F481091

General Info

Members Datasets Scaffolds Average Seq Length
794 222 1588 217

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100011028|Ga0070664_10001102810
Length 263
Sequence MQARLRLHSPFTCKPATSGTNATLEYPHLPRYRLPSPYDRTPLQRRLSGLALALGINVGLLLVLMTLGVLPPPSHRQLRGIVVELIPQQRAAAPTRSQRTEQRPRADANRPIPKPPPIILPVKPKPAPWLEISKEDMAASDISKLPAIGSGGAGDSEVVGKGPNGEALYAAEWAREPTDAELAGYMPRNAPEGFGLIACKTIANNRVEDCIELDQSPRGSHLASAVRQAAWQFRVRPPRKGGRSLIGSWVRIRIDYYRSDGSD

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 6.3
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100011028 3300005564 Bacteria 7329
2 JGI24740J21852_10008588 3300001979 Bacteria 4058
3 JGI24740J21852_10011658 3300001979 Bacteria 3340
4 JGI24739J22299_10003233 3300001989 Bacteria 6218
5 JGI24739J22299_10012916 3300001989 Bacteria 3057
6 JGI24737J22298_10000012 3300001990 Bacteria 50552
7 JGI24737J22298_10001207 3300001990 Bacteria 9104
8 JGI24737J22298_10066103 3300001990 Bacteria 1083
9 JGI24743J22301_10005946 3300001991 Bacteria 2058
10 JGI24735J21928_10015470 3300002067 Bacteria 2380
11 JGI24738J21930_10000563 3300002075 Bacteria 10610
12 JGI24738J21930_10001600 3300002075 Bacteria 6235
13 JGI24738J21930_10017886 3300002075 Bacteria 1486
14 rootL2_10210268 3300003322 Bacteria 1311
15 rootH1_10250591 3300003323 Bacteria 1620
16 Ga0070658_10000131 3300005327 Bacteria 66294
17 Ga0070658_10003622 3300005327 Bacteria 12655
18 Ga0070658_10008574 3300005327 Bacteria 8219
19 Ga0070658_10047913 3300005327 Bacteria 3459
20 Ga0070658_10049560 3300005327 Bacteria 3402
21 Ga0070658_10096144 3300005327 Bacteria 2445
22 Ga0070676_10003050 3300005328 Bacteria 8656
23 Ga0070676_10004720 3300005328 Bacteria 7202
24 Ga0070676_10221307 3300005328 Bacteria 1250
25 Ga0070683_100012183 3300005329 Bacteria 7463
26 Ga0070683_100015761 3300005329 Bacteria 6645
27 Ga0070683_100019718 3300005329 Bacteria 5992
28 Ga0070683_100105733 3300005329 Bacteria 2653
29 Ga0070683_100205538 3300005329 Bacteria 1870
30 Ga0070690_100170018 3300005330 Unclassified 1499
31 Ga0070670_100065797 3300005331 Bacteria 3110
32 Ga0070670_100075704 3300005331 Bacteria 2892
33 Ga0070670_100174362 3300005331 Bacteria 1866
34 Ga0070677_10030007 3300005333 Bacteria 2066
35 Ga0070677_10092482 3300005333 Bacteria 1318
36 Ga0068869_100012435 3300005334 Bacteria 5625
37 Ga0068869_100426737 3300005334 Bacteria 1095
38 Ga0070666_10000163 3300005335 Bacteria 45399
39 Ga0070666_10003055 3300005335 Bacteria 10164
40 Ga0070666_10026764 3300005335 Bacteria 3772
41 Ga0070666_10352182 3300005335 Unclassified 1054
42 Ga0070680_100018597 3300005336 Bacteria 5493
43 Ga0070680_100078883 3300005336 Bacteria 2713
44 Ga0070680_100340513 3300005336 Bacteria 1274
45 Ga0070682_100018778 3300005337 Bacteria 4048
46 Ga0070682_100066991 3300005337 Bacteria 2286
47 Ga0070682_100083444 3300005337 Bacteria 2074
48 Ga0068868_100002931 3300005338 Bacteria 11838
49 Ga0068868_100017771 3300005338 Bacteria 5304
50 Ga0068868_100027939 3300005338 Bacteria 4308
51 Ga0068868_100395757 3300005338 Bacteria 1191
52 Ga0070660_100000263 3300005339 Bacteria 34745
53 Ga0070660_100002246 3300005339 Bacteria 13263
54 Ga0070660_100003698 3300005339 Bacteria 10558
55 Ga0070660_100007255 3300005339 Bacteria 7716
56 Ga0070660_100016909 3300005339 Bacteria 5308
57 Ga0070660_100021099 3300005339 Bacteria 4798
58 Ga0070660_100030016 3300005339 Bacteria 4077
59 Ga0070660_100060332 3300005339 Bacteria 2943
60 Ga0070660_100085980 3300005339 Bacteria 2474
61 Ga0070660_100269315 3300005339 Bacteria 1392
62 Ga0070689_100181774 3300005340 Unclassified 1708
63 Ga0070691_10080172 3300005341 Bacteria 1597
64 Ga0070687_100271589 3300005343 Unclassified 1063
65 Ga0070687_100315935 3300005343 Unclassified 996
66 Ga0070661_100000075 3300005344 Bacteria 79164
67 Ga0070661_100024802 3300005344 Bacteria 4303
68 Ga0070661_100059701 3300005344 Bacteria 2797
69 Ga0070661_100072937 3300005344 Bacteria 2527
70 Ga0070661_100090858 3300005344 Bacteria 2261
71 Ga0070661_100133608 3300005344 Unclassified 1865
72 Ga0070692_10001815 3300005345 Bacteria 7989
73 Ga0070692_10189060 3300005345 Unclassified 1198
74 Ga0070668_100003938 3300005347 Bacteria 10978
75 Ga0070668_100044055 3300005347 Bacteria 3422
76 Ga0070668_100121887 3300005347 Bacteria 2085
77 Ga0070669_100003019 3300005353 Bacteria 12114
78 Ga0070669_100058675 3300005353 Bacteria 2825
79 Ga0070669_100136276 3300005353 Bacteria 1888
80 Ga0070669_100290235 3300005353 Bacteria 1313
81 Ga0070669_100332368 3300005353 Bacteria 1229
82 Ga0070675_100023024 3300005354 Bacteria 4977
83 Ga0070675_100127767 3300005354 Bacteria 2164
84 Ga0070671_100004930 3300005355 Bacteria 10617
85 Ga0070671_100010191 3300005355 Bacteria 7542
86 Ga0070671_100038219 3300005355 Bacteria 3984
87 Ga0070671_100046940 3300005355 Bacteria 3592
88 Ga0070671_100056822 3300005355 Bacteria 3256
89 Ga0070671_100108296 3300005355 Bacteria 2333
90 Ga0070671_100110628 3300005355 Bacteria 2308
91 Ga0070671_100206155 3300005355 Bacteria 1667
92 Ga0070671_100646529 3300005355 Unclassified 915
93 Ga0070674_100006585 3300005356 Bacteria 6789
94 Ga0070674_100010999 3300005356 Bacteria 5489
95 Ga0070674_100379220 3300005356 Bacteria 1150
96 Ga0070673_100000346 3300005364 Bacteria 24441
97 Ga0070673_100001961 3300005364 Bacteria 12410
98 Ga0070673_100019419 3300005364 Bacteria 4877
99 Ga0070673_100055235 3300005364 Bacteria 3128
100 Ga0070673_100105229 3300005364 Bacteria 2331
101 Ga0070673_100128965 3300005364 Bacteria 2119
102 Ga0070673_100169169 3300005364 Unclassified 1864
103 Ga0070659_100000126 3300005366 Bacteria 57730
104 Ga0070659_100008736 3300005366 Bacteria 7414
105 Ga0070659_100033150 3300005366 Bacteria 4010
106 Ga0070659_100089935 3300005366 Bacteria 2460
107 Ga0070659_100140889 3300005366 Bacteria 1963
108 Ga0070659_100145841 3300005366 Bacteria 1928
109 Ga0070659_100200354 3300005366 Bacteria 1643
110 Ga0070659_100407407 3300005366 Bacteria 1149
111 Ga0070659_100657753 3300005366 Bacteria 904
112 Ga0070667_100006962 3300005367 Bacteria 9394
113 Ga0070667_100021202 3300005367 Bacteria 5398
114 Ga0070667_100034302 3300005367 Bacteria 4245
115 Ga0070667_100040839 3300005367 Bacteria 3891
116 Ga0070667_100044960 3300005367 Bacteria 3711
117 Ga0070667_100061568 3300005367 Bacteria 3178
118 Ga0070667_100093366 3300005367 Bacteria 2591
119 Ga0070667_100144819 3300005367 Bacteria 2083
120 Ga0070667_100170625 3300005367 Bacteria 1920
121 Ga0070667_100286389 3300005367 Bacteria 1481
122 Ga0070709_10102560 3300005434 Bacteria 1909
123 Ga0070714_100014533 3300005435 Bacteria 6327
124 Ga0070714_100016091 3300005435 Bacteria 6030
125 Ga0070714_100082803 3300005435 Bacteria 2796
126 Ga0070714_100161381 3300005435 Bacteria 2028
127 Ga0070713_100012697 3300005436 Bacteria 6189
128 Ga0070713_100537048 3300005436 Bacteria 1106
129 Ga0070694_100028074 3300005444 Bacteria 3658
130 Ga0070663_100003721 3300005455 Bacteria 8841
131 Ga0070663_100006030 3300005455 Bacteria 7256
132 Ga0070663_100013415 3300005455 Bacteria 5225
133 Ga0070663_100054331 3300005455 Bacteria 2862
134 Ga0070663_100202090 3300005455 Bacteria 1551
135 Ga0070678_100003987 3300005456 Bacteria 8300
136 Ga0070678_100011406 3300005456 Bacteria 5481
137 Ga0070678_100042833 3300005456 Bacteria 3220
138 Ga0070678_100079551 3300005456 Bacteria 2480
139 Ga0070678_100080231 3300005456 Bacteria 2470
140 Ga0070678_100128199 3300005456 Bacteria 2012
141 Ga0070662_100000121 3300005457 Bacteria 43769
142 Ga0070662_100003608 3300005457 Bacteria 9658
143 Ga0070662_100005025 3300005457 Bacteria 8414
144 Ga0070662_100012432 3300005457 Bacteria 5646
145 Ga0070662_100017201 3300005457 Bacteria 4868
146 Ga0070662_100041447 3300005457 Bacteria 3284
147 Ga0070662_100052560 3300005457 Bacteria 2946
148 Ga0070662_100311010 3300005457 Bacteria 1282
149 Ga0070662_100398673 3300005457 Unclassified 1135
150 Ga0070681_10013184 3300005458 Bacteria 8211
151 Ga0070681_10378744 3300005458 Bacteria 1326
152 Ga0068867_100002055 3300005459 Bacteria 14094
153 Ga0068867_100008430 3300005459 Bacteria 7271
154 Ga0068867_100050916 3300005459 Bacteria 3054
155 Ga0070679_100014193 3300005530 Bacteria 7644
156 Ga0070679_100038561 3300005530 Bacteria 4750
157 Ga0070679_100232043 3300005530 Bacteria 1805
158 Ga0070679_100264361 3300005530 Unclassified 1675
159 Ga0070679_100730652 3300005530 Bacteria 933
160 Ga0070684_100031642 3300005535 Bacteria 4506
161 Ga0068853_100000078 3300005539 Bacteria 67253
162 Ga0068853_100036226 3300005539 Bacteria 4194
163 Ga0068853_100051588 3300005539 Bacteria 3541
164 Ga0068853_100093234 3300005539 Bacteria 2651
165 Ga0068853_100119733 3300005539 Bacteria 2347
166 Ga0068853_100178085 3300005539 Bacteria 1927
167 Ga0068853_100303680 3300005539 Unclassified 1476
168 Ga0070672_100004454 3300005543 Bacteria 9171
169 Ga0070672_100192112 3300005543 Bacteria 1705
170 Ga0070672_100334497 3300005543 Bacteria 1289
171 Ga0070696_100022997 3300005546 Bacteria 4238
172 Ga0070693_100007236 3300005547 Bacteria 5418
173 Ga0070693_100041029 3300005547 Bacteria 2601
174 Ga0070693_100059064 3300005547 Unclassified 2222
175 Ga0070665_100001986 3300005548 Bacteria 23017
176 Ga0070665_100013938 3300005548 Bacteria 8087
177 Ga0070665_100018165 3300005548 Bacteria 7054
178 Ga0070665_100039310 3300005548 Bacteria 4756
179 Ga0070665_100045505 3300005548 Bacteria 4407
180 Ga0070665_100063276 3300005548 Bacteria 3710
181 Ga0068855_100016758 3300005563 Bacteria 8812
182 Ga0068855_100020515 3300005563 Bacteria 7924
183 Ga0068855_100038374 3300005563 Bacteria 5691
184 Ga0068855_100046168 3300005563 Bacteria 5150
185 Ga0068855_100085406 3300005563 Bacteria 3651
186 Ga0068855_100090126 3300005563 Bacteria 3539
187 Ga0068855_100116127 3300005563 Bacteria 3067
188 Ga0068855_100139421 3300005563 Bacteria 2766
189 Ga0070664_100000320 3300005564 Bacteria 34880
190 Ga0070664_100005006 3300005564 Bacteria 10618
191 Ga0070664_100021384 3300005564 Bacteria 5331
192 Ga0070664_100022931 3300005564 Bacteria 5150
193 Ga0070664_100027118 3300005564 Bacteria 4759
194 Ga0070664_100080219 3300005564 Bacteria 2810
195 Ga0070664_100111344 3300005564 Bacteria 2390
196 Ga0070664_100151949 3300005564 Bacteria 2044
197 Ga0070664_100603534 3300005564 Unclassified 1018
198 Ga0070664_100896342 3300005564 Unclassified 831
199 Ga0068857_100012466 3300005577 Bacteria 7403
200 Ga0068857_100015401 3300005577 Bacteria 6678
201 Ga0068857_100023201 3300005577 Bacteria 5460
202 Ga0068857_100055296 3300005577 Bacteria 3522
203 Ga0068857_100148522 3300005577 Bacteria 2122
204 Ga0068857_100653642 3300005577 Bacteria 996
205 Ga0068854_100003071 3300005578 Bacteria 10394
206 Ga0068854_100003909 3300005578 Bacteria 9336
207 Ga0068854_100005446 3300005578 Bacteria 8037
208 Ga0068854_100029474 3300005578 Bacteria 3800
209 Ga0068854_100107996 3300005578 Bacteria 2095
210 Ga0068854_100477477 3300005578 Bacteria 1046
211 Ga0068856_100000766 3300005614 Bacteria 34886
212 Ga0068856_100025192 3300005614 Bacteria 5796
213 Ga0068856_100038780 3300005614 Bacteria 4677
214 Ga0068856_100040064 3300005614 Bacteria 4600
215 Ga0068856_100084753 3300005614 Bacteria 3148
216 Ga0068856_100257693 3300005614 Bacteria 1759
217 Ga0068856_100292814 3300005614 Bacteria 1645
218 Ga0070702_100222607 3300005615 Bacteria 1263
219 Ga0068852_100000220 3300005616 Bacteria 38681
220 Ga0068852_100001353 3300005616 Bacteria 16442
221 Ga0068852_100011324 3300005616 Bacteria 6710
222 Ga0068852_100014904 3300005616 Bacteria 6008
223 Ga0068852_100059582 3300005616 Bacteria 3311
224 Ga0068852_100089670 3300005616 Bacteria 2749
225 Ga0068852_100189111 3300005616 Bacteria 1941
226 Ga0068852_100203324 3300005616 Unclassified 1875
227 Ga0068852_100350721 3300005616 Bacteria 1441
228 Ga0068859_100003413 3300005617 Bacteria 16161
229 Ga0068859_100064046 3300005617 Bacteria 3708
230 Ga0068859_100160980 3300005617 Bacteria 2324
231 Ga0068859_100485113 3300005617 Unclassified 1331
232 Ga0068859_100988704 3300005617 Unclassified 924
233 Ga0068864_100002627 3300005618 Bacteria 14836
234 Ga0068864_100033577 3300005618 Bacteria 4363
235 Ga0068864_100042927 3300005618 Bacteria 3870
236 Ga0068864_100113033 3300005618 Bacteria 2421
237 Ga0068864_100174825 3300005618 Bacteria 1960
238 Ga0068864_100528440 3300005618 Unclassified 1138
239 Ga0068866_10048971 3300005718 Bacteria 2139
240 Ga0068866_10049281 3300005718 Bacteria 2133
241 Ga0068861_100420988 3300005719 Bacteria 1190
242 Ga0068851_10025914 3300005834 Bacteria 2878
243 Ga0068851_10061905 3300005834 Bacteria 1919
244 Ga0068851_10242105 3300005834 Bacteria 1020
245 Ga0068851_10383744 3300005834 Bacteria 823
246 Ga0068863_100006484 3300005841 Bacteria 11474
247 Ga0068863_100012578 3300005841 Bacteria 8166
248 Ga0068863_100018494 3300005841 Bacteria 6669
249 Ga0068863_100071822 3300005841 Bacteria 3274
250 Ga0068858_100017162 3300005842 Bacteria 6793
251 Ga0068858_100042720 3300005842 Bacteria 4203
252 Ga0068858_100070820 3300005842 Bacteria 3232
253 Ga0068858_100177631 3300005842 Bacteria 2009
254 Ga0068860_100015079 3300005843 Bacteria 7552
255 Ga0068860_100025237 3300005843 Bacteria 5735
256 Ga0068860_100202624 3300005843 Bacteria 1923
257 Ga0068860_100245879 3300005843 Unclassified 1741
258 Ga0068860_100646280 3300005843 Unclassified 1065
259 Ga0068862_100004991 3300005844 Bacteria 11169
260 Ga0068862_100012124 3300005844 Bacteria 7124
261 Ga0068862_100014742 3300005844 Bacteria 6491
262 Ga0068862_100470959 3300005844 Bacteria 1187
263 Ga0068862_100555850 3300005844 Unclassified 1096
264 Ga0070717_10117475 3300006028 Bacteria 2275
265 Ga0070716_100019259 3300006173 Bacteria 3565
266 Ga0070712_100041725 3300006175 Bacteria 3152
267 Ga0097621_100006246 3300006237 Bacteria 8456
268 Ga0097621_100012176 3300006237 Bacteria 6366
269 Ga0097621_100023857 3300006237 Bacteria 4768
270 Ga0097621_100074840 3300006237 Bacteria 2805
271 Ga0068871_100009000 3300006358 Bacteria 7210
272 Ga0068871_100044237 3300006358 Bacteria 3579
273 Ga0068871_100047296 3300006358 Bacteria 3469
274 Ga0068871_100058215 3300006358 Bacteria 3146
275 Ga0068871_100094105 3300006358 Bacteria 2501
276 Ga0075431_100617305 3300006847 Bacteria 1067
277 Ga0075433_10115341 3300006852 Bacteria 2383
278 Ga0075434_100521073 3300006871 Unclassified 1209
279 Ga0068865_100002364 3300006881 Bacteria 11134
280 Ga0068865_100016153 3300006881 Bacteria 4769
281 Ga0068865_100043772 3300006881 Bacteria 3061
282 Ga0097620_100003413 3300006931 Bacteria 16161
283 Ga0097620_100064044 3300006931 Bacteria 3708
284 Ga0097620_100160975 3300006931 Bacteria 2324
285 Ga0097620_100485077 3300006931 Unclassified 1331
286 Ga0097620_100988538 3300006931 Unclassified 924
287 Ga0075435_100144001 3300007076 Bacteria 2001
288 Ga0105240_10010272 3300009093 Bacteria 13180
289 Ga0105245_10026154 3300009098 Bacteria 5136
290 Ga0105241_10009477 3300009174 Bacteria 7152
291 Ga0105241_10041531 3300009174 Bacteria 3476
292 Ga0105241_10342216 3300009174 Unclassified 1296
293 Ga0105242_10041503 3300009176 Bacteria 3712
294 Ga0105242_10298791 3300009176 Bacteria 1469
295 Ga0105248_10001155 3300009177 Bacteria 29459
296 Ga0105248_10002104 3300009177 Bacteria 22059
297 Ga0105248_10004368 3300009177 Bacteria 15641
298 Ga0105248_10010467 3300009177 Bacteria 10215
299 Ga0105248_10021479 3300009177 Bacteria 7150
300 Ga0105248_10093864 3300009177 Bacteria 3379
301 Ga0105248_10117950 3300009177 Bacteria 2993
302 Ga0105248_10133025 3300009177 Bacteria 2806
303 Ga0105248_10589850 3300009177 Unclassified 1254
304 Ga0105248_10680813 3300009177 Bacteria 1160
305 Ga0105237_10472822 3300009545 Unclassified 1259
306 Ga0105238_10047678 3300009551 Bacteria 4319
307 Ga0105238_10380407 3300009551 Unclassified 1403
308 Ga0105249_10506228 3300009553 Bacteria 1253
309 Ga0105239_10192431 3300010375 Bacteria 2283
310 Ga0105239_10459827 3300010375 Bacteria 1444
311 Ga0105246_10035411 3300011119 Bacteria 3336
312 Ga0105246_10245480 3300011119 Bacteria 1418
313 Ga0157373_10003202 3300013100 Bacteria 12383
314 Ga0157373_10023557 3300013100 Bacteria 4462
315 Ga0157373_10026761 3300013100 Bacteria 4163
316 Ga0157373_10069984 3300013100 Bacteria 2480
317 Ga0157373_10081853 3300013100 Bacteria 2276
318 Ga0157373_10130173 3300013100 Bacteria 1770
319 Ga0157373_10280424 3300013100 Bacteria 1181
320 Ga0157371_10001324 3300013102 Bacteria 26007
321 Ga0157371_10007597 3300013102 Bacteria 8748
322 Ga0157371_10010147 3300013102 Bacteria 7358
323 Ga0157371_10033185 3300013102 Bacteria 3710
324 Ga0157371_10037728 3300013102 Bacteria 3458
325 Ga0157371_10078728 3300013102 Bacteria 2335
326 Ga0157371_10324698 3300013102 Bacteria 1117
327 Ga0157370_10077227 3300013104 Bacteria 3137
328 Ga0157370_10117833 3300013104 Bacteria 2481
329 Ga0157370_10121423 3300013104 Bacteria 2439
330 Ga0157370_10315533 3300013104 Bacteria 1442
331 Ga0157369_10066042 3300013105 Bacteria 3892
332 Ga0157369_10134248 3300013105 Bacteria 2621
333 Ga0157369_10191088 3300013105 Bacteria 2152
334 Ga0157369_10422492 3300013105 Bacteria 1382
335 Ga0157369_10430341 3300013105 Unclassified 1368
336 Ga0157369_10846671 3300013105 Bacteria 939
337 Ga0157374_10031468 3300013296 Bacteria 4823
338 Ga0157374_10053765 3300013296 Bacteria 3755
339 Ga0157374_10133994 3300013296 Bacteria 2400
340 Ga0157378_10419825 3300013297 Unclassified 1322
341 Ga0163162_10047892 3300013306 Bacteria 4283
342 Ga0163162_10139650 3300013306 Bacteria 2535
343 Ga0163162_10329199 3300013306 Bacteria 1660
344 Ga0157372_10049246 3300013307 Bacteria 4684
345 Ga0157372_10058233 3300013307 Bacteria 4318
346 Ga0157372_10060600 3300013307 Bacteria 4234
347 Ga0157372_11280145 3300013307 Bacteria 846
348 Ga0157375_10005855 3300013308 Bacteria 10699
349 Ga0157375_10041667 3300013308 Bacteria 4436
350 Ga0157375_10057455 3300013308 Bacteria 3846
351 Ga0163163_10000058 3300014325 Bacteria 123478
352 Ga0163163_10026200 3300014325 Bacteria 5569
353 Ga0163163_10055056 3300014325 Bacteria 3931
354 Ga0157380_10031571 3300014326 Bacteria 4067
355 Ga0157377_10042221 3300014745 Bacteria 2532
356 Ga0157377_10087530 3300014745 Bacteria 1833
357 Ga0157379_10001782 3300014968 Bacteria 17776
358 Ga0157379_10555872 3300014968 Bacteria 1068
359 Ga0206354_10264634 3300020081 Bacteria 2656
360 Ga0206353_10479671 3300020082 Bacteria 2578
361 Ga0206353_11794012 3300020082 Bacteria 945
362 Ga0207697_10000069 3300025315 Bacteria 43897
363 Ga0207697_10026989 3300025315 Bacteria 2349
364 Ga0207697_10054284 3300025315 Unclassified 1660
365 Ga0207656_10005724 3300025321 Bacteria 4418
366 Ga0207656_10039535 3300025321 Bacteria 1995
367 Ga0207656_10119840 3300025321 Bacteria 1224
368 Ga0207682_10049032 3300025893 Bacteria 1742
369 Ga0207688_10065425 3300025901 Bacteria 2054
370 Ga0207680_10001182 3300025903 Bacteria 12333
371 Ga0207680_10002033 3300025903 Bacteria 9472
372 Ga0207680_10057220 3300025903 Bacteria 2359
373 Ga0207680_10068445 3300025903 Bacteria 2190
374 Ga0207680_10069998 3300025903 Bacteria 2170
375 Ga0207647_10000409 3300025904 Bacteria 35287
376 Ga0207647_10007820 3300025904 Bacteria 7696
377 Ga0207647_10009183 3300025904 Bacteria 7035
378 Ga0207699_10072392 3300025906 Bacteria 2110
379 Ga0207645_10006986 3300025907 Bacteria 8035
380 Ga0207645_10023343 3300025907 Bacteria 4021
381 Ga0207645_10047765 3300025907 Bacteria 2733
382 Ga0207645_10103152 3300025907 Bacteria 1841
383 Ga0207705_10000074 3300025909 Bacteria 123863
384 Ga0207705_10000743 3300025909 Bacteria 26871
385 Ga0207705_10008531 3300025909 Bacteria 7474
386 Ga0207705_10018275 3300025909 Bacteria 5013
387 Ga0207705_10028135 3300025909 Bacteria 4007
388 Ga0207705_10145327 3300025909 Bacteria 1774
389 Ga0207705_10147568 3300025909 Bacteria 1760
390 Ga0207705_10236589 3300025909 Bacteria 1390
391 Ga0207705_10302847 3300025909 Bacteria 1226
392 Ga0207705_10486517 3300025909 Bacteria 958
393 Ga0207654_10133542 3300025911 Unclassified 1574
394 Ga0207707_10116044 3300025912 Bacteria 2339
395 Ga0207707_10167769 3300025912 Bacteria 1918
396 Ga0207695_10354933 3300025913 Bacteria 1353
397 Ga0207695_10424846 3300025913 Bacteria 1213
398 Ga0207693_10051090 3300025915 Bacteria 3246
399 Ga0207660_10001957 3300025917 Bacteria 13740
400 Ga0207660_10046416 3300025917 Bacteria 3065
401 Ga0207660_10064526 3300025917 Bacteria 2643
402 Ga0207660_10069728 3300025917 Bacteria 2553
403 Ga0207660_10283207 3300025917 Bacteria 1316
404 Ga0207662_10224774 3300025918 Unclassified 1224
405 Ga0207657_10000126 3300025919 Bacteria 76430
406 Ga0207657_10001620 3300025919 Bacteria 24220
407 Ga0207657_10001861 3300025919 Bacteria 22807
408 Ga0207657_10002435 3300025919 Bacteria 20090
409 Ga0207657_10002695 3300025919 Bacteria 19147
410 Ga0207657_10011418 3300025919 Bacteria 8817
411 Ga0207657_10018957 3300025919 Bacteria 6549
412 Ga0207657_10021095 3300025919 Bacteria 6139
413 Ga0207657_10042893 3300025919 Bacteria 3988
414 Ga0207657_10073859 3300025919 Bacteria 2881
415 Ga0207657_10103045 3300025919 Bacteria 2366
416 Ga0207649_10002272 3300025920 Bacteria 10811
417 Ga0207649_10007491 3300025920 Bacteria 5934
418 Ga0207649_10134865 3300025920 Bacteria 1682
419 Ga0207652_10027749 3300025921 Bacteria 4721
420 Ga0207652_10165438 3300025921 Bacteria 1983
421 Ga0207681_10002521 3300025923 Bacteria 11636
422 Ga0207681_10023350 3300025923 Bacteria 3954
423 Ga0207681_10136177 3300025923 Bacteria 1823
424 Ga0207694_10067348 3300025924 Bacteria 2795
425 Ga0207650_10005773 3300025925 Bacteria 8446
426 Ga0207650_10009645 3300025925 Bacteria 6599
427 Ga0207650_10048344 3300025925 Bacteria 3137
428 Ga0207650_10143644 3300025925 Bacteria 1878
429 Ga0207650_10267776 3300025925 Bacteria 1388
430 Ga0207650_10439594 3300025925 Bacteria 1084
431 Ga0207659_10035284 3300025926 Bacteria 3456
432 Ga0207687_10008831 3300025927 Bacteria 6586
433 Ga0207700_10055929 3300025928 Bacteria 2967
434 Ga0207664_10018311 3300025929 Bacteria 5153
435 Ga0207664_10148265 3300025929 Bacteria 1991
436 Ga0207664_10223747 3300025929 Bacteria 1633
437 Ga0207664_10417643 3300025929 Unclassified 1194
438 Ga0207644_10001939 3300025931 Bacteria 13429
439 Ga0207644_10002173 3300025931 Bacteria 12718
440 Ga0207644_10002879 3300025931 Bacteria 11088
441 Ga0207644_10035437 3300025931 Bacteria 3496
442 Ga0207644_10100288 3300025931 Bacteria 2174
443 Ga0207644_10252266 3300025931 Bacteria 1408
444 Ga0207644_10694750 3300025931 Unclassified 848
445 Ga0207690_10000336 3300025932 Bacteria 31366
446 Ga0207690_10046366 3300025932 Bacteria 2878
447 Ga0207690_10107730 3300025932 Bacteria 2002
448 Ga0207690_10129118 3300025932 Bacteria 1847
449 Ga0207690_10625165 3300025932 Bacteria 881
450 Ga0207690_10636399 3300025932 Bacteria 873
451 Ga0207690_10790303 3300025932 Bacteria 784
452 Ga0207706_10000151 3300025933 Bacteria 76455
453 Ga0207706_10003867 3300025933 Bacteria 14253
454 Ga0207706_10004826 3300025933 Bacteria 12629
455 Ga0207706_10009071 3300025933 Bacteria 9149
456 Ga0207706_10018409 3300025933 Bacteria 6284
457 Ga0207706_10023519 3300025933 Bacteria 5533
458 Ga0207706_10034760 3300025933 Bacteria 4484
459 Ga0207706_10065000 3300025933 Bacteria 3212
460 Ga0207706_10219213 3300025933 Bacteria 1666
461 Ga0207686_10051629 3300025934 Bacteria 2562
462 Ga0207669_10155462 3300025937 Bacteria 1608
463 Ga0207704_10017699 3300025938 Bacteria 3702
464 Ga0207704_10034950 3300025938 Bacteria 2874
465 Ga0207691_10000820 3300025940 Bacteria 30962
466 Ga0207691_10016044 3300025940 Bacteria 7116
467 Ga0207691_10084596 3300025940 Bacteria 2847
468 Ga0207691_10124772 3300025940 Bacteria 2279
469 Ga0207691_10137776 3300025940 Bacteria 2152
470 Ga0207711_10008612 3300025941 Bacteria 8527
471 Ga0207711_10024488 3300025941 Bacteria 5059
472 Ga0207711_10040147 3300025941 Bacteria 3981
473 Ga0207711_10040170 3300025941 Bacteria 3980
474 Ga0207711_10055876 3300025941 Bacteria 3390
475 Ga0207711_10094503 3300025941 Bacteria 2635
476 Ga0207711_10100982 3300025941 Bacteria 2553
477 Ga0207689_10000388 3300025942 Bacteria 41360
478 Ga0207689_10015103 3300025942 Bacteria 6546
479 Ga0207689_10015796 3300025942 Bacteria 6392
480 Ga0207661_10018153 3300025944 Bacteria 5226
481 Ga0207661_10265482 3300025944 Bacteria 1530
482 Ga0207679_10000167 3300025945 Bacteria 54388
483 Ga0207679_10005851 3300025945 Bacteria 7723
484 Ga0207679_10104552 3300025945 Bacteria 2222
485 Ga0207679_10110560 3300025945 Bacteria 2168
486 Ga0207679_10141669 3300025945 Bacteria 1944
487 Ga0207679_10164433 3300025945 Bacteria 1820
488 Ga0207679_10277798 3300025945 Bacteria 1435
489 Ga0207679_10350666 3300025945 Bacteria 1286
490 Ga0207667_10003576 3300025949 Bacteria 19204
491 Ga0207667_10013960 3300025949 Bacteria 9176
492 Ga0207667_10017856 3300025949 Bacteria 7975
493 Ga0207667_10026541 3300025949 Bacteria 6324
494 Ga0207667_10080054 3300025949 Bacteria 3385
495 Ga0207667_10081095 3300025949 Bacteria 3361
496 Ga0207667_10093089 3300025949 Bacteria 3112
497 Ga0207667_10429213 3300025949 Bacteria 1344
498 Ga0207651_10001258 3300025960 Bacteria 11415
499 Ga0207651_10017340 3300025960 Bacteria 4252
500 Ga0207651_10159163 3300025960 Unclassified 1768
501 Ga0207651_10379490 3300025960 Bacteria 1197
502 Ga0207712_10005299 3300025961 Bacteria 8144
503 Ga0207668_10000064 3300025972 Bacteria 87025
504 Ga0207668_10051949 3300025972 Bacteria 2834
505 Ga0207668_10356772 3300025972 Bacteria 1224
506 Ga0207640_10008520 3300025981 Bacteria 5697
507 Ga0207640_10012372 3300025981 Bacteria 4856
508 Ga0207640_10020609 3300025981 Bacteria 3917
509 Ga0207640_10027749 3300025981 Bacteria 3453
510 Ga0207640_10042049 3300025981 Bacteria 2911
511 Ga0207640_10319098 3300025981 Unclassified 1236
512 Ga0207658_10014202 3300025986 Bacteria 5454
513 Ga0207658_10014325 3300025986 Bacteria 5430
514 Ga0207658_10037827 3300025986 Bacteria 3471
515 Ga0207658_10046381 3300025986 Bacteria 3173
516 Ga0207658_10282349 3300025986 Bacteria 1424
517 Ga0207658_10428777 3300025986 Bacteria 1167
518 Ga0207677_10044625 3300026023 Bacteria 2954
519 Ga0207677_10158318 3300026023 Bacteria 1756
520 Ga0207677_10173677 3300026023 Bacteria 1688
521 Ga0207677_10272141 3300026023 Bacteria 1386
522 Ga0207703_10015823 3300026035 Bacteria 5884
523 Ga0207703_10025257 3300026035 Bacteria 4672
524 Ga0207703_10053107 3300026035 Bacteria 3293
525 Ga0207703_10086734 3300026035 Bacteria 2623
526 Ga0207639_10000509 3300026041 Bacteria 26911
527 Ga0207639_10030250 3300026041 Bacteria 3970
528 Ga0207639_10057348 3300026041 Bacteria 2990
529 Ga0207639_10091755 3300026041 Bacteria 2433
530 Ga0207639_10782100 3300026041 Bacteria 889
531 Ga0207678_10000558 3300026067 Bacteria 34014
532 Ga0207678_10005413 3300026067 Bacteria 11434
533 Ga0207678_10012270 3300026067 Bacteria 7524
534 Ga0207678_10018757 3300026067 Bacteria 6076
535 Ga0207678_10026643 3300026067 Bacteria 5043
536 Ga0207678_10136740 3300026067 Bacteria 2091
537 Ga0207702_10002614 3300026078 Bacteria 16915
538 Ga0207702_10011636 3300026078 Bacteria 7330
539 Ga0207702_10054061 3300026078 Bacteria 3401
540 Ga0207702_10098351 3300026078 Bacteria 2577
541 Ga0207702_10110007 3300026078 Bacteria 2448
542 Ga0207702_10129848 3300026078 Unclassified 2266
543 Ga0207702_10173724 3300026078 Unclassified 1978
544 Ga0207702_10187346 3300026078 Bacteria 1909
545 Ga0207702_10243329 3300026078 Bacteria 1686
546 Ga0207641_10008780 3300026088 Bacteria 8346
547 Ga0207641_10018514 3300026088 Bacteria 5711
548 Ga0207641_10131075 3300026088 Bacteria 2251
549 Ga0207648_10001715 3300026089 Bacteria 23988
550 Ga0207648_10002592 3300026089 Bacteria 19358
551 Ga0207648_10028120 3300026089 Bacteria 4987
552 Ga0207648_10107154 3300026089 Bacteria 2453
553 Ga0207676_10002035 3300026095 Bacteria 14696
554 Ga0207676_10036208 3300026095 Bacteria 3753
555 Ga0207676_10086388 3300026095 Bacteria 2562
556 Ga0207676_10304686 3300026095 Bacteria 1456
557 Ga0207676_10333645 3300026095 Bacteria 1397
558 Ga0207674_10000464 3300026116 Bacteria 53168
559 Ga0207674_10002680 3300026116 Bacteria 22216
560 Ga0207674_10011930 3300026116 Bacteria 9743
561 Ga0207674_10059261 3300026116 Bacteria 3875
562 Ga0207674_10076392 3300026116 Bacteria 3357
563 Ga0207674_10573489 3300026116 Unclassified 1090
564 Ga0207675_100197405 3300026118 Bacteria 1932
565 Ga0207675_100198405 3300026118 Bacteria 1927
566 Ga0207683_10001795 3300026121 Bacteria 18993
567 Ga0207683_10025331 3300026121 Bacteria 5117
568 Ga0207683_10123697 3300026121 Bacteria 2323
569 Ga0207698_10009824 3300026142 Bacteria 6115
570 Ga0207698_10046583 3300026142 Bacteria 3276
571 Ga0207698_10060664 3300026142 Bacteria 2942
572 Ga0207698_10230500 3300026142 Bacteria 1681
573 Ga0207698_10342256 3300026142 Bacteria 1409
574 Ga0207698_10635878 3300026142 Bacteria 1055
575 Ga0268266_10008960 3300028379 Bacteria 8858
576 Ga0268266_10010510 3300028379 Bacteria 8087
577 Ga0268266_10016253 3300028379 Bacteria 6361
578 Ga0268266_10076548 3300028379 Bacteria 2908
579 Ga0268266_10107476 3300028379 Unclassified 2467
580 Ga0268266_10184511 3300028379 Bacteria 1901
581 Ga0268266_10274306 3300028379 Bacteria 1566
582 Ga0268265_10003643 3300028380 Bacteria 10991
583 Ga0268265_10083580 3300028380 Bacteria 2528
584 Ga0268265_10162997 3300028380 Unclassified 1896
585 Ga0268265_10451698 3300028380 Bacteria 1200
586 Ga0268264_10003504 3300028381 Bacteria 13526
587 Ga0268264_10026996 3300028381 Bacteria 4690
588 Ga0268264_10031420 3300028381 Bacteria 4354
589 Ga0307408_100058908 3300031548 Bacteria 2794
590 Ga0307405_10158958 3300031731 Bacteria 1598
591 Ga0307413_10017197 3300031824 Bacteria 3760
592 Ga0307410_10008626 3300031852 Bacteria 5665
593 Ga0307406_10261011 3300031901 Bacteria 1310
594 Ga0307407_10058323 3300031903 Bacteria 2243
595 Ga0307412_10021891 3300031911 Bacteria 3910
596 Ga0307412_10293142 3300031911 Bacteria 1282
597 Ga0307409_100122367 3300031995 Bacteria 2206
598 Ga0307409_100706989 3300031995 Unclassified 1008
599 Ga0307416_100009913 3300032002 Bacteria 6267
600 Ga0307416_100225807 3300032002 Bacteria 1800
601 Ga0307416_100364047 3300032002 Bacteria 1469
602 Ga0307414_10003170 3300032004 Bacteria 8743
603 Ga0307414_10089346 3300032004 Bacteria 2283
604 Ga0307414_10092061 3300032004 Bacteria 2255
605 Ga0307411_10000693 3300032005 Bacteria 12374
606 Ga0307415_100031699 3300032126 Bacteria 3409
607 Ga0373930_0042689 3300034816 Unclassified 971
608 Ga0373951_0018128 3300035091 Bacteria 1598
609 Ga0373951_0044121 3300035091 Bacteria 1082
610 Ga0373960_0101983 3300035121 Bacteria 931
611 Ga0373943_0012252 3300035170 Bacteria 3858
612 Ga0373931_0255324 3300035691 Unclassified 1067
613 Ga0373935_0100827 3300035692 Bacteria 1903
614 Ga0373947_0189234 3300035725 Bacteria 1342
615 Ga0373925_0186068 3300037068 Bacteria 1646
616 Ga0395899_0000165 3300037312 Bacteria 102140
617 Ga0395899_0000641 3300037312 Bacteria 36112
618 Ga0395899_0034382 3300037312 Bacteria 3805
619 Ga0395899_0035804 3300037312 Bacteria 3725
620 Ga0395899_0050187 3300037312 Bacteria 3099
621 Ga0395899_0066417 3300037312 Bacteria 2648
622 Ga0395899_0067663 3300037312 Bacteria 2620
623 Ga0395899_0071822 3300037312 Bacteria 2533
624 Ga0395899_0093270 3300037312 Bacteria 2180
625 Ga0395899_0106057 3300037312 Bacteria 2024
626 Ga0395899_0110317 3300037312 Bacteria 1979
627 Ga0395899_0120507 3300037312 Bacteria 1879
628 Ga0395899_0591551 3300037312 Bacteria 708
629 Ga0395900_0001876 3300037418 Bacteria 23887
630 Ga0395900_0001928 3300037418 Bacteria 23514
631 Ga0395900_0011901 3300037418 Bacteria 8895
632 Ga0395900_0026442 3300037418 Bacteria 5942
633 Ga0395900_0033483 3300037418 Bacteria 5288
634 Ga0395900_0038637 3300037418 Bacteria 4921
635 Ga0395900_0056469 3300037418 Bacteria 4041
636 Ga0395900_0063973 3300037418 Bacteria 3781
637 Ga0395900_0087839 3300037418 Bacteria 3195
638 Ga0395900_0091582 3300037418 Bacteria 3124
639 Ga0395900_0127707 3300037418 Bacteria 2607
640 Ga0395900_0176538 3300037418 Bacteria 2172
641 Ga0395900_0178883 3300037418 Bacteria 2156
642 Ga0395900_0194635 3300037418 Bacteria 2055
643 Ga0395900_0210170 3300037418 Bacteria 1965
644 Ga0395900_0222070 3300037418 Bacteria 1904
645 Ga0395900_0232444 3300037418 Bacteria 1853
646 Ga0395900_0306939 3300037418 Bacteria 1571
647 Ga0395900_0350432 3300037418 Bacteria 1450
648 Ga0395900_0498645 3300037418 Bacteria 1168
649 Ga0395900_0688603 3300037418 Bacteria 956
650 Ga0395898_0000245 3300037466 Bacteria 136315
651 Ga0395898_0005895 3300037466 Bacteria 13172
652 Ga0395898_0011512 3300037466 Bacteria 9185
653 Ga0395898_0024546 3300037466 Bacteria 6080
654 Ga0395898_0054565 3300037466 Bacteria 3899
655 Ga0395898_0070445 3300037466 Bacteria 3380
656 Ga0395898_0086210 3300037466 Bacteria 3027
657 Ga0395898_0116807 3300037466 Bacteria 2556
658 Ga0395898_0129202 3300037466 Bacteria 2420
659 Ga0395898_0140295 3300037466 Bacteria 2314
660 Ga0395898_0235649 3300037466 Bacteria 1745
661 Ga0395898_0298521 3300037466 Bacteria 1537
662 Ga0395905_0000006 3300037471 Bacteria 549428
663 Ga0395905_0001020 3300037471 Bacteria 35732
664 Ga0395905_0001766 3300037471 Bacteria 25131
665 Ga0395905_0005317 3300037471 Bacteria 13160
666 Ga0395905_0006531 3300037471 Bacteria 11726
667 Ga0395905_0007765 3300037471 Bacteria 10639
668 Ga0395905_0018512 3300037471 Bacteria 6611
669 Ga0395905_0021170 3300037471 Bacteria 6155
670 Ga0395905_0028064 3300037471 Bacteria 5307
671 Ga0395905_0056320 3300037471 Bacteria 3678
672 Ga0395905_0060636 3300037471 Bacteria 3537
673 Ga0395905_0071149 3300037471 Bacteria 3261
674 Ga0395905_0082225 3300037471 Bacteria 3018
675 Ga0395905_0085391 3300037471 Bacteria 2957
676 Ga0395905_0107909 3300037471 Bacteria 2614
677 Ga0395905_0129586 3300037471 Bacteria 2372
678 Ga0395905_0166222 3300037471 Bacteria 2073
679 Ga0395905_0179035 3300037471 Bacteria 1990
680 Ga0395905_0200789 3300037471 Bacteria 1869
681 Ga0395905_0208002 3300037471 Bacteria 1834
682 Ga0395905_0277452 3300037471 Unclassified 1562
683 Ga0395905_0278292 3300037471 Bacteria 1559
684 Ga0395905_0465901 3300037471 Bacteria 1162
685 Ga0395905_0585358 3300037471 Bacteria 1017
686 Ga0395905_0666658 3300037471 Bacteria 942
687 Ga0395901_0000035 3300038443 Bacteria 223888
688 Ga0395901_0002842 3300038443 Bacteria 17486
689 Ga0395901_0005053 3300038443 Bacteria 13322
690 Ga0395901_0010057 3300038443 Bacteria 9587
691 Ga0395901_0019861 3300038443 Bacteria 6872
692 Ga0395901_0046199 3300038443 Bacteria 4522
693 Ga0395901_0062455 3300038443 Bacteria 3876
694 Ga0395901_0066468 3300038443 Bacteria 3755
695 Ga0395901_0076716 3300038443 Bacteria 3487
696 Ga0395901_0107715 3300038443 Bacteria 2925
697 Ga0395901_0115893 3300038443 Bacteria 2814
698 Ga0395901_0119215 3300038443 Bacteria 2773
699 Ga0395901_0125077 3300038443 Bacteria 2702
700 Ga0395901_0176425 3300038443 Bacteria 2241
701 Ga0395901_0707863 3300038443 Bacteria 1004
702 Ga0439432_023681 3300042006 Bacteria 2021
703 Ga0466966_0044767 3300044684 Bacteria 2832
704 Ga0466963_0067460 3300044694 Bacteria 2401
705 Ga0466963_0177058 3300044694 Unclassified 1488
706 Ga0466971_0052474 3300044719 Bacteria 1836
707 Ga0466971_0093852 3300044719 Bacteria 1375
708 Ga0466970_0098790 3300044765 Bacteria 1589
709 Ga0466970_0135368 3300044765 Unclassified 1355
710 Ga0466970_0455931 3300044765 Unclassified 733
711 Ga0466957_0036964 3300044842 Bacteria 2938
712 Ga0466957_0063248 3300044842 Unclassified 2274
713 Ga0466957_0069199 3300044842 Bacteria 2180
714 Ga0466957_0084591 3300044842 Bacteria 1980
715 Ga0466957_0498120 3300044842 Bacteria 844
716 Ga0466960_0094889 3300044901 Bacteria 1527
717 Ga0466959_0224203 3300045049 Bacteria 1303
718 Ga0451576_0033660 3300045051 Bacteria 5447
719 Ga0466958_0060719 3300045836 Bacteria 2301
720 Ga0466967_0020974 3300045976 Bacteria 5293
721 Ga0466967_0022379 3300045976 Bacteria 5156
722 Ga0466967_0041411 3300045976 Bacteria 3971
723 Ga0466967_0121032 3300045976 Bacteria 2418
724 Ga0466967_0229294 3300045976 Unclassified 1768
725 Ga0466967_0575671 3300045976 Unclassified 1110
726 Ga0466967_0674195 3300045976 Bacteria 1023
727 Ga0495629_0281604 3300046459 Bacteria 1141
728 Ga0495668_0016029 3300046616 Bacteria 4364
729 Ga0495669_0003617 3300046684 Bacteria 6363
730 Ga0495669_0009151 3300046684 Bacteria 4173
731 Ga0495669_0106382 3300046684 Bacteria 1307
732 Ga0495669_0291960 3300046684 Bacteria 785
733 Ga0495687_151782 3300047443 Bacteria 791
734 Ga0495677_0015292 3300047445 Bacteria 2788
735 Ga0496100_0042489 3300048903 Bacteria 2903
736 Ga0496101_0040418 3300048904 Bacteria 3322
737 Ga0496101_0059405 3300048904 Bacteria 2771
738 Ga0496101_0230189 3300048904 Bacteria 1440
739 Ga0496101_0577413 3300048904 Unclassified 889
740 Ga0496103_0024943 3300048906 Bacteria 3610
741 Ga0496105_0045432 3300048908 Bacteria 3624
742 Ga0496106_0001125 3300048909 Bacteria 19791
743 Ga0496106_0240147 3300048909 Bacteria 1448
744 Ga0496106_0418398 3300048909 Unclassified 1077
745 Ga0496107_0008891 3300048910 Bacteria 6959
746 Ga0496107_0015706 3300048910 Bacteria 5308
747 Ga0496107_0043781 3300048910 Bacteria 3217
748 Ga0496107_0172524 3300048910 Bacteria 1605
749 Ga0496107_0230097 3300048910 Bacteria 1379
750 Ga0496108_0014911 3300048911 Bacteria 6343
751 Ga0496108_0018467 3300048911 Bacteria 5709
752 Ga0496108_0022162 3300048911 Bacteria 5222
753 Ga0496108_0038453 3300048911 Bacteria 3986
754 Ga0496109_0012658 3300048912 Bacteria 7288
755 Ga0496109_0037331 3300048912 Bacteria 4389
756 Ga0496109_0048115 3300048912 Bacteria 3879
757 Ga0496109_0063063 3300048912 Bacteria 3390
758 Ga0496109_0181861 3300048912 Bacteria 1975
759 Ga0496109_0492133 3300048912 Bacteria 1157
760 Ga0496109_0798708 3300048912 Unclassified 882
761 Ga0496110_0012573 3300048913 Bacteria 6963
762 Ga0496110_0013508 3300048913 Bacteria 6755
763 Ga0496110_0028575 3300048913 Bacteria 4791
764 Ga0496110_0055131 3300048913 Bacteria 3497
765 Ga0496110_0126858 3300048913 Bacteria 2302
766 Ga0496111_0003461 3300048914 Bacteria 9767
767 Ga0496111_0012588 3300048914 Bacteria 5733
768 Ga0496111_0017119 3300048914 Bacteria 5005
769 Ga0496111_0056080 3300048914 Bacteria 2850
770 Ga0496111_0172485 3300048914 Bacteria 1607
771 Ga0496112_0020796 3300048915 Bacteria 6228
772 Ga0496112_0025751 3300048915 Bacteria 5650
773 Ga0496112_0035170 3300048915 Bacteria 4877
774 Ga0496112_0038350 3300048915 Bacteria 4677
775 Ga0496112_0088182 3300048915 Bacteria 3070
776 Ga0496112_0129259 3300048915 Bacteria 2497
777 Ga0496112_0156545 3300048915 Bacteria 2245
778 Ga0496112_0156979 3300048915 Bacteria 2242
779 Ga0496113_0016010 3300048916 Bacteria 5172
780 Ga0496113_0047939 3300048916 Bacteria 3177
781 Ga0496113_0051205 3300048916 Bacteria 3081
782 Ga0496113_0097704 3300048916 Bacteria 2272
783 Ga0496113_0102801 3300048916 Bacteria 2216
784 Ga0496115_0004708 3300048918 Bacteria 9893
785 Ga0501074_0021394 3300049590 Bacteria 4697
786 Ga0501227_035861 3300049665 Bacteria 1209
787 Ga0501235_048925 3300049669 Bacteria 977
788 Ga0501225_0014022 3300049705 Bacteria 2241
789 Ga0501080_0085109 3300049742 Bacteria 2938
790 Ga0501272_001833 3300049769 Bacteria 2069
791 nmdc:mga0rr50_158110_c1 3300050513 Bacteria 1837
792 nmdc:mga0a205_7359_c1 3300050515 Bacteria 9969
793 Ga0500559_0150649 3300053136 Bacteria 1091
794 Ga0466962_0038244 3300061719 Bacteria 2298
795 Ga0070664_100011028
796 JGI24740J21852_10008588
797 JGI24740J21852_10011658
798 JGI24739J22299_10003233
799 JGI24739J22299_10012916
800 JGI24737J22298_10000012
801 JGI24737J22298_10001207
802 JGI24737J22298_10066103
803 JGI24743J22301_10005946
804 JGI24735J21928_10015470
805 JGI24738J21930_10000563
806 JGI24738J21930_10001600
807 JGI24738J21930_10017886
808 rootL2_10210268
809 rootH1_10250591
810 Ga0070658_10000131
811 Ga0070658_10003622
812 Ga0070658_10008574
813 Ga0070658_10047913
814 Ga0070658_10049560
815 Ga0070658_10096144
816 Ga0070676_10003050
817 Ga0070676_10004720
818 Ga0070676_10221307
819 Ga0070683_100012183
820 Ga0070683_100015761
821 Ga0070683_100019718
822 Ga0070683_100105733
823 Ga0070683_100205538
824 Ga0070690_100170018
825 Ga0070670_100065797
826 Ga0070670_100075704
827 Ga0070670_100174362
828 Ga0070677_10030007
829 Ga0070677_10092482
830 Ga0068869_100012435
831 Ga0068869_100426737
832 Ga0070666_10000163
833 Ga0070666_10003055
834 Ga0070666_10026764
835 Ga0070666_10352182
836 Ga0070680_100018597
837 Ga0070680_100078883
838 Ga0070680_100340513
839 Ga0070682_100018778
840 Ga0070682_100066991
841 Ga0070682_100083444
842 Ga0068868_100002931
843 Ga0068868_100017771
844 Ga0068868_100027939
845 Ga0068868_100395757
846 Ga0070660_100000263
847 Ga0070660_100002246
848 Ga0070660_100003698
849 Ga0070660_100007255
850 Ga0070660_100016909
851 Ga0070660_100021099
852 Ga0070660_100030016
853 Ga0070660_100060332
854 Ga0070660_100085980
855 Ga0070660_100269315
856 Ga0070689_100181774
857 Ga0070691_10080172
858 Ga0070687_100271589
859 Ga0070687_100315935
860 Ga0070661_100000075
861 Ga0070661_100024802
862 Ga0070661_100059701
863 Ga0070661_100072937
864 Ga0070661_100090858
865 Ga0070661_100133608
866 Ga0070692_10001815
867 Ga0070692_10189060
868 Ga0070668_100003938
869 Ga0070668_100044055
870 Ga0070668_100121887
871 Ga0070669_100003019
872 Ga0070669_100058675
873 Ga0070669_100136276
874 Ga0070669_100290235
875 Ga0070669_100332368
876 Ga0070675_100023024
877 Ga0070675_100127767
878 Ga0070671_100004930
879 Ga0070671_100010191
880 Ga0070671_100038219
881 Ga0070671_100046940
882 Ga0070671_100056822
883 Ga0070671_100108296
884 Ga0070671_100110628
885 Ga0070671_100206155
886 Ga0070671_100646529
887 Ga0070674_100006585
888 Ga0070674_100010999
889 Ga0070674_100379220
890 Ga0070673_100000346
891 Ga0070673_100001961
892 Ga0070673_100019419
893 Ga0070673_100055235
894 Ga0070673_100105229
895 Ga0070673_100128965
896 Ga0070673_100169169
897 Ga0070659_100000126
898 Ga0070659_100008736
899 Ga0070659_100033150
900 Ga0070659_100089935
901 Ga0070659_100140889
902 Ga0070659_100145841
903 Ga0070659_100200354
904 Ga0070659_100407407
905 Ga0070659_100657753
906 Ga0070667_100006962
907 Ga0070667_100021202
908 Ga0070667_100034302
909 Ga0070667_100040839
910 Ga0070667_100044960
911 Ga0070667_100061568
912 Ga0070667_100093366
913 Ga0070667_100144819
914 Ga0070667_100170625
915 Ga0070667_100286389
916 Ga0070709_10102560
917 Ga0070714_100014533
918 Ga0070714_100016091
919 Ga0070714_100082803
920 Ga0070714_100161381
921 Ga0070713_100012697
922 Ga0070713_100537048
923 Ga0070694_100028074
924 Ga0070663_100003721
925 Ga0070663_100006030
926 Ga0070663_100013415
927 Ga0070663_100054331
928 Ga0070663_100202090
929 Ga0070678_100003987
930 Ga0070678_100011406
931 Ga0070678_100042833
932 Ga0070678_100079551
933 Ga0070678_100080231
934 Ga0070678_100128199
935 Ga0070662_100000121
936 Ga0070662_100003608
937 Ga0070662_100005025
938 Ga0070662_100012432
939 Ga0070662_100017201
940 Ga0070662_100041447
941 Ga0070662_100052560
942 Ga0070662_100311010
943 Ga0070662_100398673
944 Ga0070681_10013184
945 Ga0070681_10378744
946 Ga0068867_100002055
947 Ga0068867_100008430
948 Ga0068867_100050916
949 Ga0070679_100014193
950 Ga0070679_100038561
951 Ga0070679_100232043
952 Ga0070679_100264361
953 Ga0070679_100730652
954 Ga0070684_100031642
955 Ga0068853_100000078
956 Ga0068853_100036226
957 Ga0068853_100051588
958 Ga0068853_100093234
959 Ga0068853_100119733
960 Ga0068853_100178085
961 Ga0068853_100303680
962 Ga0070672_100004454
963 Ga0070672_100192112
964 Ga0070672_100334497
965 Ga0070696_100022997
966 Ga0070693_100007236
967 Ga0070693_100041029
968 Ga0070693_100059064
969 Ga0070665_100001986
970 Ga0070665_100013938
971 Ga0070665_100018165
972 Ga0070665_100039310
973 Ga0070665_100045505
974 Ga0070665_100063276
975 Ga0068855_100016758
976 Ga0068855_100020515
977 Ga0068855_100038374
978 Ga0068855_100046168
979 Ga0068855_100085406
980 Ga0068855_100090126
981 Ga0068855_100116127
982 Ga0068855_100139421
983 Ga0070664_100000320
984 Ga0070664_100005006
985 Ga0070664_100021384
986 Ga0070664_100022931
987 Ga0070664_100027118
988 Ga0070664_100080219
989 Ga0070664_100111344
990 Ga0070664_100151949
991 Ga0070664_100603534
992 Ga0070664_100896342
993 Ga0068857_100012466
994 Ga0068857_100015401
995 Ga0068857_100023201
996 Ga0068857_100055296
997 Ga0068857_100148522
998 Ga0068857_100653642
999 Ga0068854_100003071
1000 Ga0068854_100003909
1001 Ga0068854_100005446
1002 Ga0068854_100029474
1003 Ga0068854_100107996
1004 Ga0068854_100477477
1005 Ga0068856_100000766
1006 Ga0068856_100025192
1007 Ga0068856_100038780
1008 Ga0068856_100040064
1009 Ga0068856_100084753
1010 Ga0068856_100257693
1011 Ga0068856_100292814
1012 Ga0070702_100222607
1013 Ga0068852_100000220
1014 Ga0068852_100001353
1015 Ga0068852_100011324
1016 Ga0068852_100014904
1017 Ga0068852_100059582
1018 Ga0068852_100089670
1019 Ga0068852_100189111
1020 Ga0068852_100203324
1021 Ga0068852_100350721
1022 Ga0068859_100003413
1023 Ga0068859_100064046
1024 Ga0068859_100160980
1025 Ga0068859_100485113
1026 Ga0068859_100988704
1027 Ga0068864_100002627
1028 Ga0068864_100033577
1029 Ga0068864_100042927
1030 Ga0068864_100113033
1031 Ga0068864_100174825
1032 Ga0068864_100528440
1033 Ga0068866_10048971
1034 Ga0068866_10049281
1035 Ga0068861_100420988
1036 Ga0068851_10025914
1037 Ga0068851_10061905
1038 Ga0068851_10242105
1039 Ga0068851_10383744
1040 Ga0068863_100006484
1041 Ga0068863_100012578
1042 Ga0068863_100018494
1043 Ga0068863_100071822
1044 Ga0068858_100017162
1045 Ga0068858_100042720
1046 Ga0068858_100070820
1047 Ga0068858_100177631
1048 Ga0068860_100015079
1049 Ga0068860_100025237
1050 Ga0068860_100202624
1051 Ga0068860_100245879
1052 Ga0068860_100646280
1053 Ga0068862_100004991
1054 Ga0068862_100012124
1055 Ga0068862_100014742
1056 Ga0068862_100470959
1057 Ga0068862_100555850
1058 Ga0070717_10117475
1059 Ga0070716_100019259
1060 Ga0070712_100041725
1061 Ga0097621_100006246
1062 Ga0097621_100012176
1063 Ga0097621_100023857
1064 Ga0097621_100074840
1065 Ga0068871_100009000
1066 Ga0068871_100044237
1067 Ga0068871_100047296
1068 Ga0068871_100058215
1069 Ga0068871_100094105
1070 Ga0075431_100617305
1071 Ga0075433_10115341
1072 Ga0075434_100521073
1073 Ga0068865_100002364
1074 Ga0068865_100016153
1075 Ga0068865_100043772
1076 Ga0097620_100003413
1077 Ga0097620_100064044
1078 Ga0097620_100160975
1079 Ga0097620_100485077
1080 Ga0097620_100988538
1081 Ga0075435_100144001
1082 Ga0105240_10010272
1083 Ga0105245_10026154
1084 Ga0105241_10009477
1085 Ga0105241_10041531
1086 Ga0105241_10342216
1087 Ga0105242_10041503
1088 Ga0105242_10298791
1089 Ga0105248_10001155
1090 Ga0105248_10002104
1091 Ga0105248_10004368
1092 Ga0105248_10010467
1093 Ga0105248_10021479
1094 Ga0105248_10093864
1095 Ga0105248_10117950
1096 Ga0105248_10133025
1097 Ga0105248_10589850
1098 Ga0105248_10680813
1099 Ga0105237_10472822
1100 Ga0105238_10047678
1101 Ga0105238_10380407
1102 Ga0105249_10506228
1103 Ga0105239_10192431
1104 Ga0105239_10459827
1105 Ga0105246_10035411
1106 Ga0105246_10245480
1107 Ga0157373_10003202
1108 Ga0157373_10023557
1109 Ga0157373_10026761
1110 Ga0157373_10069984
1111 Ga0157373_10081853
1112 Ga0157373_10130173
1113 Ga0157373_10280424
1114 Ga0157371_10001324
1115 Ga0157371_10007597
1116 Ga0157371_10010147
1117 Ga0157371_10033185
1118 Ga0157371_10037728
1119 Ga0157371_10078728
1120 Ga0157371_10324698
1121 Ga0157370_10077227
1122 Ga0157370_10117833
1123 Ga0157370_10121423
1124 Ga0157370_10315533
1125 Ga0157369_10066042
1126 Ga0157369_10134248
1127 Ga0157369_10191088
1128 Ga0157369_10422492
1129 Ga0157369_10430341
1130 Ga0157369_10846671
1131 Ga0157374_10031468
1132 Ga0157374_10053765
1133 Ga0157374_10133994
1134 Ga0157378_10419825
1135 Ga0163162_10047892
1136 Ga0163162_10139650
1137 Ga0163162_10329199
1138 Ga0157372_10049246
1139 Ga0157372_10058233
1140 Ga0157372_10060600
1141 Ga0157372_11280145
1142 Ga0157375_10005855
1143 Ga0157375_10041667
1144 Ga0157375_10057455
1145 Ga0163163_10000058
1146 Ga0163163_10026200
1147 Ga0163163_10055056
1148 Ga0157380_10031571
1149 Ga0157377_10042221
1150 Ga0157377_10087530
1151 Ga0157379_10001782
1152 Ga0157379_10555872
1153 Ga0206354_10264634
1154 Ga0206353_10479671
1155 Ga0206353_11794012
1156 Ga0207697_10000069
1157 Ga0207697_10026989
1158 Ga0207697_10054284
1159 Ga0207656_10005724
1160 Ga0207656_10039535
1161 Ga0207656_10119840
1162 Ga0207682_10049032
1163 Ga0207688_10065425
1164 Ga0207680_10001182
1165 Ga0207680_10002033
1166 Ga0207680_10057220
1167 Ga0207680_10068445
1168 Ga0207680_10069998
1169 Ga0207647_10000409
1170 Ga0207647_10007820
1171 Ga0207647_10009183
1172 Ga0207699_10072392
1173 Ga0207645_10006986
1174 Ga0207645_10023343
1175 Ga0207645_10047765
1176 Ga0207645_10103152
1177 Ga0207705_10000074
1178 Ga0207705_10000743
1179 Ga0207705_10008531
1180 Ga0207705_10018275
1181 Ga0207705_10028135
1182 Ga0207705_10145327
1183 Ga0207705_10147568
1184 Ga0207705_10236589
1185 Ga0207705_10302847
1186 Ga0207705_10486517
1187 Ga0207654_10133542
1188 Ga0207707_10116044
1189 Ga0207707_10167769
1190 Ga0207695_10354933
1191 Ga0207695_10424846
1192 Ga0207693_10051090
1193 Ga0207660_10001957
1194 Ga0207660_10046416
1195 Ga0207660_10064526
1196 Ga0207660_10069728
1197 Ga0207660_10283207
1198 Ga0207662_10224774
1199 Ga0207657_10000126
1200 Ga0207657_10001620
1201 Ga0207657_10001861
1202 Ga0207657_10002435
1203 Ga0207657_10002695
1204 Ga0207657_10011418
1205 Ga0207657_10018957
1206 Ga0207657_10021095
1207 Ga0207657_10042893
1208 Ga0207657_10073859
1209 Ga0207657_10103045
1210 Ga0207649_10002272
1211 Ga0207649_10007491
1212 Ga0207649_10134865
1213 Ga0207652_10027749
1214 Ga0207652_10165438
1215 Ga0207681_10002521
1216 Ga0207681_10023350
1217 Ga0207681_10136177
1218 Ga0207694_10067348
1219 Ga0207650_10005773
1220 Ga0207650_10009645
1221 Ga0207650_10048344
1222 Ga0207650_10143644
1223 Ga0207650_10267776
1224 Ga0207650_10439594
1225 Ga0207659_10035284
1226 Ga0207687_10008831
1227 Ga0207700_10055929
1228 Ga0207664_10018311
1229 Ga0207664_10148265
1230 Ga0207664_10223747
1231 Ga0207664_10417643
1232 Ga0207644_10001939
1233 Ga0207644_10002173
1234 Ga0207644_10002879
1235 Ga0207644_10035437
1236 Ga0207644_10100288
1237 Ga0207644_10252266
1238 Ga0207644_10694750
1239 Ga0207690_10000336
1240 Ga0207690_10046366
1241 Ga0207690_10107730
1242 Ga0207690_10129118
1243 Ga0207690_10625165
1244 Ga0207690_10636399
1245 Ga0207690_10790303
1246 Ga0207706_10000151
1247 Ga0207706_10003867
1248 Ga0207706_10004826
1249 Ga0207706_10009071
1250 Ga0207706_10018409
1251 Ga0207706_10023519
1252 Ga0207706_10034760
1253 Ga0207706_10065000
1254 Ga0207706_10219213
1255 Ga0207686_10051629
1256 Ga0207669_10155462
1257 Ga0207704_10017699
1258 Ga0207704_10034950
1259 Ga0207691_10000820
1260 Ga0207691_10016044
1261 Ga0207691_10084596
1262 Ga0207691_10124772
1263 Ga0207691_10137776
1264 Ga0207711_10008612
1265 Ga0207711_10024488
1266 Ga0207711_10040147
1267 Ga0207711_10040170
1268 Ga0207711_10055876
1269 Ga0207711_10094503
1270 Ga0207711_10100982
1271 Ga0207689_10000388
1272 Ga0207689_10015103
1273 Ga0207689_10015796
1274 Ga0207661_10018153
1275 Ga0207661_10265482
1276 Ga0207679_10000167
1277 Ga0207679_10005851
1278 Ga0207679_10104552
1279 Ga0207679_10110560
1280 Ga0207679_10141669
1281 Ga0207679_10164433
1282 Ga0207679_10277798
1283 Ga0207679_10350666
1284 Ga0207667_10003576
1285 Ga0207667_10013960
1286 Ga0207667_10017856
1287 Ga0207667_10026541
1288 Ga0207667_10080054
1289 Ga0207667_10081095
1290 Ga0207667_10093089
1291 Ga0207667_10429213
1292 Ga0207651_10001258
1293 Ga0207651_10017340
1294 Ga0207651_10159163
1295 Ga0207651_10379490
1296 Ga0207712_10005299
1297 Ga0207668_10000064
1298 Ga0207668_10051949
1299 Ga0207668_10356772
1300 Ga0207640_10008520
1301 Ga0207640_10012372
1302 Ga0207640_10020609
1303 Ga0207640_10027749
1304 Ga0207640_10042049
1305 Ga0207640_10319098
1306 Ga0207658_10014202
1307 Ga0207658_10014325
1308 Ga0207658_10037827
1309 Ga0207658_10046381
1310 Ga0207658_10282349
1311 Ga0207658_10428777
1312 Ga0207677_10044625
1313 Ga0207677_10158318
1314 Ga0207677_10173677
1315 Ga0207677_10272141
1316 Ga0207703_10015823
1317 Ga0207703_10025257
1318 Ga0207703_10053107
1319 Ga0207703_10086734
1320 Ga0207639_10000509
1321 Ga0207639_10030250
1322 Ga0207639_10057348
1323 Ga0207639_10091755
1324 Ga0207639_10782100
1325 Ga0207678_10000558
1326 Ga0207678_10005413
1327 Ga0207678_10012270
1328 Ga0207678_10018757
1329 Ga0207678_10026643
1330 Ga0207678_10136740
1331 Ga0207702_10002614
1332 Ga0207702_10011636
1333 Ga0207702_10054061
1334 Ga0207702_10098351
1335 Ga0207702_10110007
1336 Ga0207702_10129848
1337 Ga0207702_10173724
1338 Ga0207702_10187346
1339 Ga0207702_10243329
1340 Ga0207641_10008780
1341 Ga0207641_10018514
1342 Ga0207641_10131075
1343 Ga0207648_10001715
1344 Ga0207648_10002592
1345 Ga0207648_10028120
1346 Ga0207648_10107154
1347 Ga0207676_10002035
1348 Ga0207676_10036208
1349 Ga0207676_10086388
1350 Ga0207676_10304686
1351 Ga0207676_10333645
1352 Ga0207674_10000464
1353 Ga0207674_10002680
1354 Ga0207674_10011930
1355 Ga0207674_10059261
1356 Ga0207674_10076392
1357 Ga0207674_10573489
1358 Ga0207675_100197405
1359 Ga0207675_100198405
1360 Ga0207683_10001795
1361 Ga0207683_10025331
1362 Ga0207683_10123697
1363 Ga0207698_10009824
1364 Ga0207698_10046583
1365 Ga0207698_10060664
1366 Ga0207698_10230500
1367 Ga0207698_10342256
1368 Ga0207698_10635878
1369 Ga0268266_10008960
1370 Ga0268266_10010510
1371 Ga0268266_10016253
1372 Ga0268266_10076548
1373 Ga0268266_10107476
1374 Ga0268266_10184511
1375 Ga0268266_10274306
1376 Ga0268265_10003643
1377 Ga0268265_10083580
1378 Ga0268265_10162997
1379 Ga0268265_10451698
1380 Ga0268264_10003504
1381 Ga0268264_10026996
1382 Ga0268264_10031420
1383 Ga0307408_100058908
1384 Ga0307405_10158958
1385 Ga0307413_10017197
1386 Ga0307410_10008626
1387 Ga0307406_10261011
1388 Ga0307407_10058323
1389 Ga0307412_10021891
1390 Ga0307412_10293142
1391 Ga0307409_100122367
1392 Ga0307409_100706989
1393 Ga0307416_100009913
1394 Ga0307416_100225807
1395 Ga0307416_100364047
1396 Ga0307414_10003170
1397 Ga0307414_10089346
1398 Ga0307414_10092061
1399 Ga0307411_10000693
1400 Ga0307415_100031699
1401 Ga0373930_0042689
1402 Ga0373951_0018128
1403 Ga0373951_0044121
1404 Ga0373960_0101983
1405 Ga0373943_0012252
1406 Ga0373931_0255324
1407 Ga0373935_0100827
1408 Ga0373947_0189234
1409 Ga0373925_0186068
1410 Ga0395899_0000165
1411 Ga0395899_0000641
1412 Ga0395899_0034382
1413 Ga0395899_0035804
1414 Ga0395899_0050187
1415 Ga0395899_0066417
1416 Ga0395899_0067663
1417 Ga0395899_0071822
1418 Ga0395899_0093270
1419 Ga0395899_0106057
1420 Ga0395899_0110317
1421 Ga0395899_0120507
1422 Ga0395899_0591551
1423 Ga0395900_0001876
1424 Ga0395900_0001928
1425 Ga0395900_0011901
1426 Ga0395900_0026442
1427 Ga0395900_0033483
1428 Ga0395900_0038637
1429 Ga0395900_0056469
1430 Ga0395900_0063973
1431 Ga0395900_0087839
1432 Ga0395900_0091582
1433 Ga0395900_0127707
1434 Ga0395900_0176538
1435 Ga0395900_0178883
1436 Ga0395900_0194635
1437 Ga0395900_0210170
1438 Ga0395900_0222070
1439 Ga0395900_0232444
1440 Ga0395900_0306939
1441 Ga0395900_0350432
1442 Ga0395900_0498645
1443 Ga0395900_0688603
1444 Ga0395898_0000245
1445 Ga0395898_0005895
1446 Ga0395898_0011512
1447 Ga0395898_0024546
1448 Ga0395898_0054565
1449 Ga0395898_0070445
1450 Ga0395898_0086210
1451 Ga0395898_0116807
1452 Ga0395898_0129202
1453 Ga0395898_0140295
1454 Ga0395898_0235649
1455 Ga0395898_0298521
1456 Ga0395905_0000006
1457 Ga0395905_0001020
1458 Ga0395905_0001766
1459 Ga0395905_0005317
1460 Ga0395905_0006531
1461 Ga0395905_0007765
1462 Ga0395905_0018512
1463 Ga0395905_0021170
1464 Ga0395905_0028064
1465 Ga0395905_0056320
1466 Ga0395905_0060636
1467 Ga0395905_0071149
1468 Ga0395905_0082225
1469 Ga0395905_0085391
1470 Ga0395905_0107909
1471 Ga0395905_0129586
1472 Ga0395905_0166222
1473 Ga0395905_0179035
1474 Ga0395905_0200789
1475 Ga0395905_0208002
1476 Ga0395905_0277452
1477 Ga0395905_0278292
1478 Ga0395905_0465901
1479 Ga0395905_0585358
1480 Ga0395905_0666658
1481 Ga0395901_0000035
1482 Ga0395901_0002842
1483 Ga0395901_0005053
1484 Ga0395901_0010057
1485 Ga0395901_0019861
1486 Ga0395901_0046199
1487 Ga0395901_0062455
1488 Ga0395901_0066468
1489 Ga0395901_0076716
1490 Ga0395901_0107715
1491 Ga0395901_0115893
1492 Ga0395901_0119215
1493 Ga0395901_0125077
1494 Ga0395901_0176425
1495 Ga0395901_0707863
1496 Ga0439432_023681
1497 Ga0466966_0044767
1498 Ga0466963_0067460
1499 Ga0466963_0177058
1500 Ga0466971_0052474
1501 Ga0466971_0093852
1502 Ga0466970_0098790
1503 Ga0466970_0135368
1504 Ga0466970_0455931
1505 Ga0466957_0036964
1506 Ga0466957_0063248
1507 Ga0466957_0069199
1508 Ga0466957_0084591
1509 Ga0466957_0498120
1510 Ga0466960_0094889
1511 Ga0466959_0224203
1512 Ga0451576_0033660
1513 Ga0466958_0060719
1514 Ga0466967_0020974
1515 Ga0466967_0022379
1516 Ga0466967_0041411
1517 Ga0466967_0121032
1518 Ga0466967_0229294
1519 Ga0466967_0575671
1520 Ga0466967_0674195
1521 Ga0495629_0281604
1522 Ga0495668_0016029
1523 Ga0495669_0003617
1524 Ga0495669_0009151
1525 Ga0495669_0106382
1526 Ga0495669_0291960
1527 Ga0495687_151782
1528 Ga0495677_0015292
1529 Ga0496100_0042489
1530 Ga0496101_0040418
1531 Ga0496101_0059405
1532 Ga0496101_0230189
1533 Ga0496101_0577413
1534 Ga0496103_0024943
1535 Ga0496105_0045432
1536 Ga0496106_0001125
1537 Ga0496106_0240147
1538 Ga0496106_0418398
1539 Ga0496107_0008891
1540 Ga0496107_0015706
1541 Ga0496107_0043781
1542 Ga0496107_0172524
1543 Ga0496107_0230097
1544 Ga0496108_0014911
1545 Ga0496108_0018467
1546 Ga0496108_0022162
1547 Ga0496108_0038453
1548 Ga0496109_0012658
1549 Ga0496109_0037331
1550 Ga0496109_0048115
1551 Ga0496109_0063063
1552 Ga0496109_0181861
1553 Ga0496109_0492133
1554 Ga0496109_0798708
1555 Ga0496110_0012573
1556 Ga0496110_0013508
1557 Ga0496110_0028575
1558 Ga0496110_0055131
1559 Ga0496110_0126858
1560 Ga0496111_0003461
1561 Ga0496111_0012588
1562 Ga0496111_0017119
1563 Ga0496111_0056080
1564 Ga0496111_0172485
1565 Ga0496112_0020796
1566 Ga0496112_0025751
1567 Ga0496112_0035170
1568 Ga0496112_0038350
1569 Ga0496112_0088182
1570 Ga0496112_0129259
1571 Ga0496112_0156545
1572 Ga0496112_0156979
1573 Ga0496113_0016010
1574 Ga0496113_0047939
1575 Ga0496113_0051205
1576 Ga0496113_0097704
1577 Ga0496113_0102801
1578 Ga0496115_0004708
1579 Ga0501074_0021394
1580 Ga0501227_035861
1581 Ga0501235_048925
1582 Ga0501225_0014022
1583 Ga0501080_0085109
1584 Ga0501272_001833
1585 nmdc:mga0rr50_158110_c1
1586 nmdc:mga0a205_7359_c1
1587 Ga0500559_0150649
1588 Ga0466962_0038244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fip-assembly1.cif.gz_A solution nmr structure of pseudomonas aeruginosa tonb ctd 0.6031 118 208
2gsk-assembly1.cif.gz_B structure of the btub:tonb complex 0.5999 117 204
2gsk-assembly1.cif.gz_B structure of the btub:tonb complex 0.5885 117 204
3qdr-assembly1.cif.gz_A structural characterization of the interaction of colicin a, colicin n, and tolb with the tolaiii translocon 0.5729 127 203
6i97-assembly1.cif.gz_E structure of the ferrioxamine b transporter foxa from pseudomonas aeruginosa in complex with ferrioxamine b and a c-terminal tonb fragment 0.5611 117 205
ID Description Score Start End Superfamily
2grxD00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.5366 119 206 3.30.2420.10
2grxD00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.5262 119 206 3.30.2420.10
1u07A00 Alpha Beta;2-Layer Sandwich;TolA/TonB C-terminal domain;TonB 0.5198 117 208 3.30.2420.10
af_E7F069_499_605_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5083 141 159 2.60.40.10
1lr0A00 Alpha Beta;2-Layer Sandwich;Fusion Protein Consisting Of Minor Coat Protein, Glycine Rich Linker, Tola, And A His Tag; Chain: A; Domain 2; 0.5047 126 202 3.30.1150.10
ID Description Score Start End GO Terms
AF-A0A7V8HIE5-F1-model_v4 deleted 0.9369 133 210
AF-A0A537MEK9-F1-model_v4 TonB C-terminal domain-containing protein 0.9311 107 203
AF-A0A4Q2ZF27-F1-model_v4 Energy transducer TonB 0.923 95 208
AF-A0A4R2U4Y6-F1-model_v4 TonB family protein 0.9028 117 203 GO:0005886
GO:0015031
GO:0055085
AF-A0A4Q2ZF27-F1-model_v4 Energy transducer TonB 0.8856 95 208

Map