F481142

General Info

Members Datasets Scaffolds Average Seq Length
795 259 795 258

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0134579|Ga0373937_0134579_1252_2115
Length 287
Sequence VEKDIMHPIPVVKSRRPLRALTVGLAALMCVSPLAFAQAGGKPGGASAQPATATSAQPASPEIAGIRKSLEAKFPGADIKHIAKTDYLGLYEVMLDDNLVYTDPKVAYIFVGALYDTATKQNLTDARTRRLNRVALDKLPYELAFKRVKGDGSRKLVLFSDADCPFCHRLETELKGLDNVTIYTFLFPIDQLHPDAARKSKQIWCAPDKVKAWDEFFASGKVPDNKGDCGDPVAKTQALGNSLKINATPTLVFADGTMIPGALPLPQLEKEMATAEIEARKIAAAPK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.16
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009827 3300005327 Bacteria 7687
2 Ga0070658_10030463 3300005327 Bacteria 4334
3 Ga0070658_10284103 3300005327 Bacteria 1409
4 Ga0070676_10055232 3300005328 Bacteria 2343
5 Ga0070676_10066188 3300005328 Bacteria 2159
6 Ga0070676_10091947 3300005328 Bacteria 1860
7 Ga0070676_10207265 3300005328 Bacteria 1288
8 Ga0070683_100007878 3300005329 Bacteria 9026
9 Ga0070683_100031286 3300005329 Bacteria 4838
10 Ga0070683_100036305 3300005329 Bacteria 4509
11 Ga0070683_100084263 3300005329 Bacteria 2978
12 Ga0070683_100494874 3300005329 Bacteria 1168
13 Ga0070690_100003383 3300005330 Bacteria 8712
14 Ga0070690_100060297 3300005330 Bacteria 2441
15 Ga0070690_100077990 3300005330 Bacteria 2164
16 Ga0070690_100126540 3300005330 Bacteria 1721
17 Ga0070670_100006016 3300005331 Bacteria 10260
18 Ga0070670_100011869 3300005331 Bacteria 7450
19 Ga0070670_100022732 3300005331 Bacteria 5395
20 Ga0070670_100024174 3300005331 Bacteria 5228
21 Ga0070670_100053533 3300005331 Bacteria 3466
22 Ga0070670_100394836 3300005331 Bacteria 1220
23 Ga0070677_10006409 3300005333 Bacteria 3909
24 Ga0068869_100002165 3300005334 Bacteria 11817
25 Ga0068869_100008302 3300005334 Bacteria 6689
26 Ga0068869_100010630 3300005334 Bacteria 6007
27 Ga0068869_100025032 3300005334 Bacteria 4140
28 Ga0068869_100106314 3300005334 Bacteria 2129
29 Ga0068869_100293763 3300005334 Bacteria 1310
30 Ga0070666_10068755 3300005335 Bacteria 2407
31 Ga0070666_10085648 3300005335 Unclassified 2158
32 Ga0070666_10089480 3300005335 Bacteria 2113
33 Ga0070666_10142138 3300005335 Bacteria 1672
34 Ga0070680_100078176 3300005336 Bacteria 2725
35 Ga0070680_100125440 3300005336 Bacteria 2145
36 Ga0070682_100068279 3300005337 Bacteria 2267
37 Ga0068868_100000774 3300005338 Bacteria 21630
38 Ga0068868_100025470 3300005338 Bacteria 4500
39 Ga0068868_100027999 3300005338 Bacteria 4303
40 Ga0068868_100150233 3300005338 Bacteria 1918
41 Ga0068868_100245656 3300005338 Bacteria 1505
42 Ga0070660_100007823 3300005339 Bacteria 7454
43 Ga0070660_100030182 3300005339 Bacteria 4066
44 Ga0070660_100044893 3300005339 Bacteria 3381
45 Ga0070660_100087563 3300005339 Bacteria 2451
46 Ga0070660_100096973 3300005339 Bacteria 2332
47 Ga0070660_100167942 3300005339 Bacteria 1771
48 Ga0070660_100258794 3300005339 Bacteria 1421
49 Ga0070689_100001808 3300005340 Bacteria 13750
50 Ga0070689_100024846 3300005340 Bacteria 4498
51 Ga0070689_100080408 3300005340 Bacteria 2557
52 Ga0070689_100084407 3300005340 Bacteria 2496
53 Ga0070691_10078918 3300005341 Bacteria 1608
54 Ga0070691_10085439 3300005341 Bacteria 1550
55 Ga0070687_100001561 3300005343 Bacteria 8134
56 Ga0070687_100007131 3300005343 Bacteria 4633
57 Ga0070661_100001548 3300005344 Bacteria 15981
58 Ga0070661_100015097 3300005344 Bacteria 5449
59 Ga0070661_100022392 3300005344 Bacteria 4524
60 Ga0070661_100029753 3300005344 Bacteria 3943
61 Ga0070661_100033672 3300005344 Bacteria 3712
62 Ga0070661_100073531 3300005344 Bacteria 2517
63 Ga0070661_100138528 3300005344 Bacteria 1832
64 Ga0070668_100001676 3300005347 Bacteria 16053
65 Ga0070668_100008748 3300005347 Bacteria 7521
66 Ga0070668_100032153 3300005347 Bacteria 3993
67 Ga0070668_100204128 3300005347 Bacteria 1623
68 Ga0070668_100379566 3300005347 Bacteria 1202
69 Ga0070669_100001056 3300005353 Bacteria 20146
70 Ga0070669_100195686 3300005353 Bacteria 1588
71 Ga0070669_100227429 3300005353 Bacteria 1477
72 Ga0070669_100340996 3300005353 Bacteria 1214
73 Ga0070675_100007513 3300005354 Bacteria 8422
74 Ga0070675_100009354 3300005354 Bacteria 7622
75 Ga0070675_100089321 3300005354 Bacteria 2580
76 Ga0070675_100127743 3300005354 Bacteria 2164
77 Ga0070675_100174029 3300005354 Bacteria 1858
78 Ga0070675_100208989 3300005354 Bacteria 1696
79 Ga0070675_100486603 3300005354 Unclassified 1110
80 Ga0070671_100004251 3300005355 Bacteria 11332
81 Ga0070671_100010164 3300005355 Bacteria 7553
82 Ga0070671_100010609 3300005355 Bacteria 7397
83 Ga0070671_100041804 3300005355 Bacteria 3809
84 Ga0070671_100097929 3300005355 Bacteria 2460
85 Ga0070674_100023151 3300005356 Bacteria 4015
86 Ga0070674_100063712 3300005356 Bacteria 2581
87 Ga0070674_100066301 3300005356 Bacteria 2536
88 Ga0070674_100077228 3300005356 Bacteria 2370
89 Ga0070674_100134875 3300005356 Bacteria 1845
90 Ga0070673_100002518 3300005364 Bacteria 11189
91 Ga0070673_100004580 3300005364 Bacteria 8764
92 Ga0070673_100026489 3300005364 Bacteria 4283
93 Ga0070673_100027621 3300005364 Bacteria 4209
94 Ga0070673_100035130 3300005364 Bacteria 3798
95 Ga0070673_100284403 3300005364 Bacteria 1451
96 Ga0070673_100338072 3300005364 Bacteria 1334
97 Ga0070688_100001156 3300005365 Bacteria 13175
98 Ga0070688_100015810 3300005365 Bacteria 4301
99 Ga0070688_100056869 3300005365 Bacteria 2457
100 Ga0070659_100001467 3300005366 Bacteria 16988
101 Ga0070659_100003884 3300005366 Bacteria 10646
102 Ga0070659_100004493 3300005366 Bacteria 9963
103 Ga0070659_100194963 3300005366 Bacteria 1666
104 Ga0070659_100252064 3300005366 Bacteria 1463
105 Ga0070667_100030206 3300005367 Bacteria 4519
106 Ga0070667_100032230 3300005367 Bacteria 4371
107 Ga0070667_100087187 3300005367 Bacteria 2679
108 Ga0070667_100245787 3300005367 Bacteria 1599
109 Ga0070709_10050520 3300005434 Bacteria 2606
110 Ga0070709_10135747 3300005434 Bacteria 1685
111 Ga0070709_10154229 3300005434 Bacteria 1590
112 Ga0070709_10265460 3300005434 Bacteria 1242
113 Ga0070714_100012896 3300005435 Bacteria 6682
114 Ga0070714_100340993 3300005435 Bacteria 1406
115 Ga0070714_100561651 3300005435 Bacteria 1093
116 Ga0070713_100004189 3300005436 Bacteria 9623
117 Ga0070713_100015240 3300005436 Bacteria 5735
118 Ga0070713_100295283 3300005436 Bacteria 1490
119 Ga0070711_100008712 3300005439 Bacteria 6224
120 Ga0070711_100385820 3300005439 Bacteria 1134
121 Ga0070711_100489154 3300005439 Bacteria 1013
122 Ga0070700_100021682 3300005441 Bacteria 3737
123 Ga0070708_100106282 3300005445 Bacteria 2576
124 Ga0070663_100008052 3300005455 Bacteria 6463
125 Ga0070663_100084983 3300005455 Bacteria 2334
126 Ga0070663_100250141 3300005455 Bacteria 1402
127 Ga0070663_100257205 3300005455 Bacteria 1384
128 Ga0070678_100003815 3300005456 Bacteria 8455
129 Ga0070678_100009548 3300005456 Bacteria 5884
130 Ga0070678_100324932 3300005456 Bacteria 1315
131 Ga0070678_100480951 3300005456 Bacteria 1093
132 Ga0070662_100000514 3300005457 Bacteria 23259
133 Ga0070662_100001751 3300005457 Bacteria 13369
134 Ga0070662_100031526 3300005457 Bacteria 3721
135 Ga0070662_100056698 3300005457 Bacteria 2845
136 Ga0070681_10007078 3300005458 Bacteria 10921
137 Ga0070681_10041982 3300005458 Bacteria 4584
138 Ga0070681_10302223 3300005458 Bacteria 1510
139 Ga0068867_100002175 3300005459 Bacteria 13763
140 Ga0068867_100136723 3300005459 Bacteria 1911
141 Ga0068867_100223386 3300005459 Bacteria 1519
142 Ga0068867_100373023 3300005459 Bacteria 1197
143 Ga0068867_100501901 3300005459 Bacteria 1043
144 Ga0070685_10002325 3300005466 Bacteria 9797
145 Ga0070685_10004300 3300005466 Bacteria 7190
146 Ga0070706_100014830 3300005467 Bacteria 7203
147 Ga0070707_100027782 3300005468 Bacteria 5383
148 Ga0070707_100052046 3300005468 Bacteria 3925
149 Ga0070698_100016516 3300005471 Bacteria 7788
150 Ga0070698_100103814 3300005471 Bacteria 2812
151 Ga0070698_100532084 3300005471 Bacteria 1114
152 Ga0070699_100126402 3300005518 Bacteria 2251
153 Ga0070699_100807487 3300005518 Bacteria 858
154 Ga0070679_100130273 3300005530 Bacteria 2496
155 Ga0070684_100003343 3300005535 Bacteria 12011
156 Ga0070684_100025170 3300005535 Bacteria 5000
157 Ga0070684_100153991 3300005535 Bacteria 2084
158 Ga0070684_100186839 3300005535 Bacteria 1885
159 Ga0070697_100012939 3300005536 Bacteria 6538
160 Ga0070697_100127368 3300005536 Bacteria 2133
161 Ga0068853_100005058 3300005539 Bacteria 10289
162 Ga0068853_100006454 3300005539 Bacteria 9326
163 Ga0068853_100025368 3300005539 Bacteria 4973
164 Ga0068853_100226132 3300005539 Bacteria 1710
165 Ga0068853_100288594 3300005539 Bacteria 1514
166 Ga0068853_100448099 3300005539 Bacteria 1214
167 Ga0068853_100764847 3300005539 Bacteria 924
168 Ga0070672_100004277 3300005543 Bacteria 9333
169 Ga0070672_100007539 3300005543 Bacteria 7392
170 Ga0070672_100024607 3300005543 Bacteria 4453
171 Ga0070672_100037494 3300005543 Bacteria 3699
172 Ga0070672_100045986 3300005543 Bacteria 3380
173 Ga0070672_100423683 3300005543 Bacteria 1143
174 Ga0070686_100003848 3300005544 Bacteria 8258
175 Ga0070686_100062993 3300005544 Bacteria 2401
176 Ga0070695_100088738 3300005545 Bacteria 2060
177 Ga0070695_100441127 3300005545 Unclassified 995
178 Ga0070696_100060402 3300005546 Bacteria 2651
179 Ga0070693_100003077 3300005547 Bacteria 7741
180 Ga0070693_100268951 3300005547 Bacteria 1137
181 Ga0070693_100366083 3300005547 Bacteria 990
182 Ga0070665_100010753 3300005548 Bacteria 9259
183 Ga0070665_100016809 3300005548 Bacteria 7335
184 Ga0070665_100073634 3300005548 Bacteria 3421
185 Ga0070665_100132605 3300005548 Bacteria 2493
186 Ga0070665_100502904 3300005548 Bacteria 1223
187 Ga0070704_100012983 3300005549 Bacteria 5154
188 Ga0070704_100028431 3300005549 Bacteria 3719
189 Ga0070704_100350105 3300005549 Bacteria 1247
190 Ga0068855_100002141 3300005563 Bacteria 24434
191 Ga0068855_100007236 3300005563 Bacteria 13458
192 Ga0068855_100055069 3300005563 Bacteria 4673
193 Ga0068855_100168104 3300005563 Bacteria 2485
194 Ga0068855_100232327 3300005563 Bacteria 2064
195 Ga0068855_100280116 3300005563 Bacteria 1852
196 Ga0068855_100318761 3300005563 Bacteria 1719
197 Ga0068855_100540155 3300005563 Bacteria 1263
198 Ga0068855_100690281 3300005563 Bacteria 1093
199 Ga0070664_100000603 3300005564 Bacteria 27498
200 Ga0070664_100010118 3300005564 Bacteria 7645
201 Ga0070664_100019423 3300005564 Bacteria 5591
202 Ga0070664_100039826 3300005564 Bacteria 3961
203 Ga0070664_100125443 3300005564 Bacteria 2251
204 Ga0070664_100157090 3300005564 Bacteria 2010
205 Ga0068857_100000165 3300005577 Bacteria 41423
206 Ga0068857_100010811 3300005577 Bacteria 7946
207 Ga0068857_100043571 3300005577 Bacteria 3980
208 Ga0068854_100001226 3300005578 Bacteria 15394
209 Ga0068854_100002702 3300005578 Bacteria 10993
210 Ga0068854_100097481 3300005578 Bacteria 2198
211 Ga0068854_100149633 3300005578 Bacteria 1799
212 Ga0068856_100000375 3300005614 Bacteria 49163
213 Ga0068856_100006811 3300005614 Bacteria 11183
214 Ga0068856_100054107 3300005614 Bacteria 3958
215 Ga0068856_100259851 3300005614 Unclassified 1752
216 Ga0070702_100014400 3300005615 Bacteria 4011
217 Ga0070702_100056723 3300005615 Bacteria 2263
218 Ga0068852_100000473 3300005616 Bacteria 26391
219 Ga0068852_100004904 3300005616 Bacteria 9502
220 Ga0068852_100009159 3300005616 Bacteria 7332
221 Ga0068852_100043121 3300005616 Bacteria 3825
222 Ga0068859_100000538 3300005617 Bacteria 37506
223 Ga0068859_100002241 3300005617 Bacteria 19618
224 Ga0068859_100102571 3300005617 Bacteria 2918
225 Ga0068859_100149437 3300005617 Bacteria 2412
226 Ga0068859_100187599 3300005617 Bacteria 2152
227 Ga0068859_100653473 3300005617 Bacteria 1143
228 Ga0068864_100000221 3300005618 Bacteria 51532
229 Ga0068864_100000566 3300005618 Bacteria 31533
230 Ga0068864_100001675 3300005618 Bacteria 18239
231 Ga0068864_100009639 3300005618 Bacteria 7967
232 Ga0068864_100037672 3300005618 Bacteria 4128
233 Ga0068864_100050789 3300005618 Bacteria 3570
234 Ga0068864_100055270 3300005618 Bacteria 3427
235 Ga0068864_100111849 3300005618 Bacteria 2434
236 Ga0068864_100344446 3300005618 Bacteria 1405
237 Ga0068864_100433989 3300005618 Bacteria 1254
238 Ga0068866_10002966 3300005718 Bacteria 7006
239 Ga0068866_10016521 3300005718 Bacteria 3300
240 Ga0068866_10062873 3300005718 Unclassified 1933
241 Ga0068866_10144944 3300005718 Bacteria 1368
242 Ga0068861_100003091 3300005719 Bacteria 11000
243 Ga0068861_100046826 3300005719 Bacteria 3262
244 Ga0068861_100114407 3300005719 Bacteria 2166
245 Ga0068861_100241662 3300005719 Bacteria 1536
246 Ga0068861_100297833 3300005719 Bacteria 1396
247 Ga0068851_10000426 3300005834 Bacteria 18827
248 Ga0068851_10002987 3300005834 Bacteria 7472
249 Ga0068851_10019199 3300005834 Bacteria 3301
250 Ga0068870_10001530 3300005840 Bacteria 9389
251 Ga0068870_10002508 3300005840 Bacteria 7661
252 Ga0068870_10354188 3300005840 Bacteria 943
253 Ga0068863_100001174 3300005841 Bacteria 26150
254 Ga0068863_100001288 3300005841 Bacteria 25037
255 Ga0068863_100042055 3300005841 Bacteria 4343
256 Ga0068863_100066651 3300005841 Bacteria 3405
257 Ga0068863_100083587 3300005841 Bacteria 3025
258 Ga0068863_100138251 3300005841 Bacteria 2327
259 Ga0068863_100449999 3300005841 Bacteria 1264
260 Ga0068863_100748589 3300005841 Bacteria 973
261 Ga0068863_100819936 3300005841 Bacteria 928
262 Ga0068858_100004050 3300005842 Bacteria 14449
263 Ga0068858_100011271 3300005842 Bacteria 8448
264 Ga0068858_100051795 3300005842 Bacteria 3798
265 Ga0068858_100070407 3300005842 Bacteria 3242
266 Ga0068858_100102579 3300005842 Bacteria 2668
267 Ga0068858_100392942 3300005842 Bacteria 1332
268 Ga0068860_100001659 3300005843 Bacteria 23813
269 Ga0068860_100002991 3300005843 Bacteria 17457
270 Ga0068860_100003223 3300005843 Bacteria 16827
271 Ga0068860_100008441 3300005843 Bacteria 10261
272 Ga0068860_100009595 3300005843 Bacteria 9617
273 Ga0068860_100038199 3300005843 Bacteria 4594
274 Ga0068860_100059599 3300005843 Bacteria 3628
275 Ga0068862_100031290 3300005844 Bacteria 4491
276 Ga0068862_100138809 3300005844 Bacteria 2156
277 Ga0068862_100279792 3300005844 Bacteria 1529
278 Ga0070715_10014259 3300006163 Bacteria 2940
279 Ga0070716_100077653 3300006173 Bacteria 1971
280 Ga0070716_100086414 3300006173 Bacteria 1886
281 Ga0070712_100019900 3300006175 Bacteria 4388
282 Ga0070712_100064311 3300006175 Bacteria 2601
283 Ga0097621_100039465 3300006237 Bacteria 3792
284 Ga0097621_100044014 3300006237 Bacteria 3601
285 Ga0097621_100184539 3300006237 Bacteria 1804
286 Ga0097621_100217437 3300006237 Bacteria 1664
287 Ga0097621_100404521 3300006237 Bacteria 1223
288 Ga0068871_100007334 3300006358 Bacteria 7869
289 Ga0068871_100033693 3300006358 Bacteria 4058
290 Ga0068871_100068352 3300006358 Bacteria 2917
291 Ga0068871_100133841 3300006358 Bacteria 2104
292 Ga0068871_100273771 3300006358 Bacteria 1475
293 Ga0075428_100880926 3300006844 Bacteria 950
294 Ga0075433_10030161 3300006852 Bacteria 4626
295 Ga0075434_100079351 3300006871 Bacteria 3279
296 Ga0075434_100087139 3300006871 Bacteria 3123
297 Ga0075434_100660136 3300006871 Unclassified 1064
298 Ga0068865_100019734 3300006881 Bacteria 4364
299 Ga0068865_100051841 3300006881 Bacteria 2842
300 Ga0068865_100072564 3300006881 Bacteria 2445
301 Ga0097620_100000538 3300006931 Bacteria 37506
302 Ga0097620_100002241 3300006931 Bacteria 19618
303 Ga0097620_100102574 3300006931 Bacteria 2918
304 Ga0097620_100149437 3300006931 Bacteria 2412
305 Ga0097620_100187602 3300006931 Bacteria 2152
306 Ga0097620_100653476 3300006931 Bacteria 1143
307 Ga0075435_100078850 3300007076 Bacteria 2702
308 Ga0105240_10000555 3300009093 Bacteria 69184
309 Ga0105240_10079605 3300009093 Bacteria 4032
310 Ga0111539_10013935 3300009094 Bacteria 10051
311 Ga0105245_10004136 3300009098 Bacteria 12888
312 Ga0105247_10005328 3300009101 Bacteria 8107
313 Ga0114129_10113469 3300009147 Bacteria 3737
314 Ga0105243_10050943 3300009148 Bacteria 3272
315 Ga0105243_10170986 3300009148 Bacteria 1882
316 Ga0105243_10223486 3300009148 Bacteria 1666
317 Ga0105243_10331703 3300009148 Bacteria 1390
318 Ga0105241_10016536 3300009174 Bacteria 5411
319 Ga0105241_10154028 3300009174 Bacteria 1883
320 Ga0105242_10014406 3300009176 Bacteria 6127
321 Ga0105242_10067456 3300009176 Bacteria 2958
322 Ga0105242_10120603 3300009176 Bacteria 2250
323 Ga0105248_10000874 3300009177 Bacteria 33787
324 Ga0105248_10018853 3300009177 Bacteria 7631
325 Ga0105248_10084067 3300009177 Bacteria 3580
326 Ga0105248_10093968 3300009177 Bacteria 3377
327 Ga0105248_10130372 3300009177 Bacteria 2836
328 Ga0105237_10095861 3300009545 Bacteria 2957
329 Ga0105237_10177310 3300009545 Bacteria 2132
330 Ga0105237_10212814 3300009545 Bacteria 1932
331 Ga0105238_10004888 3300009551 Bacteria 13255
332 Ga0105238_10074440 3300009551 Bacteria 3388
333 Ga0105238_10125099 3300009551 Bacteria 2550
334 Ga0105249_10146192 3300009553 Bacteria 2272
335 Ga0105249_10309883 3300009553 Bacteria 1586
336 Ga0105239_10005432 3300010375 Bacteria 14957
337 Ga0105239_10116379 3300010375 Bacteria 2966
338 Ga0105239_10303532 3300010375 Bacteria 1798
339 Ga0105246_10031481 3300011119 Bacteria 3511
340 Ga0105246_10043977 3300011119 Bacteria 3033
341 Ga0157373_10001627 3300013100 Bacteria 17144
342 Ga0157373_10001779 3300013100 Bacteria 16390
343 Ga0157373_10023685 3300013100 Bacteria 4450
344 Ga0157373_10160433 3300013100 Bacteria 1582
345 Ga0157373_10294651 3300013100 Bacteria 1151
346 Ga0157371_10000614 3300013102 Bacteria 42414
347 Ga0157371_10193486 3300013102 Bacteria 1457
348 Ga0157371_10214942 3300013102 Bacteria 1380
349 Ga0157370_10002272 3300013104 Bacteria 23306
350 Ga0157370_10019529 3300013104 Bacteria 6792
351 Ga0157370_10021376 3300013104 Bacteria 6448
352 Ga0157370_10025093 3300013104 Bacteria 5901
353 Ga0157370_10028265 3300013104 Bacteria 5519
354 Ga0157370_10096370 3300013104 Bacteria 2776
355 Ga0157370_10107004 3300013104 Bacteria 2617
356 Ga0157370_10320849 3300013104 Bacteria 1429
357 Ga0157369_10006469 3300013105 Bacteria 13577
358 Ga0157369_10020274 3300013105 Bacteria 7431
359 Ga0157369_10052080 3300013105 Bacteria 4430
360 Ga0157369_10061683 3300013105 Bacteria 4041
361 Ga0157369_10076187 3300013105 Bacteria 3595
362 Ga0157369_10125063 3300013105 Bacteria 2727
363 Ga0157369_10250757 3300013105 Bacteria 1847
364 Ga0157374_10000346 3300013296 Bacteria 42858
365 Ga0157374_10007812 3300013296 Bacteria 9132
366 Ga0157378_10085099 3300013297 Bacteria 2864
367 Ga0157378_10200853 3300013297 Bacteria 1885
368 Ga0157378_10430777 3300013297 Bacteria 1305
369 Ga0163162_10004891 3300013306 Bacteria 12917
370 Ga0163162_10012637 3300013306 Bacteria 8244
371 Ga0163162_10323313 3300013306 Bacteria 1675
372 Ga0157372_10005628 3300013307 Bacteria 13321
373 Ga0157372_10124136 3300013307 Bacteria 2968
374 Ga0157372_10293587 3300013307 Bacteria 1890
375 Ga0157372_10369990 3300013307 Bacteria 1670
376 Ga0157375_10006699 3300013308 Bacteria 10033
377 Ga0157375_10028302 3300013308 Bacteria 5251
378 Ga0157375_10038782 3300013308 Bacteria 4577
379 Ga0157375_10071036 3300013308 Bacteria 3493
380 Ga0157375_10097017 3300013308 Bacteria 3021
381 Ga0157375_10412710 3300013308 Bacteria 1516
382 Ga0157375_10423734 3300013308 Bacteria 1497
383 Ga0163163_10000834 3300014325 Bacteria 26217
384 Ga0163163_10007776 3300014325 Bacteria 9473
385 Ga0163163_10252072 3300014325 Bacteria 1816
386 Ga0163163_10798953 3300014325 Bacteria 1007
387 Ga0157380_10005009 3300014326 Bacteria 9236
388 Ga0157380_10170274 3300014326 Bacteria 1902
389 Ga0157380_10232326 3300014326 Bacteria 1657
390 Ga0157380_10656824 3300014326 Bacteria 1047
391 Ga0157377_10019007 3300014745 Bacteria 3583
392 Ga0157379_10000063 3300014968 Bacteria 68139
393 Ga0157379_10006330 3300014968 Bacteria 10194
394 Ga0157379_10029616 3300014968 Bacteria 4867
395 Ga0157379_10050077 3300014968 Bacteria 3728
396 Ga0157379_10192171 3300014968 Bacteria 1845
397 Ga0157379_10286523 3300014968 Bacteria 1499
398 Ga0157376_10005094 3300014969 Bacteria 9156
399 Ga0157376_10126952 3300014969 Bacteria 2270
400 Ga0163161_10008971 3300017792 Bacteria 6917
401 Ga0163161_10054808 3300017792 Bacteria 2894
402 Ga0163161_10111351 3300017792 Bacteria 2047
403 Ga0206356_10998087 3300020070 Bacteria 2815
404 Ga0206353_11578615 3300020082 Bacteria 3176
405 Ga0207697_10000020 3300025315 Bacteria 55999
406 Ga0207697_10012830 3300025315 Bacteria 3504
407 Ga0207656_10004889 3300025321 Bacteria 4702
408 Ga0207682_10000288 3300025893 Bacteria 22923
409 Ga0207692_10030021 3300025898 Bacteria 2588
410 Ga0207642_10019101 3300025899 Bacteria 2646
411 Ga0207642_10027163 3300025899 Unclassified 2340
412 Ga0207642_10118967 3300025899 Bacteria 1359
413 Ga0207710_10084046 3300025900 Bacteria 1481
414 Ga0207680_10020719 3300025903 Bacteria 3547
415 Ga0207680_10042020 3300025903 Bacteria 2671
416 Ga0207680_10046820 3300025903 Bacteria 2559
417 Ga0207680_10053505 3300025903 Bacteria 2424
418 Ga0207680_10056433 3300025903 Bacteria 2372
419 Ga0207680_10265463 3300025903 Bacteria 1189
420 Ga0207680_10376029 3300025903 Bacteria 1001
421 Ga0207647_10077221 3300025904 Bacteria 2002
422 Ga0207685_10007960 3300025905 Bacteria 2989
423 Ga0207699_10281538 3300025906 Bacteria 1156
424 Ga0207699_10439694 3300025906 Bacteria 934
425 Ga0207645_10000353 3300025907 Bacteria 38206
426 Ga0207645_10004764 3300025907 Bacteria 9974
427 Ga0207645_10023878 3300025907 Bacteria 3969
428 Ga0207645_10038013 3300025907 Bacteria 3088
429 Ga0207645_10039290 3300025907 Bacteria 3032
430 Ga0207645_10089388 3300025907 Bacteria 1981
431 Ga0207645_10270973 3300025907 Bacteria 1126
432 Ga0207643_10000131 3300025908 Bacteria 50934
433 Ga0207643_10002024 3300025908 Bacteria 11195
434 Ga0207643_10007598 3300025908 Bacteria 5822
435 Ga0207643_10099912 3300025908 Bacteria 1701
436 Ga0207705_10012689 3300025909 Bacteria 6080
437 Ga0207705_10049275 3300025909 Bacteria 3032
438 Ga0207705_10193168 3300025909 Bacteria 1540
439 Ga0207705_10305618 3300025909 Bacteria 1220
440 Ga0207705_10320243 3300025909 Bacteria 1191
441 Ga0207684_10155916 3300025910 Bacteria 1965
442 Ga0207684_10250545 3300025910 Bacteria 1528
443 Ga0207654_10006442 3300025911 Bacteria 5910
444 Ga0207654_10057481 3300025911 Bacteria 2261
445 Ga0207707_10022803 3300025912 Bacteria 5474
446 Ga0207707_10026302 3300025912 Bacteria 5086
447 Ga0207707_10046973 3300025912 Bacteria 3760
448 Ga0207707_10079382 3300025912 Bacteria 2865
449 Ga0207695_10010003 3300025913 Bacteria 11651
450 Ga0207695_10044873 3300025913 Bacteria 4698
451 Ga0207695_10377756 3300025913 Bacteria 1303
452 Ga0207671_10052659 3300025914 Bacteria 3016
453 Ga0207671_10155656 3300025914 Bacteria 1767
454 Ga0207671_10363711 3300025914 Unclassified 1148
455 Ga0207671_10379959 3300025914 Unclassified 1122
456 Ga0207693_10003162 3300025915 Bacteria 14146
457 Ga0207693_10012564 3300025915 Bacteria 6840
458 Ga0207693_10017226 3300025915 Bacteria 5762
459 Ga0207663_10166190 3300025916 Bacteria 1563
460 Ga0207663_10217211 3300025916 Bacteria 1389
461 Ga0207663_10278123 3300025916 Bacteria 1242
462 Ga0207660_10016156 3300025917 Bacteria 4937
463 Ga0207660_10058817 3300025917 Bacteria 2757
464 Ga0207662_10003213 3300025918 Bacteria 8366
465 Ga0207662_10019927 3300025918 Bacteria 3822
466 Ga0207657_10000838 3300025919 Bacteria 32510
467 Ga0207657_10001142 3300025919 Bacteria 28211
468 Ga0207657_10005375 3300025919 Bacteria 13408
469 Ga0207657_10006434 3300025919 Bacteria 12178
470 Ga0207657_10007848 3300025919 Bacteria 10894
471 Ga0207657_10014488 3300025919 Bacteria 7694
472 Ga0207657_10024869 3300025919 Bacteria 5536
473 Ga0207657_10333476 3300025919 Bacteria 1198
474 Ga0207649_10021892 3300025920 Bacteria 3688
475 Ga0207649_10031977 3300025920 Bacteria 3132
476 Ga0207649_10045147 3300025920 Bacteria 2700
477 Ga0207652_10025106 3300025921 Bacteria 4951
478 Ga0207652_10031346 3300025921 Bacteria 4464
479 Ga0207652_10507958 3300025921 Bacteria 1085
480 Ga0207646_10005882 3300025922 Bacteria 12809
481 Ga0207646_10351090 3300025922 Bacteria 1333
482 Ga0207646_10564925 3300025922 Bacteria 1022
483 Ga0207681_10001804 3300025923 Bacteria 13734
484 Ga0207681_10165285 3300025923 Bacteria 1672
485 Ga0207694_10002716 3300025924 Bacteria 14316
486 Ga0207694_10020858 3300025924 Bacteria 4960
487 Ga0207650_10002600 3300025925 Bacteria 12491
488 Ga0207650_10004277 3300025925 Bacteria 9744
489 Ga0207650_10012394 3300025925 Bacteria 5886
490 Ga0207650_10030171 3300025925 Bacteria 3903
491 Ga0207650_10142504 3300025925 Bacteria 1885
492 Ga0207650_10279858 3300025925 Bacteria 1358
493 Ga0207659_10006674 3300025926 Bacteria 7091
494 Ga0207659_10009437 3300025926 Bacteria 6097
495 Ga0207659_10029974 3300025926 Bacteria 3712
496 Ga0207659_10045840 3300025926 Bacteria 3085
497 Ga0207659_10094727 3300025926 Bacteria 2238
498 Ga0207659_10152880 3300025926 Bacteria 1804
499 Ga0207687_10003789 3300025927 Bacteria 10161
500 Ga0207687_10004961 3300025927 Bacteria 8830
501 Ga0207687_10026635 3300025927 Bacteria 3873
502 Ga0207700_10012983 3300025928 Bacteria 5398
503 Ga0207664_10010569 3300025929 Bacteria 6520
504 Ga0207664_10013621 3300025929 Bacteria 5845
505 Ga0207664_10089677 3300025929 Bacteria 2518
506 Ga0207644_10004041 3300025931 Bacteria 9515
507 Ga0207644_10015731 3300025931 Bacteria 5083
508 Ga0207644_10022542 3300025931 Bacteria 4303
509 Ga0207644_10060477 3300025931 Bacteria 2741
510 Ga0207644_10099000 3300025931 Bacteria 2187
511 Ga0207690_10000802 3300025932 Bacteria 20178
512 Ga0207690_10044895 3300025932 Bacteria 2916
513 Ga0207690_10141935 3300025932 Bacteria 1771
514 Ga0207690_10267604 3300025932 Unclassified 1326
515 Ga0207706_10000052 3300025933 Bacteria 115553
516 Ga0207706_10002570 3300025933 Bacteria 17702
517 Ga0207706_10006651 3300025933 Bacteria 10690
518 Ga0207706_10150777 3300025933 Bacteria 2044
519 Ga0207706_10156752 3300025933 Bacteria 2002
520 Ga0207686_10022739 3300025934 Bacteria 3613
521 Ga0207686_10282444 3300025934 Bacteria 1226
522 Ga0207709_10150528 3300025935 Bacteria 1611
523 Ga0207709_10225641 3300025935 Bacteria 1354
524 Ga0207670_10009886 3300025936 Bacteria 5464
525 Ga0207670_10146943 3300025936 Bacteria 1744
526 Ga0207670_10208822 3300025936 Bacteria 1488
527 Ga0207670_10627296 3300025936 Bacteria 884
528 Ga0207669_10084951 3300025937 Bacteria 2041
529 Ga0207669_10110440 3300025937 Bacteria 1841
530 Ga0207669_10175210 3300025937 Bacteria 1531
531 Ga0207669_10238061 3300025937 Bacteria 1347
532 Ga0207704_10019940 3300025938 Bacteria 3535
533 Ga0207665_10015079 3300025939 Bacteria 5075
534 Ga0207665_10021340 3300025939 Bacteria 4258
535 Ga0207665_10035099 3300025939 Bacteria 3327
536 Ga0207691_10007196 3300025940 Bacteria 10734
537 Ga0207691_10010390 3300025940 Bacteria 8930
538 Ga0207691_10012433 3300025940 Bacteria 8161
539 Ga0207691_10028016 3300025940 Bacteria 5278
540 Ga0207691_10038833 3300025940 Bacteria 4405
541 Ga0207691_10040366 3300025940 Bacteria 4312
542 Ga0207691_10228966 3300025940 Bacteria 1610
543 Ga0207691_10479099 3300025940 Bacteria 1058
544 Ga0207711_10000741 3300025941 Bacteria 32019
545 Ga0207711_10002533 3300025941 Bacteria 16274
546 Ga0207711_10043796 3300025941 Bacteria 3819
547 Ga0207711_10087248 3300025941 Bacteria 2737
548 Ga0207711_10163969 3300025941 Bacteria 2013
549 Ga0207711_10446067 3300025941 Bacteria 1204
550 Ga0207711_10581691 3300025941 Bacteria 1045
551 Ga0207689_10000091 3300025942 Bacteria 73260
552 Ga0207689_10000116 3300025942 Bacteria 65521
553 Ga0207689_10011986 3300025942 Bacteria 7432
554 Ga0207689_10032909 3300025942 Bacteria 4309
555 Ga0207689_10357700 3300025942 Bacteria 1214
556 Ga0207661_10256591 3300025944 Bacteria 1556
557 Ga0207679_10004806 3300025945 Bacteria 8417
558 Ga0207679_10020060 3300025945 Bacteria 4505
559 Ga0207667_10000257 3300025949 Bacteria 74952
560 Ga0207667_10008794 3300025949 Bacteria 11956
561 Ga0207667_10009201 3300025949 Bacteria 11669
562 Ga0207667_10067872 3300025949 Bacteria 3714
563 Ga0207667_10180698 3300025949 Bacteria 2167
564 Ga0207667_10212173 3300025949 Bacteria 1984
565 Ga0207667_10229175 3300025949 Bacteria 1903
566 Ga0207667_10563560 3300025949 Bacteria 1151
567 Ga0207651_10003828 3300025960 Bacteria 7458
568 Ga0207651_10010539 3300025960 Bacteria 5128
569 Ga0207651_10015691 3300025960 Bacteria 4412
570 Ga0207651_10069851 3300025960 Bacteria 2482
571 Ga0207651_10201751 3300025960 Bacteria 1594
572 Ga0207651_10434216 3300025960 Bacteria 1123
573 Ga0207651_10454584 3300025960 Bacteria 1099
574 Ga0207712_10102483 3300025961 Bacteria 2131
575 Ga0207668_10010200 3300025972 Bacteria 5669
576 Ga0207668_10093761 3300025972 Bacteria 2212
577 Ga0207668_10286968 3300025972 Bacteria 1352
578 Ga0207640_10016901 3300025981 Bacteria 4255
579 Ga0207640_10033821 3300025981 Bacteria 3184
580 Ga0207658_10015481 3300025986 Bacteria 5231
581 Ga0207658_10070171 3300025986 Bacteria 2650
582 Ga0207658_10084275 3300025986 Bacteria 2445
583 Ga0207658_10106416 3300025986 Bacteria 2208
584 Ga0207658_10159105 3300025986 Bacteria 1849
585 Ga0207677_10000945 3300026023 Bacteria 16205
586 Ga0207677_10003049 3300026023 Bacteria 8859
587 Ga0207677_10036394 3300026023 Bacteria 3208
588 Ga0207677_10138521 3300026023 Bacteria 1859
589 Ga0207677_10204930 3300026023 Bacteria 1571
590 Ga0207703_10003554 3300026035 Bacteria 13030
591 Ga0207703_10003665 3300026035 Bacteria 12803
592 Ga0207703_10078779 3300026035 Bacteria 2739
593 Ga0207703_10160732 3300026035 Bacteria 1967
594 Ga0207703_10200916 3300026035 Bacteria 1771
595 Ga0207639_10011492 3300026041 Bacteria 6152
596 Ga0207639_10020442 3300026041 Bacteria 4739
597 Ga0207639_10030799 3300026041 Bacteria 3937
598 Ga0207639_10114920 3300026041 Bacteria 2200
599 Ga0207639_10381607 3300026041 Bacteria 1266
600 Ga0207639_10567850 3300026041 Bacteria 1043
601 Ga0207678_10000257 3300026067 Bacteria 48122
602 Ga0207678_10121935 3300026067 Bacteria 2225
603 Ga0207678_10138861 3300026067 Bacteria 2074
604 Ga0207678_10144086 3300026067 Bacteria 2033
605 Ga0207678_10192050 3300026067 Bacteria 1745
606 Ga0207678_10212249 3300026067 Bacteria 1656
607 Ga0207708_10001876 3300026075 Bacteria 15504
608 Ga0207708_10045574 3300026075 Bacteria 3342
609 Ga0207702_10001528 3300026078 Bacteria 22893
610 Ga0207702_10012390 3300026078 Bacteria 7101
611 Ga0207702_10012902 3300026078 Bacteria 6949
612 Ga0207702_10158973 3300026078 Bacteria 2062
613 Ga0207702_10181992 3300026078 Bacteria 1936
614 Ga0207702_10474978 3300026078 Bacteria 1216
615 Ga0207702_10750647 3300026078 Bacteria 963
616 Ga0207641_10004463 3300026088 Bacteria 12119
617 Ga0207641_10008459 3300026088 Bacteria 8505
618 Ga0207641_10013789 3300026088 Bacteria 6627
619 Ga0207641_10076457 3300026088 Bacteria 2894
620 Ga0207648_10000306 3300026089 Bacteria 53612
621 Ga0207648_10000415 3300026089 Bacteria 47449
622 Ga0207648_10131514 3300026089 Bacteria 2203
623 Ga0207648_10427272 3300026089 Bacteria 1204
624 Ga0207648_10487201 3300026089 Bacteria 1127
625 Ga0207676_10000576 3300026095 Bacteria 30160
626 Ga0207676_10005098 3300026095 Bacteria 9298
627 Ga0207676_10019358 3300026095 Bacteria 4964
628 Ga0207676_10032258 3300026095 Bacteria 3945
629 Ga0207676_10055696 3300026095 Bacteria 3106
630 Ga0207676_10117739 3300026095 Bacteria 2235
631 Ga0207676_10123779 3300026095 Bacteria 2185
632 Ga0207674_10000180 3300026116 Bacteria 77710
633 Ga0207674_10011211 3300026116 Bacteria 10076
634 Ga0207674_10011959 3300026116 Bacteria 9727
635 Ga0207674_10011962 3300026116 Bacteria 9726
636 Ga0207674_10057938 3300026116 Bacteria 3926
637 Ga0207674_10116219 3300026116 Bacteria 2646
638 Ga0207674_10139657 3300026116 Bacteria 2383
639 Ga0207675_100002147 3300026118 Bacteria 19586
640 Ga0207675_100002299 3300026118 Bacteria 18975
641 Ga0207675_100190804 3300026118 Bacteria 1965
642 Ga0207675_100307472 3300026118 Bacteria 1545
643 Ga0207683_10000661 3300026121 Bacteria 31642
644 Ga0207683_10016177 3300026121 Bacteria 6349
645 Ga0207683_10433641 3300026121 Bacteria 1211
646 Ga0207683_10532777 3300026121 Bacteria 1085
647 Ga0207698_10003033 3300026142 Bacteria 10063
648 Ga0207698_10018680 3300026142 Bacteria 4730
649 Ga0207698_10114013 3300026142 Bacteria 2273
650 Ga0207698_10654572 3300026142 Bacteria 1041
651 Ga0209999_1006505 3300027543 Bacteria 2098
652 Ga0209983_1024780 3300027665 Bacteria 1265
653 Ga0209971_1002855 3300027682 Bacteria 4128
654 Ga0209974_10018043 3300027876 Bacteria 2340
655 Ga0268266_10040289 3300028379 Bacteria 3981
656 Ga0268266_10052156 3300028379 Bacteria 3512
657 Ga0268266_10244360 3300028379 Bacteria 1658
658 Ga0268266_10254006 3300028379 Bacteria 1627
659 Ga0268265_10010772 3300028380 Bacteria 6173
660 Ga0268265_10013552 3300028380 Bacteria 5541
661 Ga0268265_10128036 3300028380 Bacteria 2105
662 Ga0268265_10172035 3300028380 Bacteria 1852
663 Ga0268265_10550067 3300028380 Bacteria 1095
664 Ga0268264_10000599 3300028381 Bacteria 43601
665 Ga0268264_10002914 3300028381 Bacteria 14861
666 Ga0268264_10006545 3300028381 Bacteria 9808
667 Ga0268264_10021391 3300028381 Bacteria 5282
668 Ga0268264_10021523 3300028381 Bacteria 5264
669 Ga0307408_100013930 3300031548 Bacteria 5340
670 Ga0307408_100411236 3300031548 Bacteria 1164
671 Ga0307405_10022171 3300031731 Bacteria 3586
672 Ga0307405_10134498 3300031731 Bacteria 1714
673 Ga0307413_10017211 3300031824 Bacteria 3759
674 Ga0307410_10001025 3300031852 Bacteria 12119
675 Ga0307410_10090206 3300031852 Bacteria 2174
676 Ga0307406_10011580 3300031901 Bacteria 5011
677 Ga0307407_10002673 3300031903 Bacteria 7063
678 Ga0307412_10027267 3300031911 Bacteria 3559
679 Ga0307409_100077893 3300031995 Bacteria 2664
680 Ga0307409_100272864 3300031995 Bacteria 1558
681 Ga0307416_100008111 3300032002 Bacteria 6742
682 Ga0307416_100495034 3300032002 Bacteria 1285
683 Ga0307416_100991439 3300032002 Unclassified 943
684 Ga0307414_10007478 3300032004 Bacteria 6137
685 Ga0307414_10135432 3300032004 Bacteria 1920
686 Ga0307411_10001635 3300032005 Bacteria 9350
687 Ga0307411_10026811 3300032005 Bacteria 3475
688 Ga0307411_10288275 3300032005 Bacteria 1310
689 Ga0307415_100009598 3300032126 Bacteria 5436
690 Ga0373934_0008635 3300035086 Bacteria 3799
691 Ga0373923_0008271 3300035111 Bacteria 3702
692 Ga0373923_0137666 3300035111 Bacteria 1102
693 Ga0373939_0038262 3300035114 Bacteria 1430
694 Ga0373945_0028518 3300035116 Bacteria 1956
695 Ga0373953_0011491 3300035117 Bacteria 3109
696 Ga0373954_0026942 3300035118 Bacteria 2636
697 Ga0373956_0006099 3300035119 Bacteria 4821
698 Ga0373957_0004355 3300035120 Bacteria 4300
699 Ga0373957_0053941 3300035120 Bacteria 1543
700 Ga0373943_0013793 3300035170 Bacteria 3654
701 Ga0373943_0022232 3300035170 Bacteria 2936
702 Ga0373946_0013246 3300035171 Bacteria 3097
703 Ga0373955_0006260 3300035172 Bacteria 5416
704 Ga0373955_0012521 3300035172 Bacteria 4077
705 Ga0373955_0163496 3300035172 Bacteria 1315
706 Ga0373931_0070508 3300035691 Bacteria 1907
707 Ga0373935_0014581 3300035692 Bacteria 4743
708 Ga0373927_0176731 3300035695 Bacteria 1400
709 Ga0373933_0005336 3300035724 Bacteria 7005
710 Ga0373933_0040116 3300035724 Bacteria 2757
711 Ga0373933_0245393 3300035724 Bacteria 1152
712 Ga0373947_0238111 3300035725 Bacteria 1200
713 Ga0373937_0005753 3300036401 Bacteria 10653
714 Ga0373937_0037694 3300036401 Bacteria 4406
715 Ga0373937_0134579 3300036401 Bacteria 2310
716 Ga0373925_0071423 3300037068 Bacteria 2625
717 Ga0373925_0138667 3300037068 Bacteria 1902
718 Ga0373925_0438822 3300037068 Bacteria 1068
719 Ga0395899_0131810 3300037312 Bacteria 1784
720 Ga0395900_0494649 3300037418 Bacteria 1174
721 Ga0395901_0045268 3300038443 Bacteria 4566
722 Ga0451853_1018540 3300041512 Bacteria 1624
723 Ga0466967_0241150 3300045976 Bacteria 1725
724 Ga0466967_0979988 3300045976 Bacteria 842
725 Ga0495662_0113393 3300046476 Bacteria 1329
726 Ga0495664_0044588 3300046477 Bacteria 2628
727 Ga0495608_0255529 3300046511 Bacteria 1092
728 Ga0495630_0154444 3300046517 Bacteria 1747
729 Ga0495663_0060283 3300046525 Bacteria 1192
730 Ga0495621_0001838 3300046539 Bacteria 5582
731 Ga0495645_0006508 3300046543 Bacteria 8112
732 Ga0495645_0181773 3300046543 Bacteria 1440
733 Ga0495635_0093885 3300046663 Bacteria 2051
734 Ga0495623_0071625 3300046679 Bacteria 2156
735 Ga0495669_0193979 3300046684 Bacteria 970
736 Ga0495674_0068559 3300047319 Bacteria 3070
737 Ga0495602_0082816 3300048088 Bacteria 2691
738 Ga0496100_0025850 3300048903 Bacteria 3593
739 Ga0496100_0132250 3300048903 Bacteria 1759
740 Ga0496100_0385492 3300048903 Unclassified 1065
741 Ga0496101_0012964 3300048904 Bacteria 5576
742 Ga0496101_0125400 3300048904 Bacteria 1945
743 Ga0496101_0189478 3300048904 Bacteria 1587
744 Ga0496101_0285086 3300048904 Bacteria 1292
745 Ga0496102_0046701 3300048905 Bacteria 3933
746 Ga0496102_0071380 3300048905 Bacteria 3188
747 Ga0496102_0095244 3300048905 Bacteria 2759
748 Ga0496102_0403235 3300048905 Bacteria 1285
749 Ga0496103_0007843 3300048906 Bacteria 6345
750 Ga0496104_0003498 3300048907 Bacteria 13546
751 Ga0496104_0020188 3300048907 Bacteria 6104
752 Ga0496105_0093814 3300048908 Bacteria 2479
753 Ga0496105_0171595 3300048908 Bacteria 1778
754 Ga0496106_0027195 3300048909 Bacteria 4260
755 Ga0496106_0075957 3300048909 Bacteria 2574
756 Ga0496107_0006584 3300048910 Bacteria 7995
757 Ga0496107_0089582 3300048910 Bacteria 2247
758 Ga0496107_0183841 3300048910 Bacteria 1552
759 Ga0496108_0014945 3300048911 Bacteria 6336
760 Ga0496108_0027429 3300048911 Bacteria 4703
761 Ga0496108_0057427 3300048911 Bacteria 3270
762 Ga0496109_0004927 3300048912 Bacteria 11142
763 Ga0496109_0009581 3300048912 Bacteria 8261
764 Ga0496109_0044266 3300048912 Bacteria 4038
765 Ga0496109_0161442 3300048912 Bacteria 2100
766 Ga0496110_0003478 3300048913 Bacteria 12080
767 Ga0496110_0052969 3300048913 Bacteria 3566
768 Ga0496111_0030710 3300048914 Bacteria 3822
769 Ga0496112_0001998 3300048915 Bacteria 16138
770 Ga0496112_0020364 3300048915 Bacteria 6287
771 Ga0496112_0090231 3300048915 Bacteria 3034
772 Ga0496113_0362424 3300048916 Unclassified 1163
773 Ga0496113_0462969 3300048916 Bacteria 1019
774 Ga0496114_0020599 3300048917 Bacteria 5353
775 Ga0496114_0065480 3300048917 Bacteria 3045
776 Ga0496114_0209004 3300048917 Bacteria 1711
777 Ga0496115_0026872 3300048918 Bacteria 4497
778 Ga0496115_0585826 3300048918 Bacteria 888
779 Ga0501042_0173769 3300049578 Bacteria 1554
780 Ga0501075_0380459 3300049591 Bacteria 1076
781 Ga0501075_0560511 3300049591 Bacteria 872
782 Ga0501045_0291363 3300049824 Bacteria 1215
783 nmdc:mga05p37_90987_c1 3300050507 Bacteria 3760
784 nmdc:mga08y16_25446_c1 3300050511 Bacteria 6242
785 nmdc:mga0n895_167293_c1 3300050512 Bacteria 2230
786 nmdc:mga0n895_83391_c1 3300050512 Bacteria 3188
787 nmdc:mga0rr50_106851_c1 3300050513 Bacteria 2209
788 nmdc:mga08x19_226839_c1 3300050514 Bacteria 1285
789 nmdc:mga08x19_271192_c1 3300050514 Bacteria 1174
790 nmdc:mga08x19_85961_c1 3300050514 Bacteria 2070
791 nmdc:mga0a205_167339_c1 3300050515 Bacteria 2094
792 nmdc:mga0a205_49770_c1 3300050515 Bacteria 4046
793 Ga0495601_0029882 3300053077 Bacteria 3383
794 Ga0495595_0026173 3300053084 Bacteria 2591
795 Ga0501082_0220292 3300060353 Bacteria 1651

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10170986 Ga0105243_101709862 206
2 3300013105 Ga0157369_10250757 Ga0157369_102507572 218
3 3300005330 Ga0070690_100077990 Ga0070690_1000779902 219
4 3300005334 Ga0068869_100106314 Ga0068869_1001063142 219
5 3300005340 Ga0070689_100080408 Ga0070689_1000804083 219
6 3300005356 Ga0070674_100077228 Ga0070674_1000772282 219
7 3300005544 Ga0070686_100062993 Ga0070686_1000629932 219
8 3300005617 Ga0068859_100187599 Ga0068859_1001875992 219
9 3300005618 Ga0068864_100055270 Ga0068864_1000552702 219
10 3300005841 Ga0068863_100066651 Ga0068863_1000666513 219
11 3300005842 Ga0068858_100102579 Ga0068858_1001025792 219
12 3300005844 Ga0068862_100138809 Ga0068862_1001388092 219
13 3300006237 Ga0097621_100404521 Ga0097621_1004045212 219
14 3300006931 Ga0097620_100187602 Ga0097620_1001876022 219
15 3300009148 Ga0105243_10050943 Ga0105243_100509433 219
16 3300009176 Ga0105242_10014406 Ga0105242_100144064 219
17 3300013297 Ga0157378_10085099 Ga0157378_100850994 219
18 3300013306 Ga0163162_10323313 Ga0163162_103233132 219
19 3300013308 Ga0157375_10412710 Ga0157375_104127102 219
20 3300014326 Ga0157380_10005009 Ga0157380_100050099 219
21 3300006871 Ga0075434_100660136 Ga0075434_1006601361 222
22 3300009147 Ga0114129_10113469 Ga0114129_101134694 222
23 3300025935 Ga0207709_10150528 Ga0207709_101505282 222
24 3300025937 Ga0207669_10175210 Ga0207669_101752102 222
25 3300025942 Ga0207689_10011986 Ga0207689_100119862 222
26 3300026035 Ga0207703_10160732 Ga0207703_101607322 222
27 3300026075 Ga0207708_10045574 Ga0207708_100455742 222
28 3300026089 Ga0207648_10427272 Ga0207648_104272722 222
29 3300028380 Ga0268265_10172035 Ga0268265_101720352 222
30 3300050507 nmdc:mga05p37_90987_c1 nmdc:mga05p37_90987_c1_312_1115 222
31 3300035695 Ga0373927_0176731 Ga0373927_0176731_430_1209 224
32 3300013104 Ga0157370_10025093 Ga0157370_100250934 225
33 3300013307 Ga0157372_10293587 Ga0157372_102935872 225
34 3300017792 Ga0163161_10111351 Ga0163161_101113512 225
35 3300049591 Ga0501075_0560511 Ga0501075_0560511_12_794 225
36 3300050515 nmdc:mga0a205_167339_c1 nmdc:mga0a205_167339_c1_681_1454 225
37 3300013100 Ga0157373_10001627 Ga0157373_1000162711 226
38 3300013102 Ga0157371_10000614 Ga0157371_1000061444 226
39 3300013105 Ga0157369_10061683 Ga0157369_100616833 226
40 3300013307 Ga0157372_10005628 Ga0157372_100056288 226
41 3300035691 Ga0373931_0070508 Ga0373931_0070508_486_1274 226
42 3300045976 Ga0466967_0979988 Ga0466967_0979988_82_804 226
43 3300048903 Ga0496100_0132250 Ga0496100_0132250_929_1732 226
44 3300048904 Ga0496101_0285086 Ga0496101_0285086_203_1006 226
45 3300048905 Ga0496102_0046701 Ga0496102_0046701_2313_3116 226
46 3300048909 Ga0496106_0075957 Ga0496106_0075957_26_829 226
47 3300005331 Ga0070670_100006016 Ga0070670_1000060169 227
48 3300005334 Ga0068869_100002165 Ga0068869_1000021657 227
49 3300005340 Ga0070689_100084407 Ga0070689_1000844073 227
50 3300005347 Ga0070668_100204128 Ga0070668_1002041282 227
51 3300005353 Ga0070669_100195686 Ga0070669_1001956862 227
52 3300005364 Ga0070673_100004580 Ga0070673_1000045805 227
53 3300005364 Ga0070673_100284403 Ga0070673_1002844032 227
54 3300005367 Ga0070667_100032230 Ga0070667_1000322305 227
55 3300005539 Ga0068853_100288594 Ga0068853_1002885942 227
56 3300005543 Ga0070672_100007539 Ga0070672_1000075399 227
57 3300005543 Ga0070672_100045986 Ga0070672_1000459864 227
58 3300005545 Ga0070695_100088738 Ga0070695_1000887382 227
59 3300005564 Ga0070664_100157090 Ga0070664_1001570902 227
60 3300005577 Ga0068857_100010811 Ga0068857_1000108114 227
61 3300005617 Ga0068859_100000538 Ga0068859_10000053837 227
62 3300005618 Ga0068864_100000566 Ga0068864_10000056621 227
63 3300005718 Ga0068866_10062873 Ga0068866_100628732 227
64 3300005719 Ga0068861_100003091 Ga0068861_1000030916 227
65 3300005840 Ga0068870_10002508 Ga0068870_100025089 227
66 3300005841 Ga0068863_100001288 Ga0068863_1000012888 227
67 3300005842 Ga0068858_100004050 Ga0068858_1000040509 227
68 3300005843 Ga0068860_100001659 Ga0068860_1000016598 227
69 3300005844 Ga0068862_100031290 Ga0068862_1000312904 227
70 3300006931 Ga0097620_100000538 Ga0097620_1000005388 227
71 3300009177 Ga0105248_10018853 Ga0105248_100188538 227
72 3300009545 Ga0105237_10212814 Ga0105237_102128142 227
73 3300013104 Ga0157370_10107004 Ga0157370_101070043 227
74 3300013308 Ga0157375_10097017 Ga0157375_100970172 227
75 3300014325 Ga0163163_10007776 Ga0163163_1000777612 227
76 3300014968 Ga0157379_10000063 Ga0157379_1000006319 227
77 3300025899 Ga0207642_10027163 Ga0207642_100271632 227
78 3300025903 Ga0207680_10376029 Ga0207680_103760291 227
79 3300025908 Ga0207643_10002024 Ga0207643_1000202414 227
80 3300025914 Ga0207671_10155656 Ga0207671_101556562 227
81 3300025923 Ga0207681_10165285 Ga0207681_101652852 227
82 3300025925 Ga0207650_10004277 Ga0207650_100042779 227
83 3300025936 Ga0207670_10208822 Ga0207670_102088222 227
84 3300025941 Ga0207711_10446067 Ga0207711_104460672 227
85 3300025942 Ga0207689_10000116 Ga0207689_100001162 227
86 3300025960 Ga0207651_10015691 Ga0207651_100156914 227
87 3300026023 Ga0207677_10036394 Ga0207677_100363942 227
88 3300026035 Ga0207703_10003554 Ga0207703_100035549 227
89 3300026088 Ga0207641_10008459 Ga0207641_100084599 227
90 3300026095 Ga0207676_10005098 Ga0207676_100050984 227
91 3300026116 Ga0207674_10011962 Ga0207674_100119624 227
92 3300026118 Ga0207675_100002147 Ga0207675_1000021477 227
93 3300028380 Ga0268265_10010772 Ga0268265_100107724 227
94 3300028381 Ga0268264_10000599 Ga0268264_100005999 227
95 3300035172 Ga0373955_0006260 Ga0373955_0006260_2644_3426 227
96 3300035724 Ga0373933_0245393 Ga0373933_0245393_61_843 227
97 3300036401 Ga0373937_0005753 Ga0373937_0005753_2830_3612 227
98 3300037312 Ga0395899_0131810 Ga0395899_0131810_25_798 227
99 3300048905 Ga0496102_0071380 Ga0496102_0071380_1197_2012 227
100 3300048906 Ga0496103_0007843 Ga0496103_0007843_3385_4200 227
101 3300048911 Ga0496108_0027429 Ga0496108_0027429_2732_3547 227
102 3300048912 Ga0496109_0009581 Ga0496109_0009581_3856_4671 227
103 3300050514 nmdc:mga08x19_271192_c1 nmdc:mga08x19_271192_c1_444_1163 227
104 3300005336 Ga0070680_100078176 Ga0070680_1000781762 228
105 3300005434 Ga0070709_10154229 Ga0070709_101542291 228
106 3300005436 Ga0070713_100295283 Ga0070713_1002952832 228
107 3300005439 Ga0070711_100489154 Ga0070711_1004891542 228
108 3300005468 Ga0070707_100027782 Ga0070707_1000277824 228
109 3300005471 Ga0070698_100532084 Ga0070698_1005320841 228
110 3300005539 Ga0068853_100226132 Ga0068853_1002261322 228
111 3300005549 Ga0070704_100028431 Ga0070704_1000284313 228
112 3300005616 Ga0068852_100009159 Ga0068852_1000091591 228
113 3300013104 Ga0157370_10021376 Ga0157370_100213763 228
114 3300013307 Ga0157372_10369990 Ga0157372_103699901 228
115 3300025915 Ga0207693_10012564 Ga0207693_100125646 228
116 3300025916 Ga0207663_10166190 Ga0207663_101661902 228
117 3300025919 Ga0207657_10005375 Ga0207657_100053755 228
118 3300025922 Ga0207646_10564925 Ga0207646_105649251 228
119 3300025927 Ga0207687_10026635 Ga0207687_100266352 228
120 3300025933 Ga0207706_10156752 Ga0207706_101567522 228
121 3300025941 Ga0207711_10581691 Ga0207711_105816911 228
122 3300026041 Ga0207639_10381607 Ga0207639_103816072 228
123 3300050514 nmdc:mga08x19_85961_c1 nmdc:mga08x19_85961_c1_425_1201 228
124 3300005336 Ga0070680_100125440 Ga0070680_1001254401 229
125 3300005339 Ga0070660_100030182 Ga0070660_1000301825 229
126 3300005344 Ga0070661_100001548 Ga0070661_1000015489 229
127 3300005366 Ga0070659_100003884 Ga0070659_10000388412 229
128 3300005435 Ga0070714_100012896 Ga0070714_1000128965 229
129 3300005445 Ga0070708_100106282 Ga0070708_1001062822 229
130 3300005455 Ga0070663_100084983 Ga0070663_1000849832 229
131 3300005458 Ga0070681_10041982 Ga0070681_100419824 229
132 3300005467 Ga0070706_100014830 Ga0070706_1000148308 229
133 3300005468 Ga0070707_100052046 Ga0070707_1000520464 229
134 3300005471 Ga0070698_100103814 Ga0070698_1001038142 229
135 3300005518 Ga0070699_100126402 Ga0070699_1001264022 229
136 3300005518 Ga0070699_100807487 Ga0070699_1008074871 229
137 3300005535 Ga0070684_100025170 Ga0070684_1000251705 229
138 3300005536 Ga0070697_100012939 Ga0070697_1000129393 229
139 3300005536 Ga0070697_100127368 Ga0070697_1001273681 229
140 3300005539 Ga0068853_100005058 Ga0068853_1000050584 229
141 3300005549 Ga0070704_100012983 Ga0070704_1000129835 229
142 3300005563 Ga0068855_100007236 Ga0068855_10000723614 229
143 3300005564 Ga0070664_100039826 Ga0070664_1000398264 229
144 3300005577 Ga0068857_100000165 Ga0068857_10000016511 229
145 3300005578 Ga0068854_100001226 Ga0068854_1000012269 229
146 3300005614 Ga0068856_100000375 Ga0068856_10000037546 229
147 3300005616 Ga0068852_100000473 Ga0068852_1000004739 229
148 3300005834 Ga0068851_10019199 Ga0068851_100191993 229
149 3300006173 Ga0070716_100086414 Ga0070716_1000864142 229
150 3300006852 Ga0075433_10030161 Ga0075433_100301612 229
151 3300006871 Ga0075434_100079351 Ga0075434_1000793513 229
152 3300006871 Ga0075434_100087139 Ga0075434_1000871392 229
153 3300007076 Ga0075435_100078850 Ga0075435_1000788502 229
154 3300009093 Ga0105240_10000555 Ga0105240_1000055554 229
155 3300009545 Ga0105237_10177310 Ga0105237_101773102 229
156 3300009551 Ga0105238_10004888 Ga0105238_100048885 229
157 3300013100 Ga0157373_10023685 Ga0157373_100236855 229
158 3300013104 Ga0157370_10096370 Ga0157370_100963702 229
159 3300013105 Ga0157369_10006469 Ga0157369_100064694 229
160 3300025909 Ga0207705_10049275 Ga0207705_100492753 229
161 3300025910 Ga0207684_10155916 Ga0207684_101559162 229
162 3300025912 Ga0207707_10079382 Ga0207707_100793822 229
163 3300025913 Ga0207695_10010003 Ga0207695_100100033 229
164 3300025914 Ga0207671_10363711 Ga0207671_103637111 229
165 3300025917 Ga0207660_10058817 Ga0207660_100588171 229
166 3300025919 Ga0207657_10007848 Ga0207657_100078489 229
167 3300025922 Ga0207646_10005882 Ga0207646_100058829 229
168 3300025924 Ga0207694_10002716 Ga0207694_100027165 229
169 3300025929 Ga0207664_10089677 Ga0207664_100896772 229
170 3300025932 Ga0207690_10267604 Ga0207690_102676042 229
171 3300025939 Ga0207665_10021340 Ga0207665_100213402 229
172 3300025945 Ga0207679_10004806 Ga0207679_100048069 229
173 3300025949 Ga0207667_10009201 Ga0207667_100092019 229
174 3300025981 Ga0207640_10016901 Ga0207640_100169014 229
175 3300026041 Ga0207639_10030799 Ga0207639_100307994 229
176 3300026067 Ga0207678_10138861 Ga0207678_101388612 229
177 3300026078 Ga0207702_10012390 Ga0207702_100123905 229
178 3300026116 Ga0207674_10000180 Ga0207674_1000018087 229
179 3300026142 Ga0207698_10003033 Ga0207698_100030334 229
180 3300032002 Ga0307416_100991439 Ga0307416_1009914391 229
181 3300035725 Ga0373947_0238111 Ga0373947_0238111_230_1018 229
182 3300050512 nmdc:mga0n895_83391_c1 nmdc:mga0n895_83391_c1_1022_1810 229
183 3300050513 nmdc:mga0rr50_106851_c1 nmdc:mga0rr50_106851_c1_276_1064 229
184 3300050514 nmdc:mga08x19_226839_c1 nmdc:mga08x19_226839_c1_342_1130 229
185 3300050515 nmdc:mga0a205_49770_c1 nmdc:mga0a205_49770_c1_1377_2165 229
186 3300060353 Ga0501082_0220292 Ga0501082_0220292_32_811 229
187 3300005328 Ga0070676_10066188 Ga0070676_100661882 230
188 3300005329 Ga0070683_100084263 Ga0070683_1000842632 230
189 3300005330 Ga0070690_100003383 Ga0070690_10000338310 230
190 3300005331 Ga0070670_100011869 Ga0070670_1000118699 230
191 3300005334 Ga0068869_100010630 Ga0068869_1000106304 230
192 3300005338 Ga0068868_100025470 Ga0068868_1000254704 230
193 3300005338 Ga0068868_100150233 Ga0068868_1001502332 230
194 3300005339 Ga0070660_100096973 Ga0070660_1000969732 230
195 3300005340 Ga0070689_100001808 Ga0070689_1000018081 230
196 3300005341 Ga0070691_10078918 Ga0070691_100789182 230
197 3300005343 Ga0070687_100007131 Ga0070687_1000071312 230
198 3300005355 Ga0070671_100041804 Ga0070671_1000418042 230
199 3300005356 Ga0070674_100066301 Ga0070674_1000663012 230
200 3300005364 Ga0070673_100035130 Ga0070673_1000351302 230
201 3300005365 Ga0070688_100001156 Ga0070688_1000011563 230
202 3300005434 Ga0070709_10050520 Ga0070709_100505203 230
203 3300005436 Ga0070713_100004189 Ga0070713_1000041894 230
204 3300005439 Ga0070711_100008712 Ga0070711_1000087122 230
205 3300005439 Ga0070711_100385820 Ga0070711_1003858202 230
206 3300005455 Ga0070663_100257205 Ga0070663_1002572052 230
207 3300005456 Ga0070678_100009548 Ga0070678_1000095488 230
208 3300005457 Ga0070662_100001751 Ga0070662_1000017512 230
209 3300005459 Ga0068867_100223386 Ga0068867_1002233862 230
210 3300005466 Ga0070685_10002325 Ga0070685_100023258 230
211 3300005535 Ga0070684_100186839 Ga0070684_1001868392 230
212 3300005539 Ga0068853_100764847 Ga0068853_1007648471 230
213 3300005545 Ga0070695_100441127 Ga0070695_1004411272 230
214 3300005547 Ga0070693_100003077 Ga0070693_1000030779 230
215 3300005548 Ga0070665_100010753 Ga0070665_1000107536 230
216 3300005549 Ga0070704_100350105 Ga0070704_1003501051 230
217 3300005563 Ga0068855_100690281 Ga0068855_1006902812 230
218 3300005614 Ga0068856_100259851 Ga0068856_1002598511 230
219 3300005615 Ga0070702_100056723 Ga0070702_1000567232 230
220 3300005617 Ga0068859_100102571 Ga0068859_1001025712 230
221 3300005618 Ga0068864_100001675 Ga0068864_10000167516 230
222 3300005718 Ga0068866_10016521 Ga0068866_100165215 230
223 3300005719 Ga0068861_100241662 Ga0068861_1002416622 230
224 3300005841 Ga0068863_100001174 Ga0068863_10000117418 230
225 3300005842 Ga0068858_100051795 Ga0068858_1000517952 230
226 3300005843 Ga0068860_100008441 Ga0068860_1000084419 230
227 3300005843 Ga0068860_100059599 Ga0068860_1000595995 230
228 3300006163 Ga0070715_10014259 Ga0070715_100142592 230
229 3300006173 Ga0070716_100077653 Ga0070716_1000776532 230
230 3300006175 Ga0070712_100064311 Ga0070712_1000643113 230
231 3300006358 Ga0068871_100033693 Ga0068871_1000336932 230
232 3300006931 Ga0097620_100102574 Ga0097620_1001025744 230
233 3300009098 Ga0105245_10004136 Ga0105245_100041369 230
234 3300009101 Ga0105247_10005328 Ga0105247_100053289 230
235 3300009176 Ga0105242_10120603 Ga0105242_101206032 230
236 3300009177 Ga0105248_10093968 Ga0105248_100939683 230
237 3300009551 Ga0105238_10125099 Ga0105238_101250992 230
238 3300010375 Ga0105239_10303532 Ga0105239_103035322 230
239 3300011119 Ga0105246_10031481 Ga0105246_100314814 230
240 3300011119 Ga0105246_10043977 Ga0105246_100439772 230
241 3300013100 Ga0157373_10160433 Ga0157373_101604332 230
242 3300013100 Ga0157373_10294651 Ga0157373_102946512 230
243 3300013102 Ga0157371_10193486 Ga0157371_101934862 230
244 3300013105 Ga0157369_10052080 Ga0157369_100520802 230
245 3300013296 Ga0157374_10007812 Ga0157374_100078129 230
246 3300013306 Ga0163162_10004891 Ga0163162_100048919 230
247 3300013308 Ga0157375_10006699 Ga0157375_1000669911 230
248 3300014325 Ga0163163_10000834 Ga0163163_1000083418 230
249 3300014969 Ga0157376_10005094 Ga0157376_100050943 230
250 3300017792 Ga0163161_10054808 Ga0163161_100548082 230
251 3300025900 Ga0207710_10084046 Ga0207710_100840462 230
252 3300025903 Ga0207680_10056433 Ga0207680_100564333 230
253 3300025903 Ga0207680_10265463 Ga0207680_102654632 230
254 3300025905 Ga0207685_10007960 Ga0207685_100079602 230
255 3300025906 Ga0207699_10439694 Ga0207699_104396942 230
256 3300025907 Ga0207645_10038013 Ga0207645_100380133 230
257 3300025911 Ga0207654_10057481 Ga0207654_100574813 230
258 3300025912 Ga0207707_10046973 Ga0207707_100469734 230
259 3300025915 Ga0207693_10003162 Ga0207693_100031629 230
260 3300025916 Ga0207663_10217211 Ga0207663_102172112 230
261 3300025916 Ga0207663_10278123 Ga0207663_102781232 230
262 3300025918 Ga0207662_10019927 Ga0207662_100199272 230
263 3300025927 Ga0207687_10003789 Ga0207687_100037892 230
264 3300025927 Ga0207687_10004961 Ga0207687_100049618 230
265 3300025928 Ga0207700_10012983 Ga0207700_100129834 230
266 3300025929 Ga0207664_10013621 Ga0207664_100136212 230
267 3300025931 Ga0207644_10022542 Ga0207644_100225424 230
268 3300025933 Ga0207706_10006651 Ga0207706_1000665110 230
269 3300025934 Ga0207686_10022739 Ga0207686_100227395 230
270 3300025936 Ga0207670_10627296 Ga0207670_106272961 230
271 3300025937 Ga0207669_10110440 Ga0207669_101104402 230
272 3300025939 Ga0207665_10015079 Ga0207665_100150795 230
273 3300025939 Ga0207665_10035099 Ga0207665_100350994 230
274 3300025940 Ga0207691_10228966 Ga0207691_102289661 230
275 3300025941 Ga0207711_10000741 Ga0207711_1000074121 230
276 3300025942 Ga0207689_10032909 Ga0207689_100329092 230
277 3300025944 Ga0207661_10256591 Ga0207661_102565911 230
278 3300025949 Ga0207667_10563560 Ga0207667_105635602 230
279 3300025960 Ga0207651_10003828 Ga0207651_100038284 230
280 3300025986 Ga0207658_10159105 Ga0207658_101591052 230
281 3300026023 Ga0207677_10000945 Ga0207677_100009459 230
282 3300026023 Ga0207677_10138521 Ga0207677_101385212 230
283 3300026035 Ga0207703_10003665 Ga0207703_100036652 230
284 3300026041 Ga0207639_10114920 Ga0207639_101149202 230
285 3300026067 Ga0207678_10212249 Ga0207678_102122492 230
286 3300026078 Ga0207702_10158973 Ga0207702_101589732 230
287 3300026078 Ga0207702_10474978 Ga0207702_104749781 230
288 3300026088 Ga0207641_10004463 Ga0207641_1000446311 230
289 3300026089 Ga0207648_10131514 Ga0207648_101315142 230
290 3300026095 Ga0207676_10000576 Ga0207676_1000057615 230
291 3300026142 Ga0207698_10654572 Ga0207698_106545722 230
292 3300028379 Ga0268266_10040289 Ga0268266_100402894 230
293 3300028381 Ga0268264_10006545 Ga0268264_100065454 230
294 3300028381 Ga0268264_10021391 Ga0268264_100213914 230
295 3300035086 Ga0373934_0008635 Ga0373934_0008635_2546_3337 230
296 3300035111 Ga0373923_0008271 Ga0373923_0008271_433_1224 230
297 3300035116 Ga0373945_0028518 Ga0373945_0028518_698_1489 230
298 3300035117 Ga0373953_0011491 Ga0373953_0011491_1751_2542 230
299 3300035118 Ga0373954_0026942 Ga0373954_0026942_217_1008 230
300 3300035119 Ga0373956_0006099 Ga0373956_0006099_3929_4720 230
301 3300035120 Ga0373957_0004355 Ga0373957_0004355_1649_2440 230
302 3300035170 Ga0373943_0022232 Ga0373943_0022232_227_1018 230
303 3300035171 Ga0373946_0013246 Ga0373946_0013246_1565_2356 230
304 3300035172 Ga0373955_0012521 Ga0373955_0012521_1662_2453 230
305 3300035692 Ga0373935_0014581 Ga0373935_0014581_2738_3529 230
306 3300035724 Ga0373933_0005336 Ga0373933_0005336_940_1731 230
307 3300037068 Ga0373925_0071423 Ga0373925_0071423_820_1611 230
308 3300037068 Ga0373925_0138667 Ga0373925_0138667_806_1597 230
309 3300046476 Ga0495662_0113393 Ga0495662_0113393_93_884 230
310 3300046477 Ga0495664_0044588 Ga0495664_0044588_783_1574 230
311 3300046511 Ga0495608_0255529 Ga0495608_0255529_291_1082 230
312 3300046517 Ga0495630_0154444 Ga0495630_0154444_882_1673 230
313 3300046525 Ga0495663_0060283 Ga0495663_0060283_89_880 230
314 3300046543 Ga0495645_0006508 Ga0495645_0006508_457_1248 230
315 3300046543 Ga0495645_0181773 Ga0495645_0181773_630_1421 230
316 3300046663 Ga0495635_0093885 Ga0495635_0093885_281_1072 230
317 3300046679 Ga0495623_0071625 Ga0495623_0071625_1325_2116 230
318 3300046684 Ga0495669_0193979 Ga0495669_0193979_92_883 230
319 3300047319 Ga0495674_0068559 Ga0495674_0068559_1146_1937 230
320 3300048088 Ga0495602_0082816 Ga0495602_0082816_1057_1848 230
321 3300048904 Ga0496101_0012964 Ga0496101_0012964_502_1293 230
322 3300048904 Ga0496101_0189478 Ga0496101_0189478_257_1072 230
323 3300048905 Ga0496102_0403235 Ga0496102_0403235_389_1183 230
324 3300048907 Ga0496104_0020188 Ga0496104_0020188_815_1606 230
325 3300048908 Ga0496105_0093814 Ga0496105_0093814_22_813 230
326 3300048910 Ga0496107_0006584 Ga0496107_0006584_462_1253 230
327 3300048911 Ga0496108_0057427 Ga0496108_0057427_1881_2672 230
328 3300048912 Ga0496109_0044266 Ga0496109_0044266_2511_3302 230
329 3300048915 Ga0496112_0001998 Ga0496112_0001998_8465_9256 230
330 3300048917 Ga0496114_0209004 Ga0496114_0209004_155_946 230
331 3300048918 Ga0496115_0026872 Ga0496115_0026872_1942_2733 230
332 3300048918 Ga0496115_0585826 Ga0496115_0585826_46_834 230
333 3300050512 nmdc:mga0n895_167293_c1 nmdc:mga0n895_167293_c1_1127_1918 230
334 3300053077 Ga0495601_0029882 Ga0495601_0029882_1519_2310 230
335 3300005334 Ga0068869_100293763 Ga0068869_1002937631 231
336 3300005366 Ga0070659_100252064 Ga0070659_1002520641 231
337 3300025898 Ga0207692_10030021 Ga0207692_100300213 231
338 3300025908 Ga0207643_10007598 Ga0207643_100075984 231
339 3300025910 Ga0207684_10250545 Ga0207684_102505452 231
340 3300025922 Ga0207646_10351090 Ga0207646_103510901 231
341 3300025926 Ga0207659_10045840 Ga0207659_100458402 231
342 3300025934 Ga0207686_10282444 Ga0207686_102824442 231
343 3300025940 Ga0207691_10040366 Ga0207691_100403662 231
344 3300026116 Ga0207674_10139657 Ga0207674_101396572 231
345 3300031548 Ga0307408_100411236 Ga0307408_1004112362 231
346 3300031731 Ga0307405_10134498 Ga0307405_101344982 231
347 3300031852 Ga0307410_10090206 Ga0307410_100902062 231
348 3300031995 Ga0307409_100272864 Ga0307409_1002728642 231
349 3300032002 Ga0307416_100495034 Ga0307416_1004950342 231
350 3300032004 Ga0307414_10135432 Ga0307414_101354322 231
351 3300032005 Ga0307411_10026811 Ga0307411_100268112 231
352 3300032005 Ga0307411_10288275 Ga0307411_102882752 231
353 3300048914 Ga0496111_0030710 Ga0496111_0030710_56_787 231
354 3300005335 Ga0070666_10089480 Ga0070666_100894802 233
355 3300005355 Ga0070671_100004251 Ga0070671_1000042515 233
356 3300005364 Ga0070673_100027621 Ga0070673_1000276215 233
357 3300005434 Ga0070709_10265460 Ga0070709_102654602 233
358 3300005456 Ga0070678_100324932 Ga0070678_1003249322 233
359 3300005543 Ga0070672_100037494 Ga0070672_1000374942 233
360 3300006237 Ga0097621_100217437 Ga0097621_1002174372 233
361 3300006358 Ga0068871_100273771 Ga0068871_1002737712 233
362 3300009177 Ga0105248_10000874 Ga0105248_1000087438 233
363 3300013104 Ga0157370_10002272 Ga0157370_1000227219 233
364 3300013308 Ga0157375_10038782 Ga0157375_100387823 233
365 3300025903 Ga0207680_10020719 Ga0207680_100207193 233
366 3300025906 Ga0207699_10281538 Ga0207699_102815382 233
367 3300025931 Ga0207644_10004041 Ga0207644_100040416 233
368 3300025940 Ga0207691_10038833 Ga0207691_100388335 233
369 3300025941 Ga0207711_10002533 Ga0207711_100025337 233
370 3300025960 Ga0207651_10010539 Ga0207651_100105396 233
371 3300026121 Ga0207683_10433641 Ga0207683_104336411 233
372 3300026121 Ga0207683_10532777 Ga0207683_105327772 233
373 3300027543 Ga0209999_1006505 Ga0209999_10065052 233
374 3300005327 Ga0070658_10030463 Ga0070658_100304632 234
375 3300005329 Ga0070683_100007878 Ga0070683_1000078789 234
376 3300005337 Ga0070682_100068279 Ga0070682_1000682792 234
377 3300005339 Ga0070660_100087563 Ga0070660_1000875631 234
378 3300005341 Ga0070691_10085439 Ga0070691_100854392 234
379 3300005344 Ga0070661_100022392 Ga0070661_1000223924 234
380 3300005347 Ga0070668_100379566 Ga0070668_1003795662 234
381 3300005354 Ga0070675_100007513 Ga0070675_1000075134 234
382 3300005364 Ga0070673_100026489 Ga0070673_1000264893 234
383 3300005364 Ga0070673_100338072 Ga0070673_1003380721 234
384 3300005366 Ga0070659_100001467 Ga0070659_10000146718 234
385 3300005434 Ga0070709_10135747 Ga0070709_101357472 234
386 3300005435 Ga0070714_100561651 Ga0070714_1005616511 234
387 3300005455 Ga0070663_100250141 Ga0070663_1002501411 234
388 3300005535 Ga0070684_100003343 Ga0070684_10000334312 234
389 3300005539 Ga0068853_100025368 Ga0068853_1000253682 234
390 3300005547 Ga0070693_100366083 Ga0070693_1003660831 234
391 3300005564 Ga0070664_100010118 Ga0070664_1000101185 234
392 3300005578 Ga0068854_100002702 Ga0068854_1000027025 234
393 3300005614 Ga0068856_100054107 Ga0068856_1000541073 234
394 3300005618 Ga0068864_100433989 Ga0068864_1004339892 234
395 3300005834 Ga0068851_10000426 Ga0068851_1000042610 234
396 3300009174 Ga0105241_10016536 Ga0105241_100165362 234
397 3300009551 Ga0105238_10074440 Ga0105238_100744403 234
398 3300010375 Ga0105239_10005432 Ga0105239_100054327 234
399 3300013100 Ga0157373_10001779 Ga0157373_100017792 234
400 3300014325 Ga0163163_10798953 Ga0163163_107989531 234
401 3300020082 Ga0206353_11578615 Ga0206353_115786154 234
402 3300025908 Ga0207643_10099912 Ga0207643_100999122 234
403 3300025909 Ga0207705_10012689 Ga0207705_100126892 234
404 3300025911 Ga0207654_10006442 Ga0207654_100064422 234
405 3300025912 Ga0207707_10026302 Ga0207707_100263026 234
406 3300025913 Ga0207695_10044873 Ga0207695_100448736 234
407 3300025917 Ga0207660_10016156 Ga0207660_100161566 234
408 3300025919 Ga0207657_10006434 Ga0207657_100064345 234
409 3300025920 Ga0207649_10031977 Ga0207649_100319772 234
410 3300025921 Ga0207652_10025106 Ga0207652_100251062 234
411 3300025924 Ga0207694_10020858 Ga0207694_100208582 234
412 3300025926 Ga0207659_10009437 Ga0207659_100094373 234
413 3300025940 Ga0207691_10479099 Ga0207691_104790992 234
414 3300025949 Ga0207667_10008794 Ga0207667_100087945 234
415 3300025972 Ga0207668_10286968 Ga0207668_102869681 234
416 3300025981 Ga0207640_10033821 Ga0207640_100338213 234
417 3300026023 Ga0207677_10204930 Ga0207677_102049302 234
418 3300026041 Ga0207639_10020442 Ga0207639_100204425 234
419 3300026067 Ga0207678_10144086 Ga0207678_101440862 234
420 3300026078 Ga0207702_10750647 Ga0207702_107506471 234
421 3300026095 Ga0207676_10117739 Ga0207676_101177392 234
422 3300026116 Ga0207674_10011211 Ga0207674_100112116 234
423 3300026142 Ga0207698_10018680 Ga0207698_100186805 234
424 3300048910 Ga0496107_0089582 Ga0496107_0089582_884_1699 234
425 3300005328 Ga0070676_10091947 Ga0070676_100919472 235
426 3300005339 Ga0070660_100044893 Ga0070660_1000448933 235
427 3300005339 Ga0070660_100167942 Ga0070660_1001679421 235
428 3300005344 Ga0070661_100033672 Ga0070661_1000336724 235
429 3300005353 Ga0070669_100340996 Ga0070669_1003409961 235
430 3300005436 Ga0070713_100015240 Ga0070713_1000152402 235
431 3300005530 Ga0070679_100130273 Ga0070679_1001302732 235
432 3300005563 Ga0068855_100280116 Ga0068855_1002801162 235
433 3300005617 Ga0068859_100149437 Ga0068859_1001494372 235
434 3300005618 Ga0068864_100344446 Ga0068864_1003444462 235
435 3300006931 Ga0097620_100149437 Ga0097620_1001494372 235
436 3300009148 Ga0105243_10331703 Ga0105243_103317031 235
437 3300009553 Ga0105249_10146192 Ga0105249_101461922 235
438 3300013105 Ga0157369_10125063 Ga0157369_101250631 235
439 3300014968 Ga0157379_10286523 Ga0157379_102865232 235
440 3300020070 Ga0206356_10998087 Ga0206356_109980873 235
441 3300025907 Ga0207645_10089388 Ga0207645_100893882 235
442 3300025909 Ga0207705_10305618 Ga0207705_103056181 235
443 3300025913 Ga0207695_10377756 Ga0207695_103777562 235
444 3300025914 Ga0207671_10379959 Ga0207671_103799591 235
445 3300025921 Ga0207652_10507958 Ga0207652_105079582 235
446 3300025949 Ga0207667_10067872 Ga0207667_100678722 235
447 3300035111 Ga0373923_0137666 Ga0373923_0137666_32_832 235
448 3300035120 Ga0373957_0053941 Ga0373957_0053941_582_1382 235
449 3300035172 Ga0373955_0163496 Ga0373955_0163496_497_1297 235
450 3300036401 Ga0373937_0037694 Ga0373937_0037694_1817_2617 235
451 3300048915 Ga0496112_0020364 Ga0496112_0020364_192_1022 235
452 3300048915 Ga0496112_0090231 Ga0496112_0090231_654_1517 235
453 3300048916 Ga0496113_0362424 Ga0496113_0362424_237_1100 235
454 3300005365 Ga0070688_100056869 Ga0070688_1000568692 236
455 3300028380 Ga0268265_10550067 Ga0268265_105500671 236
456 3300045976 Ga0466967_0241150 Ga0466967_0241150_42_944 236
457 3300049578 Ga0501042_0173769 Ga0501042_0173769_327_1127 236
458 3300049591 Ga0501075_0380459 Ga0501075_0380459_181_981 236
459 3300049824 Ga0501045_0291363 Ga0501045_0291363_254_1054 236
460 3300005327 Ga0070658_10284103 Ga0070658_102841032 237
461 3300005328 Ga0070676_10055232 Ga0070676_100552322 237
462 3300005328 Ga0070676_10207265 Ga0070676_102072651 237
463 3300005335 Ga0070666_10142138 Ga0070666_101421382 237
464 3300005339 Ga0070660_100258794 Ga0070660_1002587942 237
465 3300005344 Ga0070661_100015097 Ga0070661_1000150976 237
466 3300005344 Ga0070661_100073531 Ga0070661_1000735312 237
467 3300005344 Ga0070661_100138528 Ga0070661_1001385282 237
468 3300005353 Ga0070669_100227429 Ga0070669_1002274292 237
469 3300005354 Ga0070675_100174029 Ga0070675_1001740292 237
470 3300005355 Ga0070671_100010164 Ga0070671_1000101643 237
471 3300005366 Ga0070659_100004493 Ga0070659_1000044936 237
472 3300005367 Ga0070667_100087187 Ga0070667_1000871872 237
473 3300005367 Ga0070667_100245787 Ga0070667_1002457871 237
474 3300005456 Ga0070678_100480951 Ga0070678_1004809512 237
475 3300005457 Ga0070662_100000514 Ga0070662_10000051414 237
476 3300005458 Ga0070681_10302223 Ga0070681_103022232 237
477 3300005471 Ga0070698_100016516 Ga0070698_1000165168 237
478 3300005539 Ga0068853_100006454 Ga0068853_1000064545 237
479 3300005539 Ga0068853_100448099 Ga0068853_1004480991 237
480 3300005543 Ga0070672_100024607 Ga0070672_1000246073 237
481 3300005563 Ga0068855_100002141 Ga0068855_1000021412 237
482 3300005564 Ga0070664_100000603 Ga0070664_10000060315 237
483 3300005564 Ga0070664_100125443 Ga0070664_1001254433 237
484 3300005578 Ga0068854_100149633 Ga0068854_1001496332 237
485 3300005614 Ga0068856_100006811 Ga0068856_1000068117 237
486 3300005616 Ga0068852_100043121 Ga0068852_1000431212 237
487 3300005841 Ga0068863_100748589 Ga0068863_1007485891 237
488 3300005841 Ga0068863_100819936 Ga0068863_1008199361 237
489 3300006175 Ga0070712_100019900 Ga0070712_1000199005 237
490 3300006237 Ga0097621_100184539 Ga0097621_1001845392 237
491 3300006358 Ga0068871_100133841 Ga0068871_1001338412 237
492 3300006844 Ga0075428_100880926 Ga0075428_1008809261 237
493 3300009545 Ga0105237_10095861 Ga0105237_100958612 237
494 3300013104 Ga0157370_10320849 Ga0157370_103208491 237
495 3300013105 Ga0157369_10076187 Ga0157369_100761874 237
496 3300013297 Ga0157378_10200853 Ga0157378_102008532 237
497 3300014326 Ga0157380_10656824 Ga0157380_106568242 237
498 3300025903 Ga0207680_10046820 Ga0207680_100468202 237
499 3300025907 Ga0207645_10023878 Ga0207645_100238783 237
500 3300025907 Ga0207645_10039290 Ga0207645_100392903 237
501 3300025907 Ga0207645_10270973 Ga0207645_102709731 237
502 3300025909 Ga0207705_10320243 Ga0207705_103202432 237
503 3300025914 Ga0207671_10052659 Ga0207671_100526592 237
504 3300025915 Ga0207693_10017226 Ga0207693_100172264 237
505 3300025919 Ga0207657_10000838 Ga0207657_1000083815 237
506 3300025919 Ga0207657_10333476 Ga0207657_103334762 237
507 3300025920 Ga0207649_10021892 Ga0207649_100218923 237
508 3300025920 Ga0207649_10045147 Ga0207649_100451472 237
509 3300025926 Ga0207659_10094727 Ga0207659_100947272 237
510 3300025929 Ga0207664_10010569 Ga0207664_100105693 237
511 3300025931 Ga0207644_10060477 Ga0207644_100604773 237
512 3300025932 Ga0207690_10000802 Ga0207690_1000080218 237
513 3300025932 Ga0207690_10141935 Ga0207690_101419351 237
514 3300025933 Ga0207706_10000052 Ga0207706_1000005269 237
515 3300025933 Ga0207706_10150777 Ga0207706_101507772 237
516 3300025940 Ga0207691_10028016 Ga0207691_100280163 237
517 3300025945 Ga0207679_10020060 Ga0207679_100200602 237
518 3300025949 Ga0207667_10000257 Ga0207667_100002574 237
519 3300025960 Ga0207651_10069851 Ga0207651_100698512 237
520 3300025960 Ga0207651_10454584 Ga0207651_104545841 237
521 3300025986 Ga0207658_10070171 Ga0207658_100701712 237
522 3300026041 Ga0207639_10011492 Ga0207639_100114923 237
523 3300026067 Ga0207678_10192050 Ga0207678_101920502 237
524 3300026078 Ga0207702_10001528 Ga0207702_1000152814 237
525 3300026078 Ga0207702_10181992 Ga0207702_101819922 237
526 3300026116 Ga0207674_10057938 Ga0207674_100579383 237
527 3300027665 Ga0209983_1024780 Ga0209983_10247802 237
528 3300027876 Ga0209974_10018043 Ga0209974_100180432 237
529 3300028379 Ga0268266_10244360 Ga0268266_102443602 237
530 3300031548 Ga0307408_100013930 Ga0307408_1000139303 237
531 3300031731 Ga0307405_10022171 Ga0307405_100221712 237
532 3300031824 Ga0307413_10017211 Ga0307413_100172114 237
533 3300031852 Ga0307410_10001025 Ga0307410_100010259 237
534 3300031901 Ga0307406_10011580 Ga0307406_100115803 237
535 3300031903 Ga0307407_10002673 Ga0307407_100026737 237
536 3300031911 Ga0307412_10027267 Ga0307412_100272674 237
537 3300031995 Ga0307409_100077893 Ga0307409_1000778932 237
538 3300032002 Ga0307416_100008111 Ga0307416_1000081112 237
539 3300032004 Ga0307414_10007478 Ga0307414_100074784 237
540 3300032005 Ga0307411_10001635 Ga0307411_100016358 237
541 3300032126 Ga0307415_100009598 Ga0307415_1000095984 237
542 3300035114 Ga0373939_0038262 Ga0373939_0038262_248_1099 237
543 3300035170 Ga0373943_0013793 Ga0373943_0013793_921_1805 237
544 3300037068 Ga0373925_0438822 Ga0373925_0438822_185_1054 237
545 3300048909 Ga0496106_0027195 Ga0496106_0027195_3332_4183 237
546 3300048913 Ga0496110_0003478 Ga0496110_0003478_10006_10857 237
547 3300005330 Ga0070690_100060297 Ga0070690_1000602972 238
548 3300005330 Ga0070690_100126540 Ga0070690_1001265402 238
549 3300005331 Ga0070670_100022732 Ga0070670_1000227321 238
550 3300005331 Ga0070670_100053533 Ga0070670_1000535332 238
551 3300005331 Ga0070670_100394836 Ga0070670_1003948361 238
552 3300005334 Ga0068869_100025032 Ga0068869_1000250324 238
553 3300005335 Ga0070666_10068755 Ga0070666_100687552 238
554 3300005335 Ga0070666_10085648 Ga0070666_100856482 238
555 3300005338 Ga0068868_100000774 Ga0068868_10000077414 238
556 3300005338 Ga0068868_100245656 Ga0068868_1002456561 238
557 3300005340 Ga0070689_100024846 Ga0070689_1000248462 238
558 3300005343 Ga0070687_100001561 Ga0070687_1000015612 238
559 3300005347 Ga0070668_100001676 Ga0070668_1000016766 238
560 3300005347 Ga0070668_100008748 Ga0070668_1000087483 238
561 3300005347 Ga0070668_100032153 Ga0070668_1000321532 238
562 3300005353 Ga0070669_100001056 Ga0070669_1000010568 238
563 3300005354 Ga0070675_100009354 Ga0070675_1000093548 238
564 3300005354 Ga0070675_100208989 Ga0070675_1002089891 238
565 3300005354 Ga0070675_100486603 Ga0070675_1004866032 238
566 3300005355 Ga0070671_100010609 Ga0070671_1000106099 238
567 3300005355 Ga0070671_100097929 Ga0070671_1000979293 238
568 3300005356 Ga0070674_100023151 Ga0070674_1000231512 238
569 3300005356 Ga0070674_100063712 Ga0070674_1000637122 238
570 3300005356 Ga0070674_100134875 Ga0070674_1001348751 238
571 3300005364 Ga0070673_100002518 Ga0070673_1000025182 238
572 3300005365 Ga0070688_100015810 Ga0070688_1000158104 238
573 3300005367 Ga0070667_100030206 Ga0070667_1000302061 238
574 3300005441 Ga0070700_100021682 Ga0070700_1000216822 238
575 3300005456 Ga0070678_100003815 Ga0070678_1000038158 238
576 3300005457 Ga0070662_100031526 Ga0070662_1000315261 238
577 3300005459 Ga0068867_100002175 Ga0068867_1000021755 238
578 3300005459 Ga0068867_100136723 Ga0068867_1001367232 238
579 3300005459 Ga0068867_100373023 Ga0068867_1003730232 238
580 3300005459 Ga0068867_100501901 Ga0068867_1005019012 238
581 3300005543 Ga0070672_100004277 Ga0070672_1000042779 238
582 3300005543 Ga0070672_100423683 Ga0070672_1004236832 238
583 3300005544 Ga0070686_100003848 Ga0070686_1000038482 238
584 3300005548 Ga0070665_100016809 Ga0070665_1000168098 238
585 3300005548 Ga0070665_100132605 Ga0070665_1001326052 238
586 3300005548 Ga0070665_100502904 Ga0070665_1005029041 238
587 3300005563 Ga0068855_100232327 Ga0068855_1002323272 238
588 3300005563 Ga0068855_100540155 Ga0068855_1005401552 238
589 3300005617 Ga0068859_100002241 Ga0068859_10000224122 238
590 3300005618 Ga0068864_100000221 Ga0068864_10000022167 238
591 3300005618 Ga0068864_100009639 Ga0068864_10000963910 238
592 3300005618 Ga0068864_100111849 Ga0068864_1001118491 238
593 3300005718 Ga0068866_10002966 Ga0068866_100029662 238
594 3300005718 Ga0068866_10144944 Ga0068866_101449442 238
595 3300005719 Ga0068861_100046826 Ga0068861_1000468263 238
596 3300005719 Ga0068861_100297833 Ga0068861_1002978332 238
597 3300005840 Ga0068870_10354188 Ga0068870_103541881 238
598 3300005841 Ga0068863_100042055 Ga0068863_1000420552 238
599 3300005841 Ga0068863_100083587 Ga0068863_1000835873 238
600 3300005841 Ga0068863_100138251 Ga0068863_1001382513 238
601 3300005841 Ga0068863_100449999 Ga0068863_1004499992 238
602 3300005842 Ga0068858_100011271 Ga0068858_1000112719 238
603 3300005842 Ga0068858_100392942 Ga0068858_1003929422 238
604 3300005843 Ga0068860_100002991 Ga0068860_10000299112 238
605 3300005843 Ga0068860_100003223 Ga0068860_1000032236 238
606 3300005843 Ga0068860_100009595 Ga0068860_1000095952 238
607 3300005844 Ga0068862_100279792 Ga0068862_1002797922 238
608 3300006237 Ga0097621_100039465 Ga0097621_1000394653 238
609 3300006237 Ga0097621_100044014 Ga0097621_1000440144 238
610 3300006358 Ga0068871_100007334 Ga0068871_1000073348 238
611 3300006358 Ga0068871_100068352 Ga0068871_1000683522 238
612 3300006881 Ga0068865_100051841 Ga0068865_1000518412 238
613 3300006881 Ga0068865_100072564 Ga0068865_1000725642 238
614 3300006931 Ga0097620_100002241 Ga0097620_10000224122 238
615 3300009148 Ga0105243_10223486 Ga0105243_102234861 238
616 3300009177 Ga0105248_10084067 Ga0105248_100840673 238
617 3300009177 Ga0105248_10130372 Ga0105248_101303723 238
618 3300009553 Ga0105249_10309883 Ga0105249_103098832 238
619 3300013102 Ga0157371_10214942 Ga0157371_102149422 238
620 3300013296 Ga0157374_10000346 Ga0157374_1000034628 238
621 3300013297 Ga0157378_10430777 Ga0157378_104307772 238
622 3300013306 Ga0163162_10012637 Ga0163162_100126372 238
623 3300013308 Ga0157375_10028302 Ga0157375_100283024 238
624 3300013308 Ga0157375_10071036 Ga0157375_100710364 238
625 3300013308 Ga0157375_10423734 Ga0157375_104237342 238
626 3300014325 Ga0163163_10252072 Ga0163163_102520722 238
627 3300014326 Ga0157380_10232326 Ga0157380_102323262 238
628 3300014968 Ga0157379_10006330 Ga0157379_100063302 238
629 3300014968 Ga0157379_10050077 Ga0157379_100500774 238
630 3300014968 Ga0157379_10192171 Ga0157379_101921712 238
631 3300014969 Ga0157376_10126952 Ga0157376_101269523 238
632 3300025315 Ga0207697_10012830 Ga0207697_100128302 238
633 3300025899 Ga0207642_10019101 Ga0207642_100191011 238
634 3300025899 Ga0207642_10118967 Ga0207642_101189672 238
635 3300025903 Ga0207680_10042020 Ga0207680_100420203 238
636 3300025903 Ga0207680_10053505 Ga0207680_100535052 238
637 3300025907 Ga0207645_10000353 Ga0207645_100003532 238
638 3300025918 Ga0207662_10003213 Ga0207662_100032132 238
639 3300025919 Ga0207657_10001142 Ga0207657_1000114210 238
640 3300025919 Ga0207657_10024869 Ga0207657_100248696 238
641 3300025923 Ga0207681_10001804 Ga0207681_1000180415 238
642 3300025925 Ga0207650_10012394 Ga0207650_100123945 238
643 3300025925 Ga0207650_10030171 Ga0207650_100301712 238
644 3300025925 Ga0207650_10142504 Ga0207650_101425042 238
645 3300025926 Ga0207659_10029974 Ga0207659_100299744 238
646 3300025926 Ga0207659_10152880 Ga0207659_101528802 238
647 3300025931 Ga0207644_10015731 Ga0207644_100157312 238
648 3300025931 Ga0207644_10099000 Ga0207644_100990001 238
649 3300025935 Ga0207709_10225641 Ga0207709_102256412 238
650 3300025936 Ga0207670_10146943 Ga0207670_101469432 238
651 3300025937 Ga0207669_10084951 Ga0207669_100849512 238
652 3300025937 Ga0207669_10238061 Ga0207669_102380611 238
653 3300025938 Ga0207704_10019940 Ga0207704_100199402 238
654 3300025940 Ga0207691_10007196 Ga0207691_100071968 238
655 3300025940 Ga0207691_10010390 Ga0207691_100103908 238
656 3300025940 Ga0207691_10012433 Ga0207691_100124332 238
657 3300025941 Ga0207711_10043796 Ga0207711_100437964 238
658 3300025941 Ga0207711_10087248 Ga0207711_100872483 238
659 3300025941 Ga0207711_10163969 Ga0207711_101639692 238
660 3300025960 Ga0207651_10201751 Ga0207651_102017512 238
661 3300025960 Ga0207651_10434216 Ga0207651_104342161 238
662 3300025961 Ga0207712_10102483 Ga0207712_101024832 238
663 3300025972 Ga0207668_10010200 Ga0207668_100102002 238
664 3300025972 Ga0207668_10093761 Ga0207668_100937612 238
665 3300025986 Ga0207658_10084275 Ga0207658_100842752 238
666 3300025986 Ga0207658_10106416 Ga0207658_101064162 238
667 3300026023 Ga0207677_10003049 Ga0207677_100030498 238
668 3300026035 Ga0207703_10200916 Ga0207703_102009162 238
669 3300026041 Ga0207639_10567850 Ga0207639_105678501 238
670 3300026075 Ga0207708_10001876 Ga0207708_1000187616 238
671 3300026088 Ga0207641_10013789 Ga0207641_100137898 238
672 3300026089 Ga0207648_10000306 Ga0207648_1000030634 238
673 3300026089 Ga0207648_10000415 Ga0207648_1000041512 238
674 3300026089 Ga0207648_10487201 Ga0207648_104872012 238
675 3300026095 Ga0207676_10019358 Ga0207676_100193584 238
676 3300026095 Ga0207676_10055696 Ga0207676_100556962 238
677 3300026095 Ga0207676_10123779 Ga0207676_101237792 238
678 3300026118 Ga0207675_100190804 Ga0207675_1001908042 238
679 3300026118 Ga0207675_100307472 Ga0207675_1003074722 238
680 3300026121 Ga0207683_10000661 Ga0207683_100006612 238
681 3300026121 Ga0207683_10016177 Ga0207683_100161774 238
682 3300027682 Ga0209971_1002855 Ga0209971_10028554 238
683 3300028379 Ga0268266_10052156 Ga0268266_100521563 238
684 3300028379 Ga0268266_10254006 Ga0268266_102540062 238
685 3300028380 Ga0268265_10013552 Ga0268265_100135527 238
686 3300028380 Ga0268265_10128036 Ga0268265_101280362 238
687 3300028381 Ga0268264_10002914 Ga0268264_100029148 238
688 3300028381 Ga0268264_10021523 Ga0268264_100215233 238
689 3300035724 Ga0373933_0040116 Ga0373933_0040116_176_976 238
690 3300037418 Ga0395900_0494649 Ga0395900_0494649_290_1120 238
691 3300038443 Ga0395901_0045268 Ga0395901_0045268_1177_2007 238
692 3300041512 Ga0451853_1018540 Ga0451853_1018540_60_878 238
693 3300048903 Ga0496100_0385492 Ga0496100_0385492_40_840 238
694 3300048908 Ga0496105_0171595 Ga0496105_0171595_800_1615 238
695 3300048912 Ga0496109_0161442 Ga0496109_0161442_857_1675 238
696 3300048913 Ga0496110_0052969 Ga0496110_0052969_587_1402 238
697 3300048916 Ga0496113_0462969 Ga0496113_0462969_13_831 238
698 3300048917 Ga0496114_0065480 Ga0496114_0065480_336_1151 238
699 3300005327 Ga0070658_10009827 Ga0070658_100098278 239
700 3300005329 Ga0070683_100031286 Ga0070683_1000312863 239
701 3300005329 Ga0070683_100036305 Ga0070683_1000363052 239
702 3300005329 Ga0070683_100494874 Ga0070683_1004948741 239
703 3300005331 Ga0070670_100024174 Ga0070670_1000241744 239
704 3300005333 Ga0070677_10006409 Ga0070677_100064093 239
705 3300005334 Ga0068869_100008302 Ga0068869_1000083025 239
706 3300005338 Ga0068868_100027999 Ga0068868_1000279992 239
707 3300005339 Ga0070660_100007823 Ga0070660_1000078238 239
708 3300005344 Ga0070661_100029753 Ga0070661_1000297533 239
709 3300005354 Ga0070675_100089321 Ga0070675_1000893213 239
710 3300005354 Ga0070675_100127743 Ga0070675_1001277432 239
711 3300005366 Ga0070659_100194963 Ga0070659_1001949632 239
712 3300005435 Ga0070714_100340993 Ga0070714_1003409932 239
713 3300005455 Ga0070663_100008052 Ga0070663_1000080524 239
714 3300005457 Ga0070662_100056698 Ga0070662_1000566983 239
715 3300005458 Ga0070681_10007078 Ga0070681_100070786 239
716 3300005466 Ga0070685_10004300 Ga0070685_100043004 239
717 3300005535 Ga0070684_100153991 Ga0070684_1001539912 239
718 3300005546 Ga0070696_100060402 Ga0070696_1000604021 239
719 3300005547 Ga0070693_100268951 Ga0070693_1002689511 239
720 3300005548 Ga0070665_100073634 Ga0070665_1000736342 239
721 3300005563 Ga0068855_100055069 Ga0068855_1000550693 239
722 3300005563 Ga0068855_100168104 Ga0068855_1001681042 239
723 3300005563 Ga0068855_100318761 Ga0068855_1003187612 239
724 3300005564 Ga0070664_100019423 Ga0070664_1000194234 239
725 3300005577 Ga0068857_100043571 Ga0068857_1000435712 239
726 3300005578 Ga0068854_100097481 Ga0068854_1000974812 239
727 3300005615 Ga0070702_100014400 Ga0070702_1000144004 239
728 3300005616 Ga0068852_100004904 Ga0068852_1000049046 239
729 3300005617 Ga0068859_100653473 Ga0068859_1006534732 239
730 3300005618 Ga0068864_100037672 Ga0068864_1000376722 239
731 3300005618 Ga0068864_100050789 Ga0068864_1000507893 239
732 3300005719 Ga0068861_100114407 Ga0068861_1001144072 239
733 3300005834 Ga0068851_10002987 Ga0068851_100029877 239
734 3300005840 Ga0068870_10001530 Ga0068870_100015308 239
735 3300005842 Ga0068858_100070407 Ga0068858_1000704072 239
736 3300005843 Ga0068860_100038199 Ga0068860_1000381992 239
737 3300006881 Ga0068865_100019734 Ga0068865_1000197343 239
738 3300006931 Ga0097620_100653476 Ga0097620_1006534762 239
739 3300009093 Ga0105240_10079605 Ga0105240_100796052 239
740 3300009094 Ga0111539_10013935 Ga0111539_100139358 239
741 3300009174 Ga0105241_10154028 Ga0105241_101540282 239
742 3300009176 Ga0105242_10067456 Ga0105242_100674563 239
743 3300010375 Ga0105239_10116379 Ga0105239_101163792 239
744 3300013104 Ga0157370_10019529 Ga0157370_100195293 239
745 3300013104 Ga0157370_10028265 Ga0157370_100282653 239
746 3300013105 Ga0157369_10020274 Ga0157369_100202745 239
747 3300013307 Ga0157372_10124136 Ga0157372_101241362 239
748 3300014326 Ga0157380_10170274 Ga0157380_101702742 239
749 3300014745 Ga0157377_10019007 Ga0157377_100190074 239
750 3300014968 Ga0157379_10029616 Ga0157379_100296163 239
751 3300017792 Ga0163161_10008971 Ga0163161_100089713 239
752 3300025315 Ga0207697_10000020 Ga0207697_1000002051 239
753 3300025321 Ga0207656_10004889 Ga0207656_100048892 239
754 3300025893 Ga0207682_10000288 Ga0207682_100002881 239
755 3300025904 Ga0207647_10077221 Ga0207647_100772212 239
756 3300025907 Ga0207645_10004764 Ga0207645_100047644 239
757 3300025908 Ga0207643_10000131 Ga0207643_100001318 239
758 3300025909 Ga0207705_10193168 Ga0207705_101931682 239
759 3300025912 Ga0207707_10022803 Ga0207707_100228035 239
760 3300025919 Ga0207657_10014488 Ga0207657_100144888 239
761 3300025921 Ga0207652_10031346 Ga0207652_100313462 239
762 3300025925 Ga0207650_10002600 Ga0207650_100026002 239
763 3300025925 Ga0207650_10279858 Ga0207650_102798582 239
764 3300025926 Ga0207659_10006674 Ga0207659_100066748 239
765 3300025932 Ga0207690_10044895 Ga0207690_100448952 239
766 3300025933 Ga0207706_10002570 Ga0207706_100025708 239
767 3300025936 Ga0207670_10009886 Ga0207670_100098866 239
768 3300025942 Ga0207689_10000091 Ga0207689_1000009138 239
769 3300025942 Ga0207689_10357700 Ga0207689_103577002 239
770 3300025949 Ga0207667_10180698 Ga0207667_101806982 239
771 3300025949 Ga0207667_10212173 Ga0207667_102121731 239
772 3300025949 Ga0207667_10229175 Ga0207667_102291752 239
773 3300025986 Ga0207658_10015481 Ga0207658_100154813 239
774 3300026035 Ga0207703_10078779 Ga0207703_100787792 239
775 3300026067 Ga0207678_10000257 Ga0207678_1000025733 239
776 3300026067 Ga0207678_10121935 Ga0207678_101219352 239
777 3300026078 Ga0207702_10012902 Ga0207702_100129027 239
778 3300026088 Ga0207641_10076457 Ga0207641_100764572 239
779 3300026095 Ga0207676_10032258 Ga0207676_100322582 239
780 3300026116 Ga0207674_10011959 Ga0207674_100119597 239
781 3300026116 Ga0207674_10116219 Ga0207674_101162193 239
782 3300026118 Ga0207675_100002299 Ga0207675_10000229911 239
783 3300026142 Ga0207698_10114013 Ga0207698_101140132 239
784 3300036401 Ga0373937_0134579 Ga0373937_0134579_1252_2115 239
785 3300046539 Ga0495621_0001838 Ga0495621_0001838_2297_3148 239
786 3300048903 Ga0496100_0025850 Ga0496100_0025850_2664_3515 239
787 3300048904 Ga0496101_0125400 Ga0496101_0125400_64_915 239
788 3300048905 Ga0496102_0095244 Ga0496102_0095244_1779_2615 239
789 3300048907 Ga0496104_0003498 Ga0496104_0003498_2284_3135 239
790 3300048910 Ga0496107_0183841 Ga0496107_0183841_365_1216 239
791 3300048911 Ga0496108_0014945 Ga0496108_0014945_3406_4257 239
792 3300048912 Ga0496109_0004927 Ga0496109_0004927_9316_10167 239
793 3300048917 Ga0496114_0020599 Ga0496114_0020599_1898_2749 239
794 3300050511 nmdc:mga08y16_25446_c1 nmdc:mga08y16_25446_c1_3325_4176 239
795 3300053084 Ga0495595_0026173 Ga0495595_0026173_260_1123 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13098

Thioredoxin_2

Thioredoxin-like domain

148

272

0.98

PF10411

DsbC_N

Disulfide bond isomerase protein N-terminal domain

46

125

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gv1-assembly1.cif.gz_A crystal structure of disulfide interchange protein from neisseria gonorrhoeae 0.9326 91 227
3gv1-assembly1.cif.gz_A crystal structure of disulfide interchange protein from neisseria gonorrhoeae 0.9075 91 227
4n30-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa dsba2 0.7779 98 226
7x36-assembly1.cif.gz_B crystal structure of hetero-diels-alderase eupff 0.7461 29 63
1z6m-assembly1.cif.gz_A structure of conserved protein of unknown function from enterococcus faecalis v583 0.74 84 225
ID Description Score Start End Superfamily
3gv1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9257 93 227 3.40.30.10
3gv1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8931 93 227 3.40.30.10
4npbB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8395 97 226 3.40.30.10
4npbB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7985 97 226 3.40.30.10
4mlyA02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7842 97 225 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3S9NJ89-F1-model_v4 Thiol:disulfide interchange protein 0.9802 92 164 GO:0042597
AF-A0A1S8CT32-F1-model_v4 Thiol:disulfide interchange protein 0.9711 86 224 GO:0042597
AF-A0A3P3ZP77-F1-model_v4 Putative thiol:disulfide interchange protein DsbC 0.9624 97 224
AF-A0A109DZH5-F1-model_v4 deleted 0.9623 94 225
AF-A0A7Y4SAH2-F1-model_v4 Thiol:disulfide interchange protein 0.9605 81 227 GO:0042597

Feature Viewer

pLDDT pTM Quality
90.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map