F481138

General Info

Members Datasets Scaffolds Average Seq Length
795 294 1590 330

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10095436|Ga0157372_100954364
Length 346
Sequence LHNNAATASVVRGHRGRYRMKTIELDVVATRGDEIESRHQVHAAIVGADDTMIAASRDARLVTSWRSCAKPFQVMPFLNSGAFDDLHWGDDQLALACASHGGEPEHVAIAGAMLRDIGLEEGDLACGPHDPLSARGMKVLRESGARLTRLHNNCSGKHAAMLARAQTAGWPTYGYERRDHQVQRCCLTSVATWADLDESSVGQAVDGCGVVAFALPLENMARAWSRFARGDGDDAAARILNAMRTRPFLIGGTDRFDSILIEETEGQVVAKIGAEGVHCVAVPELGLGIAVKVDDGAQRAQFPAVIRVLQAFDVLPADLSPRLEDFLRRPVRNTRGEVVGEVRLVA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
272 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
273 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
274 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
275 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
276 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
279 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
280 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10095436 3300013307 Bacteria 3388
2 JGI25406J46586_10021056 3300003203 Bacteria 2623
3 Ga0065712_10121841 3300005290 Unclassified 1659
4 Ga0065715_10011238 3300005293 Bacteria 3855
5 Ga0070658_10039871 3300005327 Unclassified 3789
6 Ga0070658_10240744 3300005327 Bacteria 1533
7 Ga0070676_10008120 3300005328 Bacteria 5647
8 Ga0070676_10046161 3300005328 Bacteria 2539
9 Ga0070683_100000681 3300005329 Bacteria 24634
10 Ga0070683_100001177 3300005329 Bacteria 19836
11 Ga0070683_100010079 3300005329 Bacteria 8106
12 Ga0070683_100012783 3300005329 Bacteria 7303
13 Ga0070683_100022880 3300005329 Bacteria 5589
14 Ga0070683_100036055 3300005329 Bacteria 4524
15 Ga0070683_100137602 3300005329 Unclassified 2313
16 Ga0070683_100270124 3300005329 Bacteria 1617
17 Ga0070683_100313033 3300005329 Bacteria 1494
18 Ga0070690_100056053 3300005330 Unclassified 2526
19 Ga0070690_100074753 3300005330 Bacteria 2207
20 Ga0070690_100078182 3300005330 Bacteria 2161
21 Ga0070670_100017733 3300005331 Bacteria 6108
22 Ga0070670_100021287 3300005331 Bacteria 5579
23 Ga0068869_100000336 3300005334 Bacteria 25057
24 Ga0068869_100003185 3300005334 Bacteria 10023
25 Ga0070680_100000247 3300005336 Bacteria 35633
26 Ga0070680_100009088 3300005336 Bacteria 7619
27 Ga0070680_100015569 3300005336 Bacteria 5966
28 Ga0070680_100016663 3300005336 Bacteria 5787
29 Ga0070682_100006710 3300005337 Bacteria 6454
30 Ga0070682_100009481 3300005337 Bacteria 5508
31 Ga0070682_100019512 3300005337 Bacteria 3978
32 Ga0070682_100062296 3300005337 Bacteria 2362
33 Ga0068868_100037170 3300005338 Bacteria 3774
34 Ga0068868_100195117 3300005338 Bacteria 1685
35 Ga0070660_100025284 3300005339 Bacteria 4412
36 Ga0070660_100043773 3300005339 Bacteria 3422
37 Ga0070660_100055172 3300005339 Bacteria 3070
38 Ga0070660_100065621 3300005339 Bacteria 2825
39 Ga0070689_100003792 3300005340 Bacteria 10123
40 Ga0070689_100009066 3300005340 Bacteria 7042
41 Ga0070689_100338485 3300005340 Bacteria 1260
42 Ga0070687_100009043 3300005343 Bacteria 4249
43 Ga0070687_100021253 3300005343 Bacteria 3046
44 Ga0070661_100002382 3300005344 Bacteria 12899
45 Ga0070661_100005547 3300005344 Bacteria 8699
46 Ga0070661_100006614 3300005344 Bacteria 7994
47 Ga0070661_100007742 3300005344 Bacteria 7417
48 Ga0070661_100065231 3300005344 Bacteria 2675
49 Ga0070661_100066085 3300005344 Bacteria 2657
50 Ga0070661_100071129 3300005344 Unclassified 2559
51 Ga0070661_100144648 3300005344 Bacteria 1794
52 Ga0070661_100310760 3300005344 Bacteria 1229
53 Ga0070692_10006391 3300005345 Bacteria 5116
54 Ga0070692_10031608 3300005345 Bacteria 2654
55 Ga0070692_10035269 3300005345 Unclassified 2531
56 Ga0070668_100004050 3300005347 Bacteria 10850
57 Ga0070668_100084812 3300005347 Bacteria 2489
58 Ga0070669_100002374 3300005353 Bacteria 13618
59 Ga0070669_100017185 3300005353 Bacteria 5161
60 Ga0070669_100024551 3300005353 Bacteria 4322
61 Ga0070675_100000547 3300005354 Bacteria 25799
62 Ga0070675_100010741 3300005354 Bacteria 7162
63 Ga0070675_100011278 3300005354 Bacteria 6996
64 Ga0070675_100032429 3300005354 Bacteria 4228
65 Ga0070675_100344421 3300005354 Bacteria 1321
66 Ga0070671_100007736 3300005355 Bacteria 8584
67 Ga0070671_100088275 3300005355 Bacteria 2595
68 Ga0070671_100088750 3300005355 Bacteria 2588
69 Ga0070671_100180396 3300005355 Bacteria 1787
70 Ga0070674_100137325 3300005356 Unclassified 1831
71 Ga0070673_100016912 3300005364 Bacteria 5172
72 Ga0070673_100029330 3300005364 Bacteria 4102
73 Ga0070688_100007472 3300005365 Bacteria 5896
74 Ga0070688_100010739 3300005365 Bacteria 5059
75 Ga0070688_100026534 3300005365 Bacteria 3443
76 Ga0070659_100006929 3300005366 Bacteria 8206
77 Ga0070659_100082250 3300005366 Unclassified 2573
78 Ga0070659_100203832 3300005366 Bacteria 1629
79 Ga0070659_100245053 3300005366 Bacteria 1484
80 Ga0070659_100334057 3300005366 Bacteria 1269
81 Ga0070667_100004361 3300005367 Bacteria 11938
82 Ga0070667_100024900 3300005367 Bacteria 4971
83 Ga0070667_100032444 3300005367 Bacteria 4356
84 Ga0070709_10069604 3300005434 Bacteria 2267
85 Ga0070714_100108163 3300005435 Unclassified 2458
86 Ga0070701_10033040 3300005438 Unclassified 2582
87 Ga0070701_10119105 3300005438 Bacteria 1485
88 Ga0070705_100049361 3300005440 Bacteria 2443
89 Ga0070700_100175791 3300005441 Bacteria 1486
90 Ga0070708_100000056 3300005445 Bacteria 73469
91 Ga0070708_100001891 3300005445 Bacteria 16085
92 Ga0070708_100157287 3300005445 Bacteria 2117
93 Ga0070708_100248126 3300005445 Bacteria 1672
94 Ga0070663_100069158 3300005455 Unclassified 2565
95 Ga0070678_100114818 3300005456 Bacteria 2113
96 Ga0070678_100155315 3300005456 Bacteria 1848
97 Ga0070662_100010640 3300005457 Bacteria 6049
98 Ga0070662_100079870 3300005457 Bacteria 2434
99 Ga0070662_100118081 3300005457 Bacteria 2030
100 Ga0070662_100130543 3300005457 Bacteria 1937
101 Ga0070662_100135797 3300005457 Bacteria 1902
102 Ga0070662_100179382 3300005457 Bacteria 1669
103 Ga0070681_10000442 3300005458 Bacteria 33782
104 Ga0070681_10007390 3300005458 Bacteria 10739
105 Ga0070681_10009028 3300005458 Bacteria 9800
106 Ga0070681_10019983 3300005458 Bacteria 6710
107 Ga0070681_10028793 3300005458 Bacteria 5583
108 Ga0070681_10075433 3300005458 Bacteria 3332
109 Ga0070681_10091959 3300005458 Bacteria 2983
110 Ga0070681_10224320 3300005458 Unclassified 1794
111 Ga0070681_10227360 3300005458 Bacteria 1780
112 Ga0068867_100035625 3300005459 Bacteria 3611
113 Ga0068867_100039798 3300005459 Bacteria 3429
114 Ga0068867_100042966 3300005459 Bacteria 3308
115 Ga0068867_100285372 3300005459 Unclassified 1355
116 Ga0070685_10052611 3300005466 Bacteria 2357
117 Ga0070706_100040797 3300005467 Bacteria 4285
118 Ga0070707_100004331 3300005468 Bacteria 13296
119 Ga0070698_100000081 3300005471 Bacteria 73806
120 Ga0070699_100001547 3300005518 Bacteria 21039
121 Ga0070699_100121695 3300005518 Unclassified 2295
122 Ga0070679_100001084 3300005530 Bacteria 23776
123 Ga0070679_100004926 3300005530 Bacteria 12319
124 Ga0070679_100016257 3300005530 Bacteria 7169
125 Ga0070679_100033676 3300005530 Bacteria 5073
126 Ga0070679_100045506 3300005530 Bacteria 4373
127 Ga0070679_100092366 3300005530 Bacteria 3014
128 Ga0070679_100115231 3300005530 Bacteria 2673
129 Ga0070679_100126822 3300005530 Unclassified 2534
130 Ga0070679_100138937 3300005530 Bacteria 2410
131 Ga0070679_100170491 3300005530 Unclassified 2149
132 Ga0070679_100218533 3300005530 Bacteria 1867
133 Ga0070679_100301267 3300005530 Bacteria 1553
134 Ga0070679_100329968 3300005530 Bacteria 1474
135 Ga0070684_100003476 3300005535 Bacteria 11821
136 Ga0070684_100004716 3300005535 Bacteria 10413
137 Ga0070684_100005816 3300005535 Bacteria 9486
138 Ga0070684_100006298 3300005535 Bacteria 9169
139 Ga0070684_100007365 3300005535 Bacteria 8555
140 Ga0070684_100010020 3300005535 Bacteria 7492
141 Ga0070684_100012054 3300005535 Bacteria 6911
142 Ga0070684_100012209 3300005535 Bacteria 6874
143 Ga0070684_100027055 3300005535 Bacteria 4836
144 Ga0070684_100146696 3300005535 Bacteria 2136
145 Ga0070697_100268004 3300005536 Unclassified 1463
146 Ga0068853_100008061 3300005539 Bacteria 8448
147 Ga0068853_100024434 3300005539 Bacteria 5066
148 Ga0068853_100046450 3300005539 Bacteria 3724
149 Ga0068853_100338272 3300005539 Bacteria 1398
150 Ga0070672_100029789 3300005543 Bacteria 4096
151 Ga0070672_100071261 3300005543 Bacteria 2764
152 Ga0070672_100098231 3300005543 Bacteria 2371
153 Ga0070686_100046239 3300005544 Bacteria 2745
154 Ga0070686_100107649 3300005544 Bacteria 1894
155 Ga0070695_100003704 3300005545 Bacteria 8905
156 Ga0070696_100000551 3300005546 Bacteria 23823
157 Ga0070696_100002054 3300005546 Bacteria 13194
158 Ga0070665_100153704 3300005548 Bacteria 2303
159 Ga0070665_100181608 3300005548 Bacteria 2105
160 Ga0068855_100002169 3300005563 Bacteria 24243
161 Ga0068855_100138539 3300005563 Unclassified 2775
162 Ga0068855_100153803 3300005563 Bacteria 2614
163 Ga0068855_100307304 3300005563 Bacteria 1755
164 Ga0068855_100358243 3300005563 Unclassified 1605
165 Ga0070664_100005037 3300005564 Bacteria 10588
166 Ga0070664_100005450 3300005564 Bacteria 10216
167 Ga0070664_100010643 3300005564 Bacteria 7453
168 Ga0070664_100022318 3300005564 Bacteria 5219
169 Ga0070664_100026895 3300005564 Bacteria 4778
170 Ga0070664_100033122 3300005564 Bacteria 4325
171 Ga0070664_100100588 3300005564 Unclassified 2513
172 Ga0070664_100118999 3300005564 Bacteria 2311
173 Ga0070664_100127605 3300005564 Bacteria 2232
174 Ga0070664_100220331 3300005564 Bacteria 1697
175 Ga0068857_100003188 3300005577 Bacteria 13600
176 Ga0068857_100009559 3300005577 Bacteria 8420
177 Ga0068857_100012828 3300005577 Bacteria 7302
178 Ga0068857_100027471 3300005577 Bacteria 5020
179 Ga0068857_100030916 3300005577 Bacteria 4731
180 Ga0068854_100024335 3300005578 Bacteria 4144
181 Ga0068854_100085847 3300005578 Unclassified 2331
182 Ga0068856_100004404 3300005614 Bacteria 14032
183 Ga0068856_100032399 3300005614 Bacteria 5116
184 Ga0068856_100097012 3300005614 Bacteria 2937
185 Ga0070702_100003041 3300005615 Bacteria 7420
186 Ga0070702_100200566 3300005615 Bacteria 1320
187 Ga0068852_100005536 3300005616 Bacteria 9054
188 Ga0068852_100026250 3300005616 Bacteria 4732
189 Ga0068852_100034288 3300005616 Bacteria 4221
190 Ga0068852_100055451 3300005616 Bacteria 3421
191 Ga0068852_100084130 3300005616 Bacteria 2830
192 Ga0068859_100040566 3300005617 Bacteria 4672
193 Ga0068859_100114616 3300005617 Bacteria 2759
194 Ga0068859_100132524 3300005617 Bacteria 2564
195 Ga0068859_100529165 3300005617 Bacteria 1274
196 Ga0068864_100029675 3300005618 Bacteria 4634
197 Ga0068864_100155041 3300005618 Bacteria 2078
198 Ga0068866_10090812 3300005718 Unclassified 1663
199 Ga0068861_100014363 3300005719 Bacteria 5557
200 Ga0068861_100031208 3300005719 Bacteria 3912
201 Ga0068851_10003188 3300005834 Bacteria 7275
202 Ga0068870_10012379 3300005840 Bacteria 3986
203 Ga0068870_10014700 3300005840 Bacteria 3702
204 Ga0068870_10052719 3300005840 Bacteria 2158
205 Ga0068863_100013838 3300005841 Bacteria 7776
206 Ga0068863_100091107 3300005841 Bacteria 2891
207 Ga0068863_100150446 3300005841 Bacteria 2227
208 Ga0068858_100012176 3300005842 Bacteria 8110
209 Ga0068858_100059628 3300005842 Bacteria 3527
210 Ga0068858_100117492 3300005842 Bacteria 2486
211 Ga0068860_100006907 3300005843 Bacteria 11382
212 Ga0068860_100014614 3300005843 Bacteria 7682
213 Ga0068860_100113914 3300005843 Unclassified 2586
214 Ga0068860_100147302 3300005843 Bacteria 2266
215 Ga0068860_100230413 3300005843 Bacteria 1800
216 Ga0068862_100008006 3300005844 Bacteria 8745
217 Ga0068862_100037281 3300005844 Bacteria 4120
218 Ga0068862_100039733 3300005844 Bacteria 3997
219 Ga0081539_10000104 3300005985 Bacteria 197478
220 Ga0081539_10012248 3300005985 Bacteria 6648
221 Ga0070717_10014768 3300006028 Bacteria 6007
222 Ga0070716_100051541 3300006173 Bacteria 2340
223 Ga0097621_100012625 3300006237 Bacteria 6269
224 Ga0068871_100020170 3300006358 Bacteria 5102
225 Ga0075428_100170939 3300006844 Bacteria 2356
226 Ga0075430_100000224 3300006846 Bacteria 39153
227 Ga0075430_100009255 3300006846 Bacteria 8327
228 Ga0075430_100024856 3300006846 Bacteria 5095
229 Ga0075430_100039628 3300006846 Bacteria 3988
230 Ga0075431_100131271 3300006847 Bacteria 2583
231 Ga0075433_10013303 3300006852 Bacteria 6686
232 Ga0075433_10208276 3300006852 Unclassified 1738
233 Ga0075433_10403565 3300006852 Unclassified 1206
234 Ga0075434_100201387 3300006871 Unclassified 2011
235 Ga0075434_100446675 3300006871 Bacteria 1314
236 Ga0075429_100064042 3300006880 Bacteria 3202
237 Ga0075429_100155586 3300006880 Bacteria 2002
238 Ga0075429_100179974 3300006880 Unclassified 1853
239 Ga0075429_100336591 3300006880 Bacteria 1321
240 Ga0075429_100371745 3300006880 Bacteria 1251
241 Ga0068865_100009369 3300006881 Bacteria 6068
242 Ga0068865_100037944 3300006881 Bacteria 3257
243 Ga0068865_100060209 3300006881 Archaea 2658
244 Ga0068865_100123076 3300006881 Bacteria 1932
245 Ga0068865_100312029 3300006881 Bacteria 1262
246 Ga0075436_100141229 3300006914 Bacteria 1693
247 Ga0097620_100040566 3300006931 Bacteria 4672
248 Ga0097620_100114617 3300006931 Bacteria 2759
249 Ga0097620_100132517 3300006931 Bacteria 2564
250 Ga0097620_100529134 3300006931 Bacteria 1274
251 Ga0075435_100228269 3300007076 Unclassified 1581
252 Ga0105240_10006020 3300009093 Bacteria 17933
253 Ga0105240_10008178 3300009093 Bacteria 15002
254 Ga0105240_10071369 3300009093 Bacteria 4296
255 Ga0105240_10134410 3300009093 Bacteria 2963
256 Ga0111539_10015785 3300009094 Bacteria 9382
257 Ga0111539_10034268 3300009094 Bacteria 6159
258 Ga0111539_10060941 3300009094 Bacteria 4471
259 Ga0111539_10112864 3300009094 Bacteria 3188
260 Ga0111539_10273478 3300009094 Bacteria 1966
261 Ga0105245_10004762 3300009098 Bacteria 11978
262 Ga0105245_10019133 3300009098 Bacteria 5996
263 Ga0105245_10028583 3300009098 Bacteria 4920
264 Ga0105245_10031642 3300009098 Bacteria 4683
265 Ga0105245_10184382 3300009098 Bacteria 1996
266 Ga0105245_10228580 3300009098 Unclassified 1798
267 Ga0114129_10039108 3300009147 Bacteria 6688
268 Ga0114129_10322326 3300009147 Unclassified 2054
269 Ga0105243_10048333 3300009148 Bacteria 3353
270 Ga0105243_10149002 3300009148 Bacteria 2005
271 Ga0105241_10000083 3300009174 Bacteria 70633
272 Ga0105241_10003558 3300009174 Bacteria 11587
273 Ga0105241_10045718 3300009174 Bacteria 3323
274 Ga0105242_10009135 3300009176 Bacteria 7613
275 Ga0105248_10015710 3300009177 Bacteria 8344
276 Ga0105248_10016255 3300009177 Bacteria 8190
277 Ga0105248_10047581 3300009177 Bacteria 4810
278 Ga0105248_10115837 3300009177 Bacteria 3023
279 Ga0105248_10212346 3300009177 Bacteria 2180
280 Ga0105248_10516568 3300009177 Bacteria 1347
281 Ga0105238_10111041 3300009551 Bacteria 2722
282 Ga0105249_10000401 3300009553 Bacteria 41704
283 Ga0105249_10025142 3300009553 Bacteria 5359
284 Ga0105249_10036717 3300009553 Bacteria 4445
285 Ga0099796_10027215 3300010159 Unclassified 1824
286 Ga0105239_10012515 3300010375 Bacteria 9450
287 Ga0105239_10252174 3300010375 Bacteria 1982
288 Ga0105246_10000533 3300011119 Bacteria 20789
289 Ga0157373_10044476 3300013100 Bacteria 3170
290 Ga0157373_10103595 3300013100 Unclassified 2001
291 Ga0157373_10153510 3300013100 Bacteria 1620
292 Ga0157371_10020222 3300013102 Bacteria 4900
293 Ga0157371_10021974 3300013102 Bacteria 4683
294 Ga0157371_10057423 3300013102 Bacteria 2760
295 Ga0157371_10133767 3300013102 Bacteria 1765
296 Ga0157370_10003194 3300013104 Bacteria 19381
297 Ga0157370_10035300 3300013104 Bacteria 4862
298 Ga0157370_10063945 3300013104 Bacteria 3484
299 Ga0157370_10193562 3300013104 Unclassified 1887
300 Ga0157369_10017079 3300013105 Bacteria 8154
301 Ga0157369_10043675 3300013105 Bacteria 4885
302 Ga0157369_10125047 3300013105 Bacteria 2727
303 Ga0157369_10202695 3300013105 Bacteria 2082
304 Ga0157369_10231304 3300013105 Bacteria 1933
305 Ga0157369_10306503 3300013105 Bacteria 1652
306 Ga0157369_10593862 3300013105 Bacteria 1143
307 Ga0157374_10046567 3300013296 Bacteria 4017
308 Ga0157378_10014072 3300013297 Bacteria 7005
309 Ga0157378_10049540 3300013297 Bacteria 3737
310 Ga0157378_10133385 3300013297 Bacteria 2301
311 Ga0163162_10006251 3300013306 Bacteria 11547
312 Ga0157372_10007785 3300013307 Bacteria 11380
313 Ga0157372_10012289 3300013307 Bacteria 9122
314 Ga0157372_10012544 3300013307 Bacteria 9025
315 Ga0157372_10014180 3300013307 Bacteria 8516
316 Ga0157372_10018962 3300013307 Bacteria 7404
317 Ga0157372_10021308 3300013307 Bacteria 7001
318 Ga0157372_10021746 3300013307 Bacteria 6933
319 Ga0157372_10036682 3300013307 Bacteria 5404
320 Ga0157372_10132875 3300013307 Bacteria 2865
321 Ga0157372_10140853 3300013307 Bacteria 2778
322 Ga0157372_10161792 3300013307 Bacteria 2587
323 Ga0157372_10187951 3300013307 Bacteria 2392
324 Ga0157372_10246721 3300013307 Bacteria 2072
325 Ga0157375_10007703 3300013308 Bacteria 9424
326 Ga0157375_10049710 3300013308 Bacteria 4110
327 Ga0157375_10105207 3300013308 Bacteria 2912
328 Ga0157375_10155663 3300013308 Bacteria 2424
329 Ga0157375_10266362 3300013308 Bacteria 1875
330 Ga0163163_10028398 3300014325 Bacteria 5371
331 Ga0163163_10050780 3300014325 Bacteria 4086
332 Ga0163163_10199473 3300014325 Bacteria 2049
333 Ga0157380_10002943 3300014326 Bacteria 11579
334 Ga0157380_10159520 3300014326 Bacteria 1959
335 Ga0157377_10001214 3300014745 Bacteria 10986
336 Ga0157377_10049104 3300014745 Unclassified 2370
337 Ga0157379_10002779 3300014968 Bacteria 14754
338 Ga0157376_10021797 3300014969 Bacteria 4980
339 Ga0157376_10234122 3300014969 Unclassified 1707
340 Ga0206353_10829339 3300020082 Bacteria 3091
341 Ga0213876_10010197 3300021384 Bacteria 5047
342 Ga0213876_10074988 3300021384 Bacteria 1787
343 Ga0207656_10008725 3300025321 Bacteria 3744
344 Ga0207682_10018006 3300025893 Bacteria 2758
345 Ga0207682_10022945 3300025893 Bacteria 2462
346 Ga0207692_10049027 3300025898 Unclassified 2129
347 Ga0207688_10008758 3300025901 Bacteria 5505
348 Ga0207680_10132463 3300025903 Unclassified 1644
349 Ga0207647_10040182 3300025904 Bacteria 2947
350 Ga0207699_10014614 3300025906 Bacteria 4053
351 Ga0207699_10087061 3300025906 Bacteria 1952
352 Ga0207645_10000246 3300025907 Bacteria 44995
353 Ga0207645_10019478 3300025907 Bacteria 4448
354 Ga0207645_10040866 3300025907 Bacteria 2970
355 Ga0207643_10005735 3300025908 Bacteria 6635
356 Ga0207643_10064492 3300025908 Bacteria 2096
357 Ga0207643_10094670 3300025908 Unclassified 1745
358 Ga0207705_10003411 3300025909 Bacteria 12083
359 Ga0207705_10027463 3300025909 Bacteria 4058
360 Ga0207705_10229487 3300025909 Bacteria 1412
361 Ga0207684_10037377 3300025910 Bacteria 4120
362 Ga0207684_10225977 3300025910 Unclassified 1615
363 Ga0207684_10350320 3300025910 Bacteria 1271
364 Ga0207654_10006351 3300025911 Bacteria 5943
365 Ga0207707_10000876 3300025912 Bacteria 29431
366 Ga0207707_10008044 3300025912 Bacteria 9158
367 Ga0207707_10008456 3300025912 Bacteria 8924
368 Ga0207707_10011039 3300025912 Bacteria 7861
369 Ga0207707_10015039 3300025912 Bacteria 6737
370 Ga0207707_10018771 3300025912 Bacteria 6030
371 Ga0207707_10034532 3300025912 Bacteria 4425
372 Ga0207707_10047323 3300025912 Bacteria 3745
373 Ga0207707_10067208 3300025912 Bacteria 3122
374 Ga0207707_10075902 3300025912 Bacteria 2933
375 Ga0207707_10234417 3300025912 Unclassified 1597
376 Ga0207695_10008377 3300025913 Bacteria 12951
377 Ga0207695_10015068 3300025913 Bacteria 9120
378 Ga0207695_10040786 3300025913 Bacteria 4973
379 Ga0207695_10202071 3300025913 Bacteria 1901
380 Ga0207693_10064328 3300025915 Bacteria 2873
381 Ga0207663_10066923 3300025916 Unclassified 2302
382 Ga0207660_10000019 3300025917 Bacteria 74841
383 Ga0207660_10003649 3300025917 Bacteria 10032
384 Ga0207660_10004394 3300025917 Bacteria 9192
385 Ga0207660_10020228 3300025917 Bacteria 4464
386 Ga0207660_10025507 3300025917 Bacteria 4013
387 Ga0207660_10029176 3300025917 Bacteria 3781
388 Ga0207660_10035590 3300025917 Bacteria 3458
389 Ga0207660_10057085 3300025917 Bacteria 2796
390 Ga0207662_10001341 3300025918 Bacteria 11871
391 Ga0207662_10005821 3300025918 Bacteria 6605
392 Ga0207662_10045751 3300025918 Bacteria 2587
393 Ga0207657_10014056 3300025919 Bacteria 7833
394 Ga0207657_10035139 3300025919 Bacteria 4498
395 Ga0207657_10047429 3300025919 Bacteria 3756
396 Ga0207657_10083504 3300025919 Bacteria 2680
397 Ga0207657_10107891 3300025919 Bacteria 2302
398 Ga0207657_10154878 3300025919 Bacteria 1864
399 Ga0207649_10001792 3300025920 Bacteria 12287
400 Ga0207649_10005674 3300025920 Bacteria 6758
401 Ga0207649_10006949 3300025920 Bacteria 6151
402 Ga0207649_10012948 3300025920 Bacteria 4648
403 Ga0207649_10022279 3300025920 Bacteria 3659
404 Ga0207649_10049177 3300025920 Bacteria 2602
405 Ga0207652_10001653 3300025921 Bacteria 19560
406 Ga0207652_10003236 3300025921 Bacteria 13519
407 Ga0207652_10010708 3300025921 Bacteria 7382
408 Ga0207652_10040959 3300025921 Bacteria 3936
409 Ga0207652_10041220 3300025921 Bacteria 3924
410 Ga0207652_10069352 3300025921 Bacteria 3061
411 Ga0207652_10175986 3300025921 Bacteria 1922
412 Ga0207652_10314401 3300025921 Bacteria 1414
413 Ga0207646_10004872 3300025922 Bacteria 14384
414 Ga0207646_10118235 3300025922 Unclassified 2381
415 Ga0207681_10004605 3300025923 Bacteria 8482
416 Ga0207681_10010274 3300025923 Bacteria 5729
417 Ga0207650_10027585 3300025925 Bacteria 4066
418 Ga0207650_10028491 3300025925 Bacteria 4005
419 Ga0207650_10343776 3300025925 Bacteria 1226
420 Ga0207659_10008740 3300025926 Bacteria 6306
421 Ga0207659_10030744 3300025926 Bacteria 3672
422 Ga0207659_10156634 3300025926 Bacteria 1784
423 Ga0207659_10330444 3300025926 Unclassified 1260
424 Ga0207687_10004209 3300025927 Bacteria 9624
425 Ga0207700_10013714 3300025928 Bacteria 5285
426 Ga0207700_10132316 3300025928 Unclassified 2038
427 Ga0207700_10175202 3300025928 Bacteria 1792
428 Ga0207664_10019391 3300025929 Bacteria 5026
429 Ga0207664_10163732 3300025929 Unclassified 1899
430 Ga0207644_10014421 3300025931 Bacteria 5287
431 Ga0207644_10061727 3300025931 Bacteria 2716
432 Ga0207690_10021155 3300025932 Bacteria 4029
433 Ga0207690_10038055 3300025932 Bacteria 3128
434 Ga0207690_10087053 3300025932 Unclassified 2197
435 Ga0207690_10108439 3300025932 Bacteria 1996
436 Ga0207690_10135469 3300025932 Bacteria 1808
437 Ga0207706_10000357 3300025933 Bacteria 49369
438 Ga0207706_10004509 3300025933 Bacteria 13079
439 Ga0207706_10031908 3300025933 Bacteria 4693
440 Ga0207706_10157211 3300025933 Bacteria 1999
441 Ga0207670_10034671 3300025936 Bacteria 3264
442 Ga0207670_10381822 3300025936 Bacteria 1122
443 Ga0207704_10011553 3300025938 Bacteria 4351
444 Ga0207704_10093293 3300025938 Bacteria 1984
445 Ga0207665_10002381 3300025939 Bacteria 12698
446 Ga0207691_10001314 3300025940 Bacteria 24795
447 Ga0207691_10001355 3300025940 Bacteria 24425
448 Ga0207691_10002440 3300025940 Bacteria 18181
449 Ga0207691_10205920 3300025940 Bacteria 1711
450 Ga0207711_10012482 3300025941 Bacteria 7060
451 Ga0207689_10000838 3300025942 Bacteria 29648
452 Ga0207689_10001360 3300025942 Bacteria 23476
453 Ga0207661_10000837 3300025944 Bacteria 20169
454 Ga0207661_10002707 3300025944 Bacteria 12194
455 Ga0207661_10002985 3300025944 Bacteria 11698
456 Ga0207661_10009644 3300025944 Bacteria 6931
457 Ga0207661_10012163 3300025944 Bacteria 6249
458 Ga0207661_10017850 3300025944 Bacteria 5260
459 Ga0207661_10139181 3300025944 Unclassified 2087
460 Ga0207661_10152940 3300025944 Unclassified 1996
461 Ga0207661_10194447 3300025944 Bacteria 1780
462 Ga0207661_10200070 3300025944 Unclassified 1756
463 Ga0207679_10001293 3300025945 Bacteria 15800
464 Ga0207679_10002934 3300025945 Bacteria 10557
465 Ga0207679_10005132 3300025945 Bacteria 8196
466 Ga0207679_10016901 3300025945 Bacteria 4851
467 Ga0207679_10044636 3300025945 Bacteria 3199
468 Ga0207679_10073037 3300025945 Bacteria 2594
469 Ga0207679_10089529 3300025945 Unclassified 2376
470 Ga0207679_10106593 3300025945 Bacteria 2203
471 Ga0207679_10281395 3300025945 Bacteria 1427
472 Ga0207667_10059187 3300025949 Bacteria 4014
473 Ga0207667_10067852 3300025949 Bacteria 3715
474 Ga0207667_10109412 3300025949 Bacteria 2850
475 Ga0207667_10142428 3300025949 Unclassified 2468
476 Ga0207667_10377247 3300025949 Bacteria 1445
477 Ga0207651_10013040 3300025960 Bacteria 4736
478 Ga0207712_10004798 3300025961 Bacteria 8542
479 Ga0207712_10089340 3300025961 Bacteria 2265
480 Ga0207640_10001447 3300025981 Bacteria 12838
481 Ga0207640_10018594 3300025981 Bacteria 4087
482 Ga0207658_10019166 3300025986 Bacteria 4731
483 Ga0207658_10029822 3300025986 Bacteria 3857
484 Ga0207658_10219604 3300025986 Bacteria 1598
485 Ga0207677_10028245 3300026023 Unclassified 3544
486 Ga0207703_10005549 3300026035 Bacteria 10126
487 Ga0207703_10060323 3300026035 Bacteria 3102
488 Ga0207703_10086685 3300026035 Bacteria 2623
489 Ga0207703_10465490 3300026035 Unclassified 1183
490 Ga0207639_10041014 3300026041 Bacteria 3460
491 Ga0207639_10290754 3300026041 Bacteria 1441
492 Ga0207678_10052781 3300026067 Bacteria 3505
493 Ga0207708_10052601 3300026075 Bacteria 3102
494 Ga0207708_10216089 3300026075 Bacteria 1534
495 Ga0207702_10008970 3300026078 Bacteria 8426
496 Ga0207702_10149450 3300026078 Bacteria 2123
497 Ga0207641_10015530 3300026088 Bacteria 6240
498 Ga0207641_10023335 3300026088 Bacteria 5098
499 Ga0207641_10120792 3300026088 Bacteria 2338
500 Ga0207641_10137355 3300026088 Bacteria 2202
501 Ga0207641_10265217 3300026088 Unclassified 1609
502 Ga0207648_10022648 3300026089 Bacteria 5639
503 Ga0207648_10043541 3300026089 Bacteria 3940
504 Ga0207648_10066857 3300026089 Bacteria 3134
505 Ga0207648_10198946 3300026089 Bacteria 1777
506 Ga0207648_10402980 3300026089 Bacteria 1240
507 Ga0207676_10006741 3300026095 Bacteria 8128
508 Ga0207676_10013795 3300026095 Bacteria 5802
509 Ga0207674_10001189 3300026116 Bacteria 33857
510 Ga0207674_10005220 3300026116 Bacteria 15462
511 Ga0207674_10012363 3300026116 Bacteria 9541
512 Ga0207674_10016525 3300026116 Bacteria 8075
513 Ga0207674_10018424 3300026116 Bacteria 7588
514 Ga0207674_10020068 3300026116 Bacteria 7229
515 Ga0207675_100000320 3300026118 Bacteria 45668
516 Ga0207675_100024660 3300026118 Bacteria 5592
517 Ga0207683_10134854 3300026121 Bacteria 2222
518 Ga0207683_10136869 3300026121 Bacteria 2205
519 Ga0207698_10018539 3300026142 Bacteria 4745
520 Ga0207698_10038232 3300026142 Bacteria 3544
521 Ga0207698_10041383 3300026142 Bacteria 3433
522 Ga0207698_10052960 3300026142 Bacteria 3112
523 Ga0207698_10073315 3300026142 Bacteria 2726
524 Ga0207698_10200092 3300026142 Bacteria 1788
525 Ga0207698_10489414 3300026142 Bacteria 1195
526 Ga0207428_10206773 3300027907 Bacteria 1476
527 Ga0268266_10065062 3300028379 Bacteria 3152
528 Ga0268265_10002328 3300028380 Bacteria 14426
529 Ga0268265_10002878 3300028380 Bacteria 12639
530 Ga0268265_10027846 3300028380 Bacteria 4039
531 Ga0268264_10007527 3300028381 Bacteria 9085
532 Ga0268264_10116498 3300028381 Bacteria 2349
533 Ga0265340_10056912 3300031247 Bacteria 1880
534 Ga0307408_100048438 3300031548 Bacteria 3049
535 Ga0307408_100095135 3300031548 Bacteria 2258
536 Ga0307408_100126618 3300031548 Bacteria 1987
537 Ga0307408_100384029 3300031548 Unclassified 1201
538 Ga0265342_10095075 3300031712 Bacteria 1704
539 Ga0307405_10006095 3300031731 Bacteria 5898
540 Ga0307405_10011026 3300031731 Bacteria 4715
541 Ga0307405_10020285 3300031731 Bacteria 3711
542 Ga0307405_10060289 3300031731 Bacteria 2394
543 Ga0307405_10145775 3300031731 Bacteria 1658
544 Ga0307405_10207669 3300031731 Bacteria 1427
545 Ga0307413_10011653 3300031824 Bacteria 4337
546 Ga0307413_10029397 3300031824 Bacteria 3073
547 Ga0307413_10143677 3300031824 Bacteria 1652
548 Ga0307410_10000204 3300031852 Bacteria 22235
549 Ga0307410_10005473 3300031852 Bacteria 6727
550 Ga0307410_10186964 3300031852 Bacteria 1572
551 Ga0307410_10332617 3300031852 Bacteria 1208
552 Ga0307406_10002087 3300031901 Bacteria 10898
553 Ga0307406_10002761 3300031901 Bacteria 9582
554 Ga0307406_10003135 3300031901 Bacteria 8987
555 Ga0307406_10007929 3300031901 Bacteria 5912
556 Ga0307406_10271528 3300031901 Bacteria 1288
557 Ga0307407_10000173 3300031903 Bacteria 19580
558 Ga0307407_10006846 3300031903 Bacteria 5110
559 Ga0307407_10017799 3300031903 Bacteria 3576
560 Ga0307407_10038949 3300031903 Bacteria 2639
561 Ga0307407_10044717 3300031903 Bacteria 2498
562 Ga0307412_10010418 3300031911 Bacteria 5354
563 Ga0307412_10068472 3300031911 Unclassified 2414
564 Ga0307412_10146371 3300031911 Bacteria 1737
565 Ga0307409_100000064 3300031995 Bacteria 38623
566 Ga0307409_100023265 3300031995 Bacteria 4289
567 Ga0307409_100038991 3300031995 Bacteria 3520
568 Ga0307409_100039847 3300031995 Bacteria 3490
569 Ga0307409_100110428 3300031995 Bacteria 2305
570 Ga0307409_100349025 3300031995 Bacteria 1395
571 Ga0307416_100002944 3300032002 Bacteria 9929
572 Ga0307416_100017933 3300032002 Bacteria 4971
573 Ga0307416_100020574 3300032002 Bacteria 4712
574 Ga0307416_100055046 3300032002 Bacteria 3201
575 Ga0307416_100225274 3300032002 Bacteria 1802
576 Ga0307414_10023255 3300032004 Bacteria 3927
577 Ga0307414_10041511 3300032004 Bacteria 3117
578 Ga0307414_10115002 3300032004 Bacteria 2057
579 Ga0307411_10053081 3300032005 Bacteria 2653
580 Ga0307411_10076380 3300032005 Bacteria 2290
581 Ga0307411_10125298 3300032005 Bacteria 1867
582 Ga0307411_10313528 3300032005 Bacteria 1263
583 Ga0307415_100001458 3300032126 Bacteria 11337
584 Ga0307415_100004895 3300032126 Bacteria 7035
585 Ga0307415_100010501 3300032126 Bacteria 5249
586 Ga0307415_100117207 3300032126 Bacteria 1988
587 Ga0373926_0044097 3300035083 Bacteria 1597
588 Ga0373934_0095134 3300035086 Bacteria 1202
589 Ga0373944_0060600 3300035089 Unclassified 1213
590 Ga0373923_0057996 3300035111 Bacteria 1638
591 Ga0373954_0029633 3300035118 Bacteria 2521
592 Ga0373956_0010506 3300035119 Bacteria 3796
593 Ga0373956_0025536 3300035119 Bacteria 2554
594 Ga0373957_0003498 3300035120 Bacteria 4651
595 Ga0373957_0017867 3300035120 Unclassified 2477
596 Ga0373957_0091197 3300035120 Bacteria 1211
597 Ga0373943_0006401 3300035170 Bacteria 5289
598 Ga0373946_0062216 3300035171 Bacteria 1591
599 Ga0373955_0002387 3300035172 Bacteria 8180
600 Ga0373955_0127862 3300035172 Bacteria 1481
601 Ga0373924_0130816 3300035410 Bacteria 1092
602 Ga0373927_0128454 3300035695 Bacteria 1655
603 Ga0373933_0005918 3300035724 Bacteria 6654
604 Ga0373933_0220197 3300035724 Bacteria 1217
605 Ga0373937_0001063 3300036401 Bacteria 23173
606 Ga0373937_0009784 3300036401 Bacteria 8358
607 Ga0373937_0382741 3300036401 Bacteria 1334
608 Ga0373925_0023376 3300037068 Bacteria 4510
609 Ga0373925_0119887 3300037068 Bacteria 2041
610 Ga0395899_0110016 3300037312 Bacteria 1982
611 Ga0395900_0066207 3300037418 Bacteria 3713
612 Ga0395905_0006883 3300037471 Bacteria 11367
613 Ga0395905_0365356 3300037471 Unclassified 1336
614 Ga0436365_0262337 3300039437 Bacteria 7273
615 Ga0436365_0433142 3300039437 Bacteria 1784
616 Ga0436365_1818520 3300039437 Bacteria 1322
617 Ga0439439_0018473 3300041406 Bacteria 1723
618 Ga0439439_0029503 3300041406 Bacteria 1392
619 Ga0439434_0004027 3300042435 Bacteria 4288
620 Ga0439434_0018127 3300042435 Bacteria 2106
621 Ga0453684_0036233 3300044712 Bacteria 6801
622 Ga0453684_0188119 3300044712 Bacteria 2417
623 Ga0451576_0055645 3300045051 Bacteria 4138
624 Ga0451576_0106572 3300045051 Bacteria 2916
625 Ga0451576_0373872 3300045051 Bacteria 1493
626 Ga0466967_0018462 3300045976 Bacteria 5576
627 Ga0466967_0147298 3300045976 Bacteria 2197
628 Ga0495592_0069656 3300046454 Bacteria 2564
629 Ga0495629_0190651 3300046459 Bacteria 1419
630 Ga0495651_0001301 3300046462 Bacteria 19332
631 Ga0495651_0051123 3300046462 Bacteria 3187
632 Ga0495651_0076573 3300046462 Bacteria 2534
633 Ga0495651_0119516 3300046462 Bacteria 1938
634 Ga0495653_0017208 3300046463 Bacteria 5878
635 Ga0495653_0224460 3300046463 Bacteria 1261
636 Ga0495580_0005339 3300046472 Bacteria 10644
637 Ga0495580_0009964 3300046472 Bacteria 7431
638 Ga0495580_0101282 3300046472 Bacteria 2003
639 Ga0495639_0008820 3300046475 Bacteria 4325
640 Ga0495639_0011312 3300046475 Bacteria 3846
641 Ga0495664_0087366 3300046477 Bacteria 1873
642 Ga0495594_0017198 3300046499 Bacteria 3817
643 Ga0495594_0070921 3300046499 Bacteria 1937
644 Ga0495594_0134775 3300046499 Bacteria 1399
645 Ga0495608_0008696 3300046511 Bacteria 7105
646 Ga0495608_0009500 3300046511 Bacteria 6795
647 Ga0495618_0046981 3300046514 Bacteria 2725
648 Ga0495618_0186174 3300046514 Bacteria 1318
649 Ga0495628_0024650 3300046516 Bacteria 4921
650 Ga0495628_0025499 3300046516 Bacteria 4829
651 Ga0495630_0030203 3300046517 Bacteria 4030
652 Ga0495630_0050381 3300046517 Bacteria 3116
653 Ga0495630_0075318 3300046517 Bacteria 2543
654 Ga0495630_0075946 3300046517 Bacteria 2531
655 Ga0495630_0143635 3300046517 Unclassified 1814
656 Ga0495663_0036584 3300046525 Bacteria 1478
657 Ga0495652_0004653 3300046529 Bacteria 13086
658 Ga0495652_0007351 3300046529 Bacteria 10157
659 Ga0495652_0018881 3300046529 Bacteria 6146
660 Ga0495652_0070538 3300046529 Bacteria 2920
661 Ga0495652_0228278 3300046529 Bacteria 1394
662 Ga0495665_0002007 3300046531 Bacteria 11006
663 Ga0495640_0089800 3300046533 Bacteria 2029
664 Ga0495640_0211627 3300046533 Bacteria 1225
665 Ga0495586_0006585 3300046535 Bacteria 6207
666 Ga0495586_0022559 3300046535 Bacteria 3360
667 Ga0495586_0178068 3300046535 Bacteria 1202
668 Ga0495587_0000269 3300046536 Bacteria 37262
669 Ga0495587_0000334 3300046536 Bacteria 33589
670 Ga0495587_0007670 3300046536 Bacteria 6982
671 Ga0495587_0083933 3300046536 Bacteria 1845
672 Ga0495587_0128778 3300046536 Bacteria 1447
673 Ga0495621_0062442 3300046539 Bacteria 1355
674 Ga0495645_0000517 3300046543 Bacteria 26623
675 Ga0495645_0000918 3300046543 Bacteria 20080
676 Ga0495645_0020739 3300046543 Bacteria 4746
677 Ga0495645_0023498 3300046543 Bacteria 4464
678 Ga0495645_0076410 3300046543 Bacteria 2409
679 Ga0495622_0077273 3300046557 Bacteria 1534
680 Ga0495667_0013252 3300046559 Bacteria 5582
681 Ga0495667_0016941 3300046559 Bacteria 4921
682 Ga0495667_0092811 3300046559 Bacteria 1954
683 Ga0495635_0000200 3300046663 Bacteria 37911
684 Ga0495635_0057114 3300046663 Bacteria 2686
685 Ga0495635_0057702 3300046663 Bacteria 2671
686 Ga0495588_0002760 3300046674 Bacteria 7538
687 Ga0495657_0001237 3300046675 Bacteria 22362
688 Ga0495657_0083842 3300046675 Bacteria 2057
689 Ga0495599_0000385 3300046678 Bacteria 25410
690 Ga0495599_0000604 3300046678 Bacteria 20459
691 Ga0495599_0004010 3300046678 Bacteria 8674
692 Ga0495599_0064948 3300046678 Bacteria 2280
693 Ga0495599_0174605 3300046678 Bacteria 1325
694 Ga0495599_0207218 3300046678 Bacteria 1203
695 Ga0495623_0000156 3300046679 Bacteria 42279
696 Ga0495623_0003214 3300046679 Bacteria 10785
697 Ga0495623_0027125 3300046679 Bacteria 3683
698 Ga0495646_0069069 3300046680 Bacteria 2085
699 Ga0495646_0081024 3300046680 Bacteria 1892
700 Ga0495658_0002228 3300046683 Bacteria 9798
701 Ga0495669_0075094 3300046684 Bacteria 1546
702 Ga0495613_0133722 3300046689 Unclassified 1775
703 Ga0495613_0160111 3300046689 Bacteria 1602
704 Ga0495600_0005770 3300046809 Bacteria 7477
705 Ga0495600_0102685 3300046809 Unclassified 1863
706 Ga0495581_0035327 3300047315 Bacteria 2892
707 Ga0495604_0004394 3300047317 Bacteria 11161
708 Ga0495604_0014501 3300047317 Bacteria 6284
709 Ga0495636_0062140 3300047318 Unclassified 1581
710 Ga0495674_0004839 3300047319 Bacteria 12950
711 Ga0495674_0095660 3300047319 Bacteria 2532
712 Ga0495674_0097329 3300047319 Bacteria 2506
713 Ga0495674_0252523 3300047319 Bacteria 1451
714 Ga0495672_0039809 3300047320 Bacteria 2856
715 Ga0495676_0195205 3300047321 Bacteria 1410
716 Ga0495680_0028925 3300047322 Bacteria 4541
717 Ga0495680_0043312 3300047322 Bacteria 3566
718 Ga0495680_0188759 3300047322 Bacteria 1483
719 Ga0495675_0058505 3300047444 Bacteria 2444
720 Ga0495675_0100124 3300047444 Bacteria 1814
721 Ga0495684_0002113 3300047471 Bacteria 15945
722 Ga0495684_0028480 3300047471 Bacteria 4288
723 Ga0495684_0037827 3300047471 Bacteria 3701
724 Ga0495684_0098433 3300047471 Bacteria 2211
725 Ga0495684_0228275 3300047471 Bacteria 1362
726 Ga0495602_0022321 3300048088 Bacteria 6198
727 Ga0495602_0100672 3300048088 Bacteria 2372
728 Ga0495602_0238270 3300048088 Bacteria 1362
729 Ga0495614_0013536 3300048089 Bacteria 3576
730 Ga0496100_0163581 3300048903 Bacteria 1597
731 Ga0496104_0122769 3300048907 Bacteria 2494
732 Ga0496104_0363303 3300048907 Unclassified 1360
733 Ga0496108_0020209 3300048911 Bacteria 5473
734 Ga0496108_0139525 3300048911 Bacteria 2088
735 Ga0496108_0196691 3300048911 Bacteria 1749
736 Ga0496109_0054858 3300048912 Bacteria 3635
737 Ga0496110_0148580 3300048913 Unclassified 2121
738 Ga0496110_0212710 3300048913 Unclassified 1758
739 Ga0496112_0000196 3300048915 Bacteria 39516
740 Ga0496112_0040201 3300048915 Bacteria 4572
741 Ga0496112_0088854 3300048915 Bacteria 3058
742 Ga0496113_0014762 3300048916 Bacteria 5343
743 Ga0496115_0023520 3300048918 Bacteria 4781
744 Ga0501033_0026915 3300049570 Bacteria 4326
745 Ga0501034_0023281 3300049571 Bacteria 6311
746 Ga0501040_0085139 3300049576 Bacteria 2194
747 Ga0501043_0094432 3300049579 Bacteria 2351
748 Ga0501047_0030185 3300049581 Bacteria 5227
749 Ga0501047_0149295 3300049581 Bacteria 2214
750 Ga0501048_0150904 3300049582 Bacteria 1644
751 Ga0501072_0257590 3300049588 Bacteria 1389
752 Ga0501076_0071229 3300049592 Bacteria 2781
753 Ga0501076_0154877 3300049592 Unclassified 1865
754 Ga0501216_001750 3300049660 Bacteria 2978
755 Ga0501217_001077 3300049661 Unclassified 4959
756 Ga0501252_006578 3300049682 Bacteria 1296
757 Ga0501257_013835 3300049686 Bacteria 1852
758 Ga0501221_000410 3300049704 Bacteria 6611
759 Ga0501234_001884 3300049707 Bacteria 3309
760 Ga0501081_0075961 3300049743 Bacteria 2346
761 Ga0501266_001068 3300049763 Bacteria 3528
762 Ga0501268_000409 3300049765 Bacteria 4597
763 Ga0501270_002122 3300049767 Bacteria 1998
764 Ga0501035_0028174 3300049822 Bacteria 5127
765 Ga0501035_0331108 3300049822 Bacteria 1278
766 Ga0501044_0042149 3300049823 Bacteria 4750
767 nmdc:mga05p37_272908_c1 3300050507 Bacteria 2020
768 nmdc:mga05p37_347349_c1 3300050507 Unclassified 1747
769 nmdc:mga09592_329806_c1 3300050508 Bacteria 1321
770 nmdc:mga0qj67_209673_c1 3300050509 Bacteria 1583
771 nmdc:mga0qj67_39857_c1 3300050509 Bacteria 3690
772 nmdc:mga0qj67_71620_c1 3300050509 Bacteria 2767
773 nmdc:mga06r32_199102_c1 3300050510 Bacteria 1991
774 nmdc:mga06r32_236996_c1 3300050510 Bacteria 1812
775 nmdc:mga06r32_85186_c1 3300050510 Unclassified 3081
776 nmdc:mga06r32_92915_c1 3300050510 Bacteria 2950
777 nmdc:mga08y16_150292_c1 3300050511 Bacteria 2421
778 nmdc:mga08y16_164016_c1 3300050511 Bacteria 2308
779 nmdc:mga08y16_447391_c1 3300050511 Bacteria 1318
780 nmdc:mga08y16_66250_c1 3300050511 Bacteria 3769
781 nmdc:mga08y16_87803_c1 3300050511 Bacteria 3240
782 nmdc:mga0n895_152714_c1 3300050512 Unclassified 2340
783 nmdc:mga0n895_18729_c1 3300050512 Bacteria 6415
784 nmdc:mga0n895_200618_c1 3300050512 Unclassified 2026
785 nmdc:mga0n895_440971_c1 3300050512 Bacteria 1315
786 nmdc:mga08x19_44349_c1 3300050514 Bacteria 2839
787 nmdc:mga0a205_153264_c1 3300050515 Unclassified 2203
788 nmdc:mga0a205_24539_c1 3300050515 Bacteria 5736
789 nmdc:mga0a205_407816_c1 3300050515 Unclassified 1222
790 Ga0495612_0006507 3300053078 Bacteria 4799
791 Ga0495595_0026088 3300053084 Bacteria 2594
792 Ga0495595_0028448 3300053084 Bacteria 2496
793 Ga0495619_0036015 3300053085 Bacteria 3221
794 Ga0495619_0184056 3300053085 Bacteria 1445
795 Ga0500583_0066036 3300053092 Unclassified 1720
796 Ga0157372_10095436
797 JGI25406J46586_10021056
798 Ga0065712_10121841
799 Ga0065715_10011238
800 Ga0070658_10039871
801 Ga0070658_10240744
802 Ga0070676_10008120
803 Ga0070676_10046161
804 Ga0070683_100000681
805 Ga0070683_100001177
806 Ga0070683_100010079
807 Ga0070683_100012783
808 Ga0070683_100022880
809 Ga0070683_100036055
810 Ga0070683_100137602
811 Ga0070683_100270124
812 Ga0070683_100313033
813 Ga0070690_100056053
814 Ga0070690_100074753
815 Ga0070690_100078182
816 Ga0070670_100017733
817 Ga0070670_100021287
818 Ga0068869_100000336
819 Ga0068869_100003185
820 Ga0070680_100000247
821 Ga0070680_100009088
822 Ga0070680_100015569
823 Ga0070680_100016663
824 Ga0070682_100006710
825 Ga0070682_100009481
826 Ga0070682_100019512
827 Ga0070682_100062296
828 Ga0068868_100037170
829 Ga0068868_100195117
830 Ga0070660_100025284
831 Ga0070660_100043773
832 Ga0070660_100055172
833 Ga0070660_100065621
834 Ga0070689_100003792
835 Ga0070689_100009066
836 Ga0070689_100338485
837 Ga0070687_100009043
838 Ga0070687_100021253
839 Ga0070661_100002382
840 Ga0070661_100005547
841 Ga0070661_100006614
842 Ga0070661_100007742
843 Ga0070661_100065231
844 Ga0070661_100066085
845 Ga0070661_100071129
846 Ga0070661_100144648
847 Ga0070661_100310760
848 Ga0070692_10006391
849 Ga0070692_10031608
850 Ga0070692_10035269
851 Ga0070668_100004050
852 Ga0070668_100084812
853 Ga0070669_100002374
854 Ga0070669_100017185
855 Ga0070669_100024551
856 Ga0070675_100000547
857 Ga0070675_100010741
858 Ga0070675_100011278
859 Ga0070675_100032429
860 Ga0070675_100344421
861 Ga0070671_100007736
862 Ga0070671_100088275
863 Ga0070671_100088750
864 Ga0070671_100180396
865 Ga0070674_100137325
866 Ga0070673_100016912
867 Ga0070673_100029330
868 Ga0070688_100007472
869 Ga0070688_100010739
870 Ga0070688_100026534
871 Ga0070659_100006929
872 Ga0070659_100082250
873 Ga0070659_100203832
874 Ga0070659_100245053
875 Ga0070659_100334057
876 Ga0070667_100004361
877 Ga0070667_100024900
878 Ga0070667_100032444
879 Ga0070709_10069604
880 Ga0070714_100108163
881 Ga0070701_10033040
882 Ga0070701_10119105
883 Ga0070705_100049361
884 Ga0070700_100175791
885 Ga0070708_100000056
886 Ga0070708_100001891
887 Ga0070708_100157287
888 Ga0070708_100248126
889 Ga0070663_100069158
890 Ga0070678_100114818
891 Ga0070678_100155315
892 Ga0070662_100010640
893 Ga0070662_100079870
894 Ga0070662_100118081
895 Ga0070662_100130543
896 Ga0070662_100135797
897 Ga0070662_100179382
898 Ga0070681_10000442
899 Ga0070681_10007390
900 Ga0070681_10009028
901 Ga0070681_10019983
902 Ga0070681_10028793
903 Ga0070681_10075433
904 Ga0070681_10091959
905 Ga0070681_10224320
906 Ga0070681_10227360
907 Ga0068867_100035625
908 Ga0068867_100039798
909 Ga0068867_100042966
910 Ga0068867_100285372
911 Ga0070685_10052611
912 Ga0070706_100040797
913 Ga0070707_100004331
914 Ga0070698_100000081
915 Ga0070699_100001547
916 Ga0070699_100121695
917 Ga0070679_100001084
918 Ga0070679_100004926
919 Ga0070679_100016257
920 Ga0070679_100033676
921 Ga0070679_100045506
922 Ga0070679_100092366
923 Ga0070679_100115231
924 Ga0070679_100126822
925 Ga0070679_100138937
926 Ga0070679_100170491
927 Ga0070679_100218533
928 Ga0070679_100301267
929 Ga0070679_100329968
930 Ga0070684_100003476
931 Ga0070684_100004716
932 Ga0070684_100005816
933 Ga0070684_100006298
934 Ga0070684_100007365
935 Ga0070684_100010020
936 Ga0070684_100012054
937 Ga0070684_100012209
938 Ga0070684_100027055
939 Ga0070684_100146696
940 Ga0070697_100268004
941 Ga0068853_100008061
942 Ga0068853_100024434
943 Ga0068853_100046450
944 Ga0068853_100338272
945 Ga0070672_100029789
946 Ga0070672_100071261
947 Ga0070672_100098231
948 Ga0070686_100046239
949 Ga0070686_100107649
950 Ga0070695_100003704
951 Ga0070696_100000551
952 Ga0070696_100002054
953 Ga0070665_100153704
954 Ga0070665_100181608
955 Ga0068855_100002169
956 Ga0068855_100138539
957 Ga0068855_100153803
958 Ga0068855_100307304
959 Ga0068855_100358243
960 Ga0070664_100005037
961 Ga0070664_100005450
962 Ga0070664_100010643
963 Ga0070664_100022318
964 Ga0070664_100026895
965 Ga0070664_100033122
966 Ga0070664_100100588
967 Ga0070664_100118999
968 Ga0070664_100127605
969 Ga0070664_100220331
970 Ga0068857_100003188
971 Ga0068857_100009559
972 Ga0068857_100012828
973 Ga0068857_100027471
974 Ga0068857_100030916
975 Ga0068854_100024335
976 Ga0068854_100085847
977 Ga0068856_100004404
978 Ga0068856_100032399
979 Ga0068856_100097012
980 Ga0070702_100003041
981 Ga0070702_100200566
982 Ga0068852_100005536
983 Ga0068852_100026250
984 Ga0068852_100034288
985 Ga0068852_100055451
986 Ga0068852_100084130
987 Ga0068859_100040566
988 Ga0068859_100114616
989 Ga0068859_100132524
990 Ga0068859_100529165
991 Ga0068864_100029675
992 Ga0068864_100155041
993 Ga0068866_10090812
994 Ga0068861_100014363
995 Ga0068861_100031208
996 Ga0068851_10003188
997 Ga0068870_10012379
998 Ga0068870_10014700
999 Ga0068870_10052719
1000 Ga0068863_100013838
1001 Ga0068863_100091107
1002 Ga0068863_100150446
1003 Ga0068858_100012176
1004 Ga0068858_100059628
1005 Ga0068858_100117492
1006 Ga0068860_100006907
1007 Ga0068860_100014614
1008 Ga0068860_100113914
1009 Ga0068860_100147302
1010 Ga0068860_100230413
1011 Ga0068862_100008006
1012 Ga0068862_100037281
1013 Ga0068862_100039733
1014 Ga0081539_10000104
1015 Ga0081539_10012248
1016 Ga0070717_10014768
1017 Ga0070716_100051541
1018 Ga0097621_100012625
1019 Ga0068871_100020170
1020 Ga0075428_100170939
1021 Ga0075430_100000224
1022 Ga0075430_100009255
1023 Ga0075430_100024856
1024 Ga0075430_100039628
1025 Ga0075431_100131271
1026 Ga0075433_10013303
1027 Ga0075433_10208276
1028 Ga0075433_10403565
1029 Ga0075434_100201387
1030 Ga0075434_100446675
1031 Ga0075429_100064042
1032 Ga0075429_100155586
1033 Ga0075429_100179974
1034 Ga0075429_100336591
1035 Ga0075429_100371745
1036 Ga0068865_100009369
1037 Ga0068865_100037944
1038 Ga0068865_100060209
1039 Ga0068865_100123076
1040 Ga0068865_100312029
1041 Ga0075436_100141229
1042 Ga0097620_100040566
1043 Ga0097620_100114617
1044 Ga0097620_100132517
1045 Ga0097620_100529134
1046 Ga0075435_100228269
1047 Ga0105240_10006020
1048 Ga0105240_10008178
1049 Ga0105240_10071369
1050 Ga0105240_10134410
1051 Ga0111539_10015785
1052 Ga0111539_10034268
1053 Ga0111539_10060941
1054 Ga0111539_10112864
1055 Ga0111539_10273478
1056 Ga0105245_10004762
1057 Ga0105245_10019133
1058 Ga0105245_10028583
1059 Ga0105245_10031642
1060 Ga0105245_10184382
1061 Ga0105245_10228580
1062 Ga0114129_10039108
1063 Ga0114129_10322326
1064 Ga0105243_10048333
1065 Ga0105243_10149002
1066 Ga0105241_10000083
1067 Ga0105241_10003558
1068 Ga0105241_10045718
1069 Ga0105242_10009135
1070 Ga0105248_10015710
1071 Ga0105248_10016255
1072 Ga0105248_10047581
1073 Ga0105248_10115837
1074 Ga0105248_10212346
1075 Ga0105248_10516568
1076 Ga0105238_10111041
1077 Ga0105249_10000401
1078 Ga0105249_10025142
1079 Ga0105249_10036717
1080 Ga0099796_10027215
1081 Ga0105239_10012515
1082 Ga0105239_10252174
1083 Ga0105246_10000533
1084 Ga0157373_10044476
1085 Ga0157373_10103595
1086 Ga0157373_10153510
1087 Ga0157371_10020222
1088 Ga0157371_10021974
1089 Ga0157371_10057423
1090 Ga0157371_10133767
1091 Ga0157370_10003194
1092 Ga0157370_10035300
1093 Ga0157370_10063945
1094 Ga0157370_10193562
1095 Ga0157369_10017079
1096 Ga0157369_10043675
1097 Ga0157369_10125047
1098 Ga0157369_10202695
1099 Ga0157369_10231304
1100 Ga0157369_10306503
1101 Ga0157369_10593862
1102 Ga0157374_10046567
1103 Ga0157378_10014072
1104 Ga0157378_10049540
1105 Ga0157378_10133385
1106 Ga0163162_10006251
1107 Ga0157372_10007785
1108 Ga0157372_10012289
1109 Ga0157372_10012544
1110 Ga0157372_10014180
1111 Ga0157372_10018962
1112 Ga0157372_10021308
1113 Ga0157372_10021746
1114 Ga0157372_10036682
1115 Ga0157372_10132875
1116 Ga0157372_10140853
1117 Ga0157372_10161792
1118 Ga0157372_10187951
1119 Ga0157372_10246721
1120 Ga0157375_10007703
1121 Ga0157375_10049710
1122 Ga0157375_10105207
1123 Ga0157375_10155663
1124 Ga0157375_10266362
1125 Ga0163163_10028398
1126 Ga0163163_10050780
1127 Ga0163163_10199473
1128 Ga0157380_10002943
1129 Ga0157380_10159520
1130 Ga0157377_10001214
1131 Ga0157377_10049104
1132 Ga0157379_10002779
1133 Ga0157376_10021797
1134 Ga0157376_10234122
1135 Ga0206353_10829339
1136 Ga0213876_10010197
1137 Ga0213876_10074988
1138 Ga0207656_10008725
1139 Ga0207682_10018006
1140 Ga0207682_10022945
1141 Ga0207692_10049027
1142 Ga0207688_10008758
1143 Ga0207680_10132463
1144 Ga0207647_10040182
1145 Ga0207699_10014614
1146 Ga0207699_10087061
1147 Ga0207645_10000246
1148 Ga0207645_10019478
1149 Ga0207645_10040866
1150 Ga0207643_10005735
1151 Ga0207643_10064492
1152 Ga0207643_10094670
1153 Ga0207705_10003411
1154 Ga0207705_10027463
1155 Ga0207705_10229487
1156 Ga0207684_10037377
1157 Ga0207684_10225977
1158 Ga0207684_10350320
1159 Ga0207654_10006351
1160 Ga0207707_10000876
1161 Ga0207707_10008044
1162 Ga0207707_10008456
1163 Ga0207707_10011039
1164 Ga0207707_10015039
1165 Ga0207707_10018771
1166 Ga0207707_10034532
1167 Ga0207707_10047323
1168 Ga0207707_10067208
1169 Ga0207707_10075902
1170 Ga0207707_10234417
1171 Ga0207695_10008377
1172 Ga0207695_10015068
1173 Ga0207695_10040786
1174 Ga0207695_10202071
1175 Ga0207693_10064328
1176 Ga0207663_10066923
1177 Ga0207660_10000019
1178 Ga0207660_10003649
1179 Ga0207660_10004394
1180 Ga0207660_10020228
1181 Ga0207660_10025507
1182 Ga0207660_10029176
1183 Ga0207660_10035590
1184 Ga0207660_10057085
1185 Ga0207662_10001341
1186 Ga0207662_10005821
1187 Ga0207662_10045751
1188 Ga0207657_10014056
1189 Ga0207657_10035139
1190 Ga0207657_10047429
1191 Ga0207657_10083504
1192 Ga0207657_10107891
1193 Ga0207657_10154878
1194 Ga0207649_10001792
1195 Ga0207649_10005674
1196 Ga0207649_10006949
1197 Ga0207649_10012948
1198 Ga0207649_10022279
1199 Ga0207649_10049177
1200 Ga0207652_10001653
1201 Ga0207652_10003236
1202 Ga0207652_10010708
1203 Ga0207652_10040959
1204 Ga0207652_10041220
1205 Ga0207652_10069352
1206 Ga0207652_10175986
1207 Ga0207652_10314401
1208 Ga0207646_10004872
1209 Ga0207646_10118235
1210 Ga0207681_10004605
1211 Ga0207681_10010274
1212 Ga0207650_10027585
1213 Ga0207650_10028491
1214 Ga0207650_10343776
1215 Ga0207659_10008740
1216 Ga0207659_10030744
1217 Ga0207659_10156634
1218 Ga0207659_10330444
1219 Ga0207687_10004209
1220 Ga0207700_10013714
1221 Ga0207700_10132316
1222 Ga0207700_10175202
1223 Ga0207664_10019391
1224 Ga0207664_10163732
1225 Ga0207644_10014421
1226 Ga0207644_10061727
1227 Ga0207690_10021155
1228 Ga0207690_10038055
1229 Ga0207690_10087053
1230 Ga0207690_10108439
1231 Ga0207690_10135469
1232 Ga0207706_10000357
1233 Ga0207706_10004509
1234 Ga0207706_10031908
1235 Ga0207706_10157211
1236 Ga0207670_10034671
1237 Ga0207670_10381822
1238 Ga0207704_10011553
1239 Ga0207704_10093293
1240 Ga0207665_10002381
1241 Ga0207691_10001314
1242 Ga0207691_10001355
1243 Ga0207691_10002440
1244 Ga0207691_10205920
1245 Ga0207711_10012482
1246 Ga0207689_10000838
1247 Ga0207689_10001360
1248 Ga0207661_10000837
1249 Ga0207661_10002707
1250 Ga0207661_10002985
1251 Ga0207661_10009644
1252 Ga0207661_10012163
1253 Ga0207661_10017850
1254 Ga0207661_10139181
1255 Ga0207661_10152940
1256 Ga0207661_10194447
1257 Ga0207661_10200070
1258 Ga0207679_10001293
1259 Ga0207679_10002934
1260 Ga0207679_10005132
1261 Ga0207679_10016901
1262 Ga0207679_10044636
1263 Ga0207679_10073037
1264 Ga0207679_10089529
1265 Ga0207679_10106593
1266 Ga0207679_10281395
1267 Ga0207667_10059187
1268 Ga0207667_10067852
1269 Ga0207667_10109412
1270 Ga0207667_10142428
1271 Ga0207667_10377247
1272 Ga0207651_10013040
1273 Ga0207712_10004798
1274 Ga0207712_10089340
1275 Ga0207640_10001447
1276 Ga0207640_10018594
1277 Ga0207658_10019166
1278 Ga0207658_10029822
1279 Ga0207658_10219604
1280 Ga0207677_10028245
1281 Ga0207703_10005549
1282 Ga0207703_10060323
1283 Ga0207703_10086685
1284 Ga0207703_10465490
1285 Ga0207639_10041014
1286 Ga0207639_10290754
1287 Ga0207678_10052781
1288 Ga0207708_10052601
1289 Ga0207708_10216089
1290 Ga0207702_10008970
1291 Ga0207702_10149450
1292 Ga0207641_10015530
1293 Ga0207641_10023335
1294 Ga0207641_10120792
1295 Ga0207641_10137355
1296 Ga0207641_10265217
1297 Ga0207648_10022648
1298 Ga0207648_10043541
1299 Ga0207648_10066857
1300 Ga0207648_10198946
1301 Ga0207648_10402980
1302 Ga0207676_10006741
1303 Ga0207676_10013795
1304 Ga0207674_10001189
1305 Ga0207674_10005220
1306 Ga0207674_10012363
1307 Ga0207674_10016525
1308 Ga0207674_10018424
1309 Ga0207674_10020068
1310 Ga0207675_100000320
1311 Ga0207675_100024660
1312 Ga0207683_10134854
1313 Ga0207683_10136869
1314 Ga0207698_10018539
1315 Ga0207698_10038232
1316 Ga0207698_10041383
1317 Ga0207698_10052960
1318 Ga0207698_10073315
1319 Ga0207698_10200092
1320 Ga0207698_10489414
1321 Ga0207428_10206773
1322 Ga0268266_10065062
1323 Ga0268265_10002328
1324 Ga0268265_10002878
1325 Ga0268265_10027846
1326 Ga0268264_10007527
1327 Ga0268264_10116498
1328 Ga0265340_10056912
1329 Ga0307408_100048438
1330 Ga0307408_100095135
1331 Ga0307408_100126618
1332 Ga0307408_100384029
1333 Ga0265342_10095075
1334 Ga0307405_10006095
1335 Ga0307405_10011026
1336 Ga0307405_10020285
1337 Ga0307405_10060289
1338 Ga0307405_10145775
1339 Ga0307405_10207669
1340 Ga0307413_10011653
1341 Ga0307413_10029397
1342 Ga0307413_10143677
1343 Ga0307410_10000204
1344 Ga0307410_10005473
1345 Ga0307410_10186964
1346 Ga0307410_10332617
1347 Ga0307406_10002087
1348 Ga0307406_10002761
1349 Ga0307406_10003135
1350 Ga0307406_10007929
1351 Ga0307406_10271528
1352 Ga0307407_10000173
1353 Ga0307407_10006846
1354 Ga0307407_10017799
1355 Ga0307407_10038949
1356 Ga0307407_10044717
1357 Ga0307412_10010418
1358 Ga0307412_10068472
1359 Ga0307412_10146371
1360 Ga0307409_100000064
1361 Ga0307409_100023265
1362 Ga0307409_100038991
1363 Ga0307409_100039847
1364 Ga0307409_100110428
1365 Ga0307409_100349025
1366 Ga0307416_100002944
1367 Ga0307416_100017933
1368 Ga0307416_100020574
1369 Ga0307416_100055046
1370 Ga0307416_100225274
1371 Ga0307414_10023255
1372 Ga0307414_10041511
1373 Ga0307414_10115002
1374 Ga0307411_10053081
1375 Ga0307411_10076380
1376 Ga0307411_10125298
1377 Ga0307411_10313528
1378 Ga0307415_100001458
1379 Ga0307415_100004895
1380 Ga0307415_100010501
1381 Ga0307415_100117207
1382 Ga0373926_0044097
1383 Ga0373934_0095134
1384 Ga0373944_0060600
1385 Ga0373923_0057996
1386 Ga0373954_0029633
1387 Ga0373956_0010506
1388 Ga0373956_0025536
1389 Ga0373957_0003498
1390 Ga0373957_0017867
1391 Ga0373957_0091197
1392 Ga0373943_0006401
1393 Ga0373946_0062216
1394 Ga0373955_0002387
1395 Ga0373955_0127862
1396 Ga0373924_0130816
1397 Ga0373927_0128454
1398 Ga0373933_0005918
1399 Ga0373933_0220197
1400 Ga0373937_0001063
1401 Ga0373937_0009784
1402 Ga0373937_0382741
1403 Ga0373925_0023376
1404 Ga0373925_0119887
1405 Ga0395899_0110016
1406 Ga0395900_0066207
1407 Ga0395905_0006883
1408 Ga0395905_0365356
1409 Ga0436365_0262337
1410 Ga0436365_0433142
1411 Ga0436365_1818520
1412 Ga0439439_0018473
1413 Ga0439439_0029503
1414 Ga0439434_0004027
1415 Ga0439434_0018127
1416 Ga0453684_0036233
1417 Ga0453684_0188119
1418 Ga0451576_0055645
1419 Ga0451576_0106572
1420 Ga0451576_0373872
1421 Ga0466967_0018462
1422 Ga0466967_0147298
1423 Ga0495592_0069656
1424 Ga0495629_0190651
1425 Ga0495651_0001301
1426 Ga0495651_0051123
1427 Ga0495651_0076573
1428 Ga0495651_0119516
1429 Ga0495653_0017208
1430 Ga0495653_0224460
1431 Ga0495580_0005339
1432 Ga0495580_0009964
1433 Ga0495580_0101282
1434 Ga0495639_0008820
1435 Ga0495639_0011312
1436 Ga0495664_0087366
1437 Ga0495594_0017198
1438 Ga0495594_0070921
1439 Ga0495594_0134775
1440 Ga0495608_0008696
1441 Ga0495608_0009500
1442 Ga0495618_0046981
1443 Ga0495618_0186174
1444 Ga0495628_0024650
1445 Ga0495628_0025499
1446 Ga0495630_0030203
1447 Ga0495630_0050381
1448 Ga0495630_0075318
1449 Ga0495630_0075946
1450 Ga0495630_0143635
1451 Ga0495663_0036584
1452 Ga0495652_0004653
1453 Ga0495652_0007351
1454 Ga0495652_0018881
1455 Ga0495652_0070538
1456 Ga0495652_0228278
1457 Ga0495665_0002007
1458 Ga0495640_0089800
1459 Ga0495640_0211627
1460 Ga0495586_0006585
1461 Ga0495586_0022559
1462 Ga0495586_0178068
1463 Ga0495587_0000269
1464 Ga0495587_0000334
1465 Ga0495587_0007670
1466 Ga0495587_0083933
1467 Ga0495587_0128778
1468 Ga0495621_0062442
1469 Ga0495645_0000517
1470 Ga0495645_0000918
1471 Ga0495645_0020739
1472 Ga0495645_0023498
1473 Ga0495645_0076410
1474 Ga0495622_0077273
1475 Ga0495667_0013252
1476 Ga0495667_0016941
1477 Ga0495667_0092811
1478 Ga0495635_0000200
1479 Ga0495635_0057114
1480 Ga0495635_0057702
1481 Ga0495588_0002760
1482 Ga0495657_0001237
1483 Ga0495657_0083842
1484 Ga0495599_0000385
1485 Ga0495599_0000604
1486 Ga0495599_0004010
1487 Ga0495599_0064948
1488 Ga0495599_0174605
1489 Ga0495599_0207218
1490 Ga0495623_0000156
1491 Ga0495623_0003214
1492 Ga0495623_0027125
1493 Ga0495646_0069069
1494 Ga0495646_0081024
1495 Ga0495658_0002228
1496 Ga0495669_0075094
1497 Ga0495613_0133722
1498 Ga0495613_0160111
1499 Ga0495600_0005770
1500 Ga0495600_0102685
1501 Ga0495581_0035327
1502 Ga0495604_0004394
1503 Ga0495604_0014501
1504 Ga0495636_0062140
1505 Ga0495674_0004839
1506 Ga0495674_0095660
1507 Ga0495674_0097329
1508 Ga0495674_0252523
1509 Ga0495672_0039809
1510 Ga0495676_0195205
1511 Ga0495680_0028925
1512 Ga0495680_0043312
1513 Ga0495680_0188759
1514 Ga0495675_0058505
1515 Ga0495675_0100124
1516 Ga0495684_0002113
1517 Ga0495684_0028480
1518 Ga0495684_0037827
1519 Ga0495684_0098433
1520 Ga0495684_0228275
1521 Ga0495602_0022321
1522 Ga0495602_0100672
1523 Ga0495602_0238270
1524 Ga0495614_0013536
1525 Ga0496100_0163581
1526 Ga0496104_0122769
1527 Ga0496104_0363303
1528 Ga0496108_0020209
1529 Ga0496108_0139525
1530 Ga0496108_0196691
1531 Ga0496109_0054858
1532 Ga0496110_0148580
1533 Ga0496110_0212710
1534 Ga0496112_0000196
1535 Ga0496112_0040201
1536 Ga0496112_0088854
1537 Ga0496113_0014762
1538 Ga0496115_0023520
1539 Ga0501033_0026915
1540 Ga0501034_0023281
1541 Ga0501040_0085139
1542 Ga0501043_0094432
1543 Ga0501047_0030185
1544 Ga0501047_0149295
1545 Ga0501048_0150904
1546 Ga0501072_0257590
1547 Ga0501076_0071229
1548 Ga0501076_0154877
1549 Ga0501216_001750
1550 Ga0501217_001077
1551 Ga0501252_006578
1552 Ga0501257_013835
1553 Ga0501221_000410
1554 Ga0501234_001884
1555 Ga0501081_0075961
1556 Ga0501266_001068
1557 Ga0501268_000409
1558 Ga0501270_002122
1559 Ga0501035_0028174
1560 Ga0501035_0331108
1561 Ga0501044_0042149
1562 nmdc:mga05p37_272908_c1
1563 nmdc:mga05p37_347349_c1
1564 nmdc:mga09592_329806_c1
1565 nmdc:mga0qj67_209673_c1
1566 nmdc:mga0qj67_39857_c1
1567 nmdc:mga0qj67_71620_c1
1568 nmdc:mga06r32_199102_c1
1569 nmdc:mga06r32_236996_c1
1570 nmdc:mga06r32_85186_c1
1571 nmdc:mga06r32_92915_c1
1572 nmdc:mga08y16_150292_c1
1573 nmdc:mga08y16_164016_c1
1574 nmdc:mga08y16_447391_c1
1575 nmdc:mga08y16_66250_c1
1576 nmdc:mga08y16_87803_c1
1577 nmdc:mga0n895_152714_c1
1578 nmdc:mga0n895_18729_c1
1579 nmdc:mga0n895_200618_c1
1580 nmdc:mga0n895_440971_c1
1581 nmdc:mga08x19_44349_c1
1582 nmdc:mga0a205_153264_c1
1583 nmdc:mga0a205_24539_c1
1584 nmdc:mga0a205_407816_c1
1585 Ga0495612_0006507
1586 Ga0495595_0026088
1587 Ga0495595_0028448
1588 Ga0495619_0036015
1589 Ga0495619_0184056
1590 Ga0500583_0066036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06089

Asparaginase_II

L-asparaginase II

27

344

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9391 7 325
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9372 5 325
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9353 4 325
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9134 4 325
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9124 5 325
ID Description Score Start End Superfamily
af_P12080_32_503_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.7562 260 280 2.130.10.130
af_Q8SXB3_7_108_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.7335 164 194 3.90.470.20
af_A0A0R4ICS1_30_455_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.715 260 277 2.130.10.130
af_Q8IKR0_45_147_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.6889 162 197 3.30.1200.10
af_Q09EE9_24_127_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.6826 163 197 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A2V7HI73-F1-model_v4 Asparaginase 0.9906 1 328
AF-A0A2V7SID8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9852 1 301 GO:0051920
AF-A0A2V7HI73-F1-model_v4 Asparaginase 0.9846 1 328
AF-A0A838QG36-F1-model_v4 Asparaginase 0.9845 78 329
AF-A0A3D4V958-F1-model_v4 Asparaginase 0.9843 3 329

Map