282 | 239 |
| 742 | 3300009176 | Ga0105242_10067456 | Ga0105242_100674563 | 239 |
| 743 | 3300010375 | Ga0105239_10116379 | Ga0105239_101163792 | 239 |
| 744 | 3300013104 | Ga0157370_10019529 | Ga0157370_100195293 | 239 |
| 745 | 3300013104 | Ga0157370_10028265 | Ga0157370_100282653 | 239 |
| 746 | 3300013105 | Ga0157369_10020274 | Ga0157369_100202745 | 239 |
| 747 | 3300013307 | Ga0157372_10124136 | Ga0157372_101241362 | 239 |
| 748 | 3300014326 | Ga0157380_10170274 | Ga0157380_101702742 | 239 |
| 749 | 3300014745 | Ga0157377_10019007 | Ga0157377_100190074 | 239 |
| 750 | 3300014968 | Ga0157379_10029616 | Ga0157379_100296163 | 239 |
| 751 | 3300017792 | Ga0163161_10008971 | Ga0163161_100089713 | 239 |
| 752 | 3300025315 | Ga0207697_10000020 | Ga0207697_1000002051 | 239 |
| 753 | 3300025321 | Ga0207656_10004889 | Ga0207656_100048892 | 239 |
| 754 | 3300025893 | Ga0207682_10000288 | Ga0207682_100002881 | 239 |
| 755 | 3300025904 | Ga0207647_10077221 | Ga0207647_100772212 | 239 |
| 756 | 3300025907 | Ga0207645_10004764 | Ga0207645_100047644 | 239 |
| 757 | 3300025908 | Ga0207643_10000131 | Ga0207643_100001318 | 239 |
| 758 | 3300025909 | Ga0207705_10193168 | Ga0207705_101931682 | 239 |
| 759 | 3300025912 | Ga0207707_10022803 | Ga0207707_100228035 | 239 |
| 760 | 3300025919 | Ga0207657_10014488 | Ga0207657_100144888 | 239 |
| 761 | 3300025921 | Ga0207652_10031346 | Ga0207652_100313462 | 239 |
| 762 | 3300025925 | Ga0207650_10002600 | Ga0207650_100026002 | 239 |
| 763 | 3300025925 | Ga0207650_10279858 | Ga0207650_102798582 | 239 |
| 764 | 3300025926 | Ga0207659_10006674 | Ga0207659_100066748 | 239 |
| 765 | 3300025932 | Ga0207690_10044895 | Ga0207690_100448952 | 239 |
| 766 | 3300025933 | Ga0207706_10002570 | Ga0207706_100025708 | 239 |
| 767 | 3300025936 | Ga0207670_10009886 | Ga0207670_100098866 | 239 |
| 768 | 3300025942 | Ga0207689_10000091 | Ga0207689_1000009138 | 239 |
| 769 | 3300025942 | Ga0207689_10357700 | Ga0207689_103577002 | 239 |
| 770 | 3300025949 | Ga0207667_10180698 | Ga0207667_101806982 | 239 |
| 771 | 3300025949 | Ga0207667_10212173 | Ga0207667_102121731 | 239 |
| 772 | 3300025949 | Ga0207667_10229175 | Ga0207667_102291752 | 239 |
| 773 | 3300025986 | Ga0207658_10015481 | Ga0207658_100154813 | 239 |
| 774 | 3300026035 | Ga0207703_10078779 | Ga0207703_100787792 | 239 |
| 775 | 3300026067 | Ga0207678_10000257 | Ga0207678_1000025733 | 239 |
| 776 | 3300026067 | Ga0207678_10121935 | Ga0207678_101219352 | 239 |
| 777 | 3300026078 | Ga0207702_10012902 | Ga0207702_100129027 | 239 |
| 778 | 3300026088 | Ga0207641_10076457 | Ga0207641_100764572 | 239 |
| 779 | 3300026095 | Ga0207676_10032258 | Ga0207676_100322582 | 239 |
| 780 | 3300026116 | Ga0207674_10011959 | Ga0207674_100119597 | 239 |
| 781 | 3300026116 | Ga0207674_10116219 | Ga0207674_101162193 | 239 |
| 782 | 3300026118 | Ga0207675_100002299 | Ga0207675_10000229911 | 239 |
| 783 | 3300026142 | Ga0207698_10114013 | Ga0207698_101140132 | 239 |
| 784 | 3300036401 | Ga0373937_0134579 | Ga0373937_0134579_1252_2115 | 239 |
| 785 | 3300046539 | Ga0495621_0001838 | Ga0495621_0001838_2297_3148 | 239 |
| 786 | 3300048903 | Ga0496100_0025850 | Ga0496100_0025850_2664_3515 | 239 |
| 787 | 3300048904 | Ga0496101_0125400 | Ga0496101_0125400_64_915 | 239 |
| 788 | 3300048905 | Ga0496102_0095244 | Ga0496102_0095244_1779_2615 | 239 |
| 789 | 3300048907 | Ga0496104_0003498 | Ga0496104_0003498_2284_3135 | 239 |
| 790 | 3300048910 | Ga0496107_0183841 | Ga0496107_0183841_365_1216 | 239 |
| 791 | 3300048911 | Ga0496108_0014945 | Ga0496108_0014945_3406_4257 | 239 |
| 792 | 3300048912 | Ga0496109_0004927 | Ga0496109_0004927_9316_10167 | 239 |
| 793 | 3300048917 | Ga0496114_0020599 | Ga0496114_0020599_1898_2749 | 239 |
| 794 | 3300050511 | nmdc:mga08y16_25446_c1 | nmdc:mga08y16_25446_c1_3325_4176 | 239 |
| 795 | 3300053084 | Ga0495595_0026173 | Ga0495595_0026173_260_1123 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gv1-assembly1.cif.gz_A | crystal structure of disulfide interchange protein from neisseria gonorrhoeae | 0.9326 | 91 | 227 |
| 3gv1-assembly1.cif.gz_A | crystal structure of disulfide interchange protein from neisseria gonorrhoeae | 0.9075 | 91 | 227 |
| 4n30-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa dsba2 | 0.7779 | 98 | 226 |
| 7x36-assembly1.cif.gz_B | crystal structure of hetero-diels-alderase eupff | 0.7461 | 29 | 63 |
| 1z6m-assembly1.cif.gz_A | structure of conserved protein of unknown function from enterococcus faecalis v583 | 0.74 | 84 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gv1A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9257 | 93 | 227 | 3.40.30.10 |
| 3gv1A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8931 | 93 | 227 | 3.40.30.10 |
| 4npbB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8395 | 97 | 226 | 3.40.30.10 |
| 4npbB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7985 | 97 | 226 | 3.40.30.10 |
| 4mlyA02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7842 | 97 | 225 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S9NJ89-F1-model_v4 | Thiol:disulfide interchange protein | 0.9802 | 92 | 164 |
GO:0042597
|
| AF-A0A1S8CT32-F1-model_v4 | Thiol:disulfide interchange protein | 0.9711 | 86 | 224 |
GO:0042597
|
| AF-A0A3P3ZP77-F1-model_v4 | Putative thiol:disulfide interchange protein DsbC | 0.9624 | 97 | 224 |
|
| AF-A0A109DZH5-F1-model_v4 | deleted | 0.9623 | 94 | 225 |
|
| AF-A0A7Y4SAH2-F1-model_v4 | Thiol:disulfide interchange protein | 0.9605 | 81 | 227 |
GO:0042597
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar