F480974

General Info

Members Datasets Scaffolds Average Seq Length
791 286 1582 87

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_101871701|Ga0070700_1018717012
Length 84
Sequence MDVEGSVIEVLKNVSRRPIEPTPASDLIADLGFDSLQVMEVVTELEDRFDITIPADALSTGPAAHTVADVIAQVSAIVEGRQRV

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.06
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 28.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_101871701 3300005441 Unclassified 518
2 JGI24751J29686_10117863 3300002459 Unclassified 557
3 Ga0058859_11474252 3300004798 Bacteria 533
4 Ga0065714_10404127 3300005288 Bacteria 587
5 Ga0065712_10098102 3300005290 Bacteria 2130
6 Ga0065715_10100524 3300005293 Bacteria 3294
7 Ga0065715_10533611 3300005293 Unclassified 754
8 Ga0065707_10061121 3300005295 Bacteria 527
9 Ga0065707_10134361 3300005295 Bacteria 1866
10 Ga0070676_10838866 3300005328 Unclassified 681
11 Ga0070676_10923538 3300005328 Unclassified 651
12 Ga0070683_100601367 3300005329 Bacteria 1052
13 Ga0070690_100006060 3300005330 Bacteria 6841
14 Ga0070670_101464691 3300005331 Unclassified 626
15 Ga0068869_100113839 3300005334 Bacteria 2061
16 Ga0068869_100122172 3300005334 Unclassified 1993
17 Ga0068869_100459983 3300005334 Unclassified 1056
18 Ga0068869_101142492 3300005334 Unclassified 683
19 Ga0068869_101666574 3300005334 Bacteria 569
20 Ga0070666_10233764 3300005335 Bacteria 1299
21 Ga0070666_10377336 3300005335 Bacteria 1017
22 Ga0070666_10439171 3300005335 Bacteria 941
23 Ga0070666_10799285 3300005335 Bacteria 695
24 Ga0070666_11509256 3300005335 Bacteria 503
25 Ga0070680_100191100 3300005336 Bacteria 1725
26 Ga0070680_101946472 3300005336 Bacteria 509
27 Ga0068868_100041429 3300005338 Bacteria 3587
28 Ga0068868_100851563 3300005338 Bacteria 826
29 Ga0068868_100930969 3300005338 Unclassified 791
30 Ga0068868_101428796 3300005338 Unclassified 646
31 Ga0070660_100861667 3300005339 Bacteria 763
32 Ga0070660_101461498 3300005339 Unclassified 581
33 Ga0070689_100309094 3300005340 Bacteria 1318
34 Ga0070691_10711158 3300005341 Unclassified 604
35 Ga0070691_10761896 3300005341 Unclassified 586
36 Ga0070691_10887962 3300005341 Bacteria 549
37 Ga0070687_100270933 3300005343 Bacteria 1064
38 Ga0070692_10155628 3300005345 Bacteria 1305
39 Ga0070692_10860550 3300005345 Bacteria 624
40 Ga0070668_102035282 3300005347 Unclassified 530
41 Ga0070669_100003633 3300005353 Bacteria 11127
42 Ga0070669_100118884 3300005353 Bacteria 2013
43 Ga0070669_100694774 3300005353 Bacteria 859
44 Ga0070675_100134147 3300005354 Bacteria 2112
45 Ga0070671_100064415 3300005355 Bacteria 3053
46 Ga0070671_100076062 3300005355 Bacteria 2805
47 Ga0070671_100294067 3300005355 Unclassified 1382
48 Ga0070674_100019535 3300005356 Bacteria 4306
49 Ga0070674_100169921 3300005356 Bacteria 1661
50 Ga0070674_101241648 3300005356 Unclassified 663
51 Ga0070674_101323243 3300005356 Unclassified 643
52 Ga0070673_101235051 3300005364 Bacteria 701
53 Ga0070673_101354664 3300005364 Bacteria 669
54 Ga0070688_100208714 3300005365 Unclassified 1370
55 Ga0070688_100280079 3300005365 Unclassified 1198
56 Ga0070688_100672979 3300005365 Bacteria 799
57 Ga0070659_101379630 3300005366 Bacteria 626
58 Ga0070667_100024537 3300005367 Bacteria 5008
59 Ga0070667_100597469 3300005367 Bacteria 1017
60 Ga0070667_101150008 3300005367 Bacteria 726
61 Ga0070703_10022756 3300005406 Bacteria 1841
62 Ga0070709_10867008 3300005434 Unclassified 712
63 Ga0070714_100032630 3300005435 Bacteria 4348
64 Ga0070713_100088333 3300005436 Bacteria 2660
65 Ga0070713_101947095 3300005436 Bacteria 570
66 Ga0070710_10549450 3300005437 Unclassified 797
67 Ga0070710_10724518 3300005437 Bacteria 704
68 Ga0070701_10080311 3300005438 Bacteria 1764
69 Ga0070701_10191668 3300005438 Unclassified 1203
70 Ga0070701_10421674 3300005438 Bacteria 850
71 Ga0070711_100620703 3300005439 Unclassified 904
72 Ga0070711_100964088 3300005439 Bacteria 730
73 Ga0070705_100551792 3300005440 Unclassified 884
74 Ga0070700_100753601 3300005441 Unclassified 779
75 Ga0070694_100059424 3300005444 Bacteria 2604
76 Ga0070694_100215655 3300005444 Bacteria 1437
77 Ga0070694_100753733 3300005444 Bacteria 795
78 Ga0070694_100757059 3300005444 Unclassified 794
79 Ga0070694_101605376 3300005444 Unclassified 552
80 Ga0070708_100092413 3300005445 Bacteria 2756
81 Ga0070663_100909855 3300005455 Unclassified 760
82 Ga0070678_100103288 3300005456 Bacteria 2214
83 Ga0070678_100145297 3300005456 Bacteria 1903
84 Ga0070662_100052196 3300005457 Bacteria 2955
85 Ga0070662_100257494 3300005457 Unclassified 1405
86 Ga0070662_101478190 3300005457 Unclassified 586
87 Ga0070681_10134906 3300005458 Bacteria 2399
88 Ga0070681_10164224 3300005458 Bacteria 2144
89 Ga0068867_100220140 3300005459 Unclassified 1529
90 Ga0068867_100245369 3300005459 Bacteria 1454
91 Ga0068867_101580526 3300005459 Bacteria 612
92 Ga0070685_10434089 3300005466 Bacteria 917
93 Ga0070685_10619331 3300005466 Unclassified 781
94 Ga0070706_100370582 3300005467 Bacteria 1334
95 Ga0070706_100384491 3300005467 Bacteria 1307
96 Ga0070706_100640588 3300005467 Unclassified 987
97 Ga0070706_100725956 3300005467 Unclassified 921
98 Ga0070706_101769844 3300005467 Bacteria 562
99 Ga0070707_100013464 3300005468 Bacteria 7653
100 Ga0070707_100104124 3300005468 Bacteria 2751
101 Ga0070707_100359875 3300005468 Bacteria 1413
102 Ga0070707_100523303 3300005468 Bacteria 1148
103 Ga0070698_100135110 3300005471 Bacteria 2421
104 Ga0070698_100323115 3300005471 Bacteria 1474
105 Ga0070698_100397689 3300005471 Bacteria 1311
106 Ga0070699_100001907 3300005518 Bacteria 18836
107 Ga0070699_100044406 3300005518 Bacteria 3848
108 Ga0070699_100497687 3300005518 Bacteria 1107
109 Ga0070699_100682152 3300005518 Unclassified 938
110 Ga0070699_100857634 3300005518 Bacteria 831
111 Ga0070699_101219253 3300005518 Unclassified 690
112 Ga0070679_100127807 3300005530 Unclassified 2523
113 Ga0070684_101108183 3300005535 Bacteria 744
114 Ga0070684_101248414 3300005535 Unclassified 699
115 Ga0070697_100028991 3300005536 Bacteria 4436
116 Ga0070697_100072856 3300005536 Bacteria 2819
117 Ga0070697_100609219 3300005536 Unclassified 960
118 Ga0070697_100636415 3300005536 Bacteria 939
119 Ga0070697_100998043 3300005536 Bacteria 744
120 Ga0068853_101402883 3300005539 Bacteria 676
121 Ga0070672_100184223 3300005543 Bacteria 1741
122 Ga0070672_101204893 3300005543 Unclassified 675
123 Ga0070672_101958094 3300005543 Bacteria 528
124 Ga0070686_100000234 3300005544 Bacteria 37628
125 Ga0070686_100076446 3300005544 Bacteria 2205
126 Ga0070686_100550543 3300005544 Bacteria 902
127 Ga0070695_100016036 3300005545 Unclassified 4530
128 Ga0070695_100124067 3300005545 Bacteria 1771
129 Ga0070695_100790762 3300005545 Unclassified 759
130 Ga0070696_100092794 3300005546 Bacteria 2152
131 Ga0070696_100105440 3300005546 Bacteria 2025
132 Ga0070696_100487900 3300005546 Unclassified 978
133 Ga0070693_101315461 3300005547 Bacteria 559
134 Ga0070665_100011419 3300005548 Bacteria 8979
135 Ga0070665_100024718 3300005548 Bacteria 6053
136 Ga0070665_100156585 3300005548 Bacteria 2280
137 Ga0070704_100015280 3300005549 Bacteria 4820
138 Ga0070704_100186418 3300005549 Bacteria 1664
139 Ga0070704_100302484 3300005549 Bacteria 1333
140 Ga0068855_100951615 3300005563 Bacteria 905
141 Ga0068855_101247242 3300005563 Unclassified 771
142 Ga0070664_100762095 3300005564 Bacteria 904
143 Ga0068854_100000719 3300005578 Bacteria 19601
144 Ga0068854_100348589 3300005578 Bacteria 1211
145 Ga0070702_100092864 3300005615 Bacteria 1834
146 Ga0070702_100369671 3300005615 Unclassified 1016
147 Ga0070702_101411214 3300005615 Unclassified 570
148 Ga0068852_100947295 3300005616 Unclassified 879
149 Ga0068859_100007657 3300005617 Bacteria 10977
150 Ga0068859_100121760 3300005617 Bacteria 2676
151 Ga0068859_100291842 3300005617 Unclassified 1724
152 Ga0068859_101074700 3300005617 Bacteria 885
153 Ga0068859_101443258 3300005617 Unclassified 759
154 Ga0068859_102714437 3300005617 Unclassified 544
155 Ga0068864_100005804 3300005618 Bacteria 10127
156 Ga0068864_100034702 3300005618 Bacteria 4292
157 Ga0068864_101125005 3300005618 Bacteria 782
158 Ga0068864_101973282 3300005618 Bacteria 590
159 Ga0068866_10061638 3300005718 Bacteria 1949
160 Ga0068866_10217743 3300005718 Bacteria 1150
161 Ga0068861_100073288 3300005719 Unclassified 2660
162 Ga0068861_100093152 3300005719 Unclassified 2382
163 Ga0068861_100107083 3300005719 Bacteria 2234
164 Ga0068870_10282905 3300005840 Unclassified 1040
165 Ga0068863_100005047 3300005841 Bacteria 13015
166 Ga0068863_100246428 3300005841 Bacteria 1725
167 Ga0068863_100286761 3300005841 Bacteria 1596
168 Ga0068863_100886306 3300005841 Unclassified 892
169 Ga0068863_101940230 3300005841 Bacteria 599
170 Ga0068858_100059676 3300005842 Bacteria 3525
171 Ga0068858_100307327 3300005842 Bacteria 1514
172 Ga0068858_100550143 3300005842 Bacteria 1117
173 Ga0068858_100949784 3300005842 Bacteria 841
174 Ga0068858_101000707 3300005842 Unclassified 819
175 Ga0068858_101692816 3300005842 Bacteria 624
176 Ga0068860_100078222 3300005843 Bacteria 3146
177 Ga0068860_100523508 3300005843 Bacteria 1186
178 Ga0068860_100573552 3300005843 Bacteria 1132
179 Ga0068860_100586808 3300005843 Bacteria 1119
180 Ga0068860_100877487 3300005843 Unclassified 913
181 Ga0068860_100900833 3300005843 Unclassified 900
182 Ga0068860_101257057 3300005843 Bacteria 761
183 Ga0068860_102433423 3300005843 Bacteria 543
184 Ga0068860_102517150 3300005843 Unclassified 534
185 Ga0068860_102615055 3300005843 Unclassified 524
186 Ga0068860_102863669 3300005843 Bacteria 500
187 Ga0068862_100011594 3300005844 Bacteria 7273
188 Ga0068862_100353249 3300005844 Bacteria 1364
189 Ga0068862_100433450 3300005844 Unclassified 1236
190 Ga0068862_100610863 3300005844 Bacteria 1048
191 Ga0068862_101385079 3300005844 Unclassified 706
192 Ga0081455_10012088 3300005937 Bacteria 8629
193 Ga0081539_10067370 3300005985 Bacteria 1936
194 Ga0081539_10319827 3300005985 Bacteria 660
195 Ga0070716_100193019 3300006173 Bacteria 1347
196 Ga0070716_101274286 3300006173 Bacteria 593
197 Ga0097621_100006473 3300006237 Bacteria 8317
198 Ga0097621_100008305 3300006237 Bacteria 7470
199 Ga0097621_100015290 3300006237 Bacteria 5772
200 Ga0097621_100050137 3300006237 Bacteria 3394
201 Ga0097621_100363834 3300006237 Unclassified 1289
202 Ga0097621_100437846 3300006237 Bacteria 1176
203 Ga0097621_100691348 3300006237 Unclassified 938
204 Ga0097621_101026523 3300006237 Bacteria 772
205 Ga0097621_101410742 3300006237 Bacteria 659
206 Ga0097621_101797594 3300006237 Bacteria 584
207 Ga0068871_100008369 3300006358 Bacteria 7437
208 Ga0068871_100008767 3300006358 Bacteria 7282
209 Ga0068871_100035108 3300006358 Bacteria 3983
210 Ga0068871_100102171 3300006358 Bacteria 2403
211 Ga0068871_100157555 3300006358 Bacteria 1940
212 Ga0068871_100605060 3300006358 Bacteria 997
213 Ga0068871_101355640 3300006358 Unclassified 670
214 Ga0068871_101490000 3300006358 Bacteria 639
215 Ga0075428_100121332 3300006844 Bacteria 2846
216 Ga0075428_100321399 3300006844 Bacteria 1663
217 Ga0075428_101231671 3300006844 Bacteria 788
218 Ga0075428_102308664 3300006844 Unclassified 554
219 Ga0075433_10046879 3300006852 Bacteria 3759
220 Ga0075433_10057729 3300006852 Bacteria 3393
221 Ga0075433_10066046 3300006852 Bacteria 3173
222 Ga0075433_10429958 3300006852 Bacteria 1164
223 Ga0075433_11941299 3300006852 Bacteria 505
224 Ga0075434_100000194 3300006871 Bacteria 40577
225 Ga0075434_100003151 3300006871 Bacteria 14699
226 Ga0075434_100019974 3300006871 Bacteria 6488
227 Ga0075434_100121612 3300006871 Unclassified 2626
228 Ga0075434_100264919 3300006871 Bacteria 1738
229 Ga0075434_100272260 3300006871 Bacteria 1712
230 Ga0075434_100354850 3300006871 Bacteria 1487
231 Ga0075434_100501754 3300006871 Unclassified 1234
232 Ga0075434_100740534 3300006871 Bacteria 1000
233 Ga0075434_100853258 3300006871 Bacteria 926
234 Ga0068865_100014479 3300006881 Bacteria 5012
235 Ga0068865_100134201 3300006881 Bacteria 1858
236 Ga0068865_100170852 3300006881 Bacteria 1666
237 Ga0075436_100000036 3300006914 Bacteria 84076
238 Ga0075436_100011139 3300006914 Bacteria 6167
239 Ga0075436_100043183 3300006914 Bacteria 3108
240 Ga0075436_100164865 3300006914 Bacteria 1563
241 Ga0075436_100226142 3300006914 Unclassified 1328
242 Ga0075436_100356052 3300006914 Bacteria 1055
243 Ga0075436_100886071 3300006914 Bacteria 667
244 Ga0075436_101098710 3300006914 Unclassified 599
245 Ga0097620_100007657 3300006931 Bacteria 10977
246 Ga0097620_100121749 3300006931 Bacteria 2676
247 Ga0097620_100291840 3300006931 Unclassified 1724
248 Ga0097620_101074803 3300006931 Bacteria 885
249 Ga0097620_101443115 3300006931 Unclassified 759
250 Ga0097620_102713502 3300006931 Unclassified 544
251 Ga0075435_100000014 3300007076 Bacteria 100771
252 Ga0075435_100000237 3300007076 Bacteria 33932
253 Ga0075435_100001291 3300007076 Bacteria 16095
254 Ga0075435_100012959 3300007076 Bacteria 6185
255 Ga0075435_100017553 3300007076 Bacteria 5421
256 Ga0075435_100023602 3300007076 Bacteria 4759
257 Ga0075435_100188436 3300007076 Bacteria 1745
258 Ga0075435_100281507 3300007076 Bacteria 1420
259 Ga0075435_100525223 3300007076 Bacteria 1024
260 Ga0075435_100568255 3300007076 Bacteria 983
261 Ga0075435_100609576 3300007076 Bacteria 947
262 Ga0075435_100884017 3300007076 Bacteria 779
263 Ga0105250_10268079 3300009092 Unclassified 733
264 Ga0105240_10090990 3300009093 Bacteria 3728
265 Ga0105240_10179451 3300009093 Unclassified 2500
266 Ga0105240_12017524 3300009093 Bacteria 599
267 Ga0111539_10015152 3300009094 Bacteria 9606
268 Ga0111539_10380060 3300009094 Bacteria 1644
269 Ga0105245_10095734 3300009098 Bacteria 2739
270 Ga0105245_10249570 3300009098 Bacteria 1723
271 Ga0105245_10367398 3300009098 Bacteria 1429
272 Ga0105245_13230679 3300009098 Unclassified 505
273 Ga0105247_10013772 3300009101 Bacteria 4849
274 Ga0105247_10059228 3300009101 Bacteria 2371
275 Ga0105247_10070642 3300009101 Bacteria 2181
276 Ga0114129_10000263 3300009147 Bacteria 59355
277 Ga0114129_10003980 3300009147 Bacteria 20868
278 Ga0114129_10005237 3300009147 Bacteria 18273
279 Ga0114129_10034954 3300009147 Bacteria 7099
280 Ga0114129_10142767 3300009147 Bacteria 3280
281 Ga0114129_10177454 3300009147 Bacteria 2901
282 Ga0114129_10536117 3300009147 Unclassified 1524
283 Ga0114129_11166909 3300009147 Bacteria 961
284 Ga0114129_11772129 3300009147 Unclassified 752
285 Ga0114129_11948831 3300009147 Bacteria 711
286 Ga0105243_10044754 3300009148 Bacteria 3474
287 Ga0105243_10223792 3300009148 Unclassified 1665
288 Ga0105243_10592348 3300009148 Bacteria 1066
289 Ga0105243_11124208 3300009148 Bacteria 795
290 Ga0105241_10422526 3300009174 Bacteria 1173
291 Ga0105241_11494975 3300009174 Unclassified 650
292 Ga0105242_10002103 3300009176 Bacteria 15688
293 Ga0105242_10017864 3300009176 Bacteria 5536
294 Ga0105242_10059610 3300009176 Bacteria 3132
295 Ga0105242_10153239 3300009176 Bacteria 2011
296 Ga0105242_10349914 3300009176 Bacteria 1364
297 Ga0105242_10510671 3300009176 Unclassified 1145
298 Ga0105242_10553516 3300009176 Bacteria 1103
299 Ga0105242_11967710 3300009176 Unclassified 626
300 Ga0105242_12164034 3300009176 Unclassified 601
301 Ga0105242_12734704 3300009176 Unclassified 543
302 Ga0105242_12962216 3300009176 Unclassified 525
303 Ga0105248_10007870 3300009177 Bacteria 11707
304 Ga0105248_10110345 3300009177 Bacteria 3102
305 Ga0105248_10211596 3300009177 Bacteria 2185
306 Ga0105248_10214423 3300009177 Bacteria 2169
307 Ga0105248_10256227 3300009177 Unclassified 1970
308 Ga0105248_10295194 3300009177 Bacteria 1825
309 Ga0105248_10307327 3300009177 Bacteria 1786
310 Ga0105248_10311468 3300009177 Unclassified 1773
311 Ga0105248_10393843 3300009177 Bacteria 1560
312 Ga0105248_10459896 3300009177 Bacteria 1434
313 Ga0105248_11145189 3300009177 Unclassified 879
314 Ga0105248_11324969 3300009177 Bacteria 814
315 Ga0105248_11398797 3300009177 Bacteria 792
316 Ga0105248_11452172 3300009177 Unclassified 776
317 Ga0105248_12292191 3300009177 Unclassified 615
318 Ga0105248_12292196 3300009177 Unclassified 615
319 Ga0105238_10142554 3300009551 Unclassified 2373
320 Ga0105238_10185158 3300009551 Bacteria 2058
321 Ga0105238_10767431 3300009551 Unclassified 979
322 Ga0105238_11645265 3300009551 Unclassified 672
323 Ga0105249_10572968 3300009553 Bacteria 1181
324 Ga0105249_10835929 3300009553 Unclassified 986
325 Ga0105249_11029427 3300009553 Bacteria 893
326 Ga0105249_11687646 3300009553 Bacteria 706
327 Ga0105249_13084504 3300009553 Unclassified 535
328 Ga0105239_12572369 3300010375 Bacteria 593
329 Ga0105246_10237091 3300011119 Unclassified 1440
330 Ga0157374_11453658 3300013296 Unclassified 709
331 Ga0157374_11993215 3300013296 Unclassified 607
332 Ga0157374_12410252 3300013296 Unclassified 554
333 Ga0157378_10034531 3300013297 Bacteria 4472
334 Ga0157378_10246210 3300013297 Bacteria 1710
335 Ga0157378_10348355 3300013297 Bacteria 1446
336 Ga0157378_10497354 3300013297 Unclassified 1217
337 Ga0157378_12936374 3300013297 Unclassified 529
338 Ga0163162_10282220 3300013306 Bacteria 1793
339 Ga0163162_10832964 3300013306 Unclassified 1038
340 Ga0163162_11988216 3300013306 Bacteria 666
341 Ga0163162_12124039 3300013306 Bacteria 644
342 Ga0163162_12153532 3300013306 Unclassified 640
343 Ga0157372_10980030 3300013307 Unclassified 979
344 Ga0157375_10116815 3300013308 Bacteria 2773
345 Ga0157375_10271412 3300013308 Unclassified 1858
346 Ga0157375_10729664 3300013308 Bacteria 1143
347 Ga0157375_10875166 3300013308 Bacteria 1044
348 Ga0157375_10924017 3300013308 Unclassified 1015
349 Ga0157375_11012855 3300013308 Bacteria 970
350 Ga0157375_11469686 3300013308 Bacteria 804
351 Ga0157375_12326949 3300013308 Bacteria 639
352 Ga0157375_13538763 3300013308 Unclassified 520
353 Ga0163163_10005401 3300014325 Bacteria 11044
354 Ga0163163_10088295 3300014325 Bacteria 3111
355 Ga0163163_10804024 3300014325 Unclassified 1004
356 Ga0163163_11087952 3300014325 Bacteria 862
357 Ga0157380_10265505 3300014326 Bacteria 1561
358 Ga0157380_11000627 3300014326 Unclassified 869
359 Ga0157380_12803052 3300014326 Unclassified 554
360 Ga0157377_10385520 3300014745 Unclassified 950
361 Ga0157379_10027323 3300014968 Bacteria 5081
362 Ga0157379_10043032 3300014968 Bacteria 4033
363 Ga0157379_10203191 3300014968 Bacteria 1792
364 Ga0157379_10548975 3300014968 Bacteria 1075
365 Ga0157379_10917280 3300014968 Unclassified 832
366 Ga0157379_11164513 3300014968 Bacteria 740
367 Ga0157376_10005178 3300014969 Bacteria 9094
368 Ga0157376_10057443 3300014969 Bacteria 3255
369 Ga0157376_10215274 3300014969 Bacteria 1776
370 Ga0157376_10361361 3300014969 Bacteria 1392
371 Ga0157376_10531883 3300014969 Unclassified 1160
372 Ga0157376_12293643 3300014969 Unclassified 579
373 Ga0182007_10363413 3300015262 Unclassified 546
374 Ga0207653_10210230 3300025885 Unclassified 736
375 Ga0207642_10013167 3300025899 Bacteria 3011
376 Ga0207642_10750085 3300025899 Unclassified 618
377 Ga0207710_10121143 3300025900 Bacteria 1249
378 Ga0207710_10138988 3300025900 Unclassified 1171
379 Ga0207680_10002110 3300025903 Bacteria 9305
380 Ga0207680_10047340 3300025903 Bacteria 2548
381 Ga0207680_10070303 3300025903 Bacteria 2166
382 Ga0207680_10126259 3300025903 Unclassified 1680
383 Ga0207680_11047610 3300025903 Unclassified 584
384 Ga0207685_10602009 3300025905 Unclassified 590
385 Ga0207699_10722489 3300025906 Unclassified 730
386 Ga0207645_10156477 3300025907 Unclassified 1489
387 Ga0207684_10123488 3300025910 Bacteria 2221
388 Ga0207684_11116004 3300025910 Unclassified 656
389 Ga0207684_11306229 3300025910 Unclassified 597
390 Ga0207654_10813593 3300025911 Unclassified 675
391 Ga0207654_10890960 3300025911 Bacteria 645
392 Ga0207707_10209632 3300025912 Bacteria 1698
393 Ga0207695_10072756 3300025913 Bacteria 3505
394 Ga0207695_10824288 3300025913 Bacteria 808
395 Ga0207663_10409235 3300025916 Bacteria 1039
396 Ga0207660_10644824 3300025917 Bacteria 863
397 Ga0207662_10292974 3300025918 Bacteria 1080
398 Ga0207657_10618068 3300025919 Bacteria 845
399 Ga0207652_10184887 3300025921 Unclassified 1874
400 Ga0207646_10058783 3300025922 Bacteria 3434
401 Ga0207646_10095236 3300025922 Bacteria 2667
402 Ga0207646_10129300 3300025922 Bacteria 2272
403 Ga0207646_10538609 3300025922 Unclassified 1050
404 Ga0207646_11040258 3300025922 Bacteria 722
405 Ga0207681_10011839 3300025923 Bacteria 5367
406 Ga0207681_10058392 3300025923 Bacteria 2641
407 Ga0207681_10120192 3300025923 Bacteria 1926
408 Ga0207681_10324945 3300025923 Bacteria 1224
409 Ga0207681_10627011 3300025923 Unclassified 890
410 Ga0207694_10469452 3300025924 Unclassified 1052
411 Ga0207694_10611317 3300025924 Bacteria 917
412 Ga0207694_11185242 3300025924 Bacteria 646
413 Ga0207694_11728546 3300025924 Bacteria 526
414 Ga0207659_10829591 3300025926 Unclassified 795
415 Ga0207659_11691801 3300025926 Unclassified 539
416 Ga0207659_11751492 3300025926 Unclassified 528
417 Ga0207687_10449910 3300025927 Bacteria 1068
418 Ga0207687_10780463 3300025927 Bacteria 814
419 Ga0207687_11357102 3300025927 Unclassified 611
420 Ga0207700_10102821 3300025928 Bacteria 2283
421 Ga0207664_10073521 3300025929 Bacteria 2758
422 Ga0207644_10102621 3300025931 Bacteria 2151
423 Ga0207644_10138846 3300025931 Bacteria 1869
424 Ga0207644_10234324 3300025931 Unclassified 1460
425 Ga0207690_10990340 3300025932 Unclassified 699
426 Ga0207706_10091412 3300025933 Bacteria 2676
427 Ga0207706_10294660 3300025933 Unclassified 1414
428 Ga0207706_10955371 3300025933 Unclassified 722
429 Ga0207706_11106088 3300025933 Bacteria 662
430 Ga0207686_10030587 3300025934 Bacteria 3189
431 Ga0207686_10034624 3300025934 Bacteria 3024
432 Ga0207686_10041831 3300025934 Bacteria 2797
433 Ga0207686_10042570 3300025934 Bacteria 2777
434 Ga0207686_10224872 3300025934 Bacteria 1357
435 Ga0207686_10474482 3300025934 Unclassified 966
436 Ga0207686_10677960 3300025934 Unclassified 818
437 Ga0207709_10022771 3300025935 Bacteria 3557
438 Ga0207709_10289468 3300025935 Bacteria 1213
439 Ga0207669_10008960 3300025937 Bacteria 4732
440 Ga0207669_10043468 3300025937 Unclassified 2632
441 Ga0207669_10494343 3300025937 Unclassified 978
442 Ga0207669_11359248 3300025937 Unclassified 604
443 Ga0207704_10088701 3300025938 Bacteria 2024
444 Ga0207704_10255623 3300025938 Unclassified 1318
445 Ga0207665_10221325 3300025939 Bacteria 1387
446 Ga0207665_11005757 3300025939 Bacteria 663
447 Ga0207665_11280107 3300025939 Bacteria 585
448 Ga0207691_10009587 3300025940 Bacteria 9294
449 Ga0207691_10084157 3300025940 Bacteria 2856
450 Ga0207711_10013072 3300025941 Bacteria 6896
451 Ga0207711_10022138 3300025941 Bacteria 5313
452 Ga0207711_10202289 3300025941 Unclassified 1813
453 Ga0207711_10218306 3300025941 Unclassified 1743
454 Ga0207711_10267412 3300025941 Unclassified 1572
455 Ga0207711_10281731 3300025941 Bacteria 1531
456 Ga0207711_10295294 3300025941 Bacteria 1494
457 Ga0207711_10474101 3300025941 Bacteria 1166
458 Ga0207711_10488496 3300025941 Bacteria 1147
459 Ga0207711_10536121 3300025941 Unclassified 1092
460 Ga0207711_10864372 3300025941 Bacteria 841
461 Ga0207711_10884434 3300025941 Bacteria 831
462 Ga0207689_10154656 3300025942 Unclassified 1890
463 Ga0207689_10342348 3300025942 Bacteria 1242
464 Ga0207689_10594877 3300025942 Unclassified 930
465 Ga0207689_11592055 3300025942 Bacteria 544
466 Ga0207661_10495686 3300025944 Bacteria 1116
467 Ga0207661_10835021 3300025944 Bacteria 848
468 Ga0207679_10140813 3300025945 Bacteria 1949
469 Ga0207667_10303628 3300025949 Bacteria 1631
470 Ga0207667_10866276 3300025949 Unclassified 897
471 Ga0207651_10193853 3300025960 Bacteria 1623
472 Ga0207651_10731935 3300025960 Unclassified 873
473 Ga0207651_11600242 3300025960 Bacteria 587
474 Ga0207712_10068530 3300025961 Bacteria 2543
475 Ga0207712_10363326 3300025961 Bacteria 1207
476 Ga0207712_10447884 3300025961 Bacteria 1094
477 Ga0207712_11346513 3300025961 Unclassified 638
478 Ga0207712_11848061 3300025961 Unclassified 541
479 Ga0207668_11135110 3300025972 Unclassified 701
480 Ga0207640_10002210 3300025981 Bacteria 10470
481 Ga0207640_10428958 3300025981 Bacteria 1084
482 Ga0207640_10533435 3300025981 Unclassified 983
483 Ga0207658_10026045 3300025986 Bacteria 4098
484 Ga0207658_10344096 3300025986 Unclassified 1297
485 Ga0207658_11499183 3300025986 Unclassified 617
486 Ga0207658_11773000 3300025986 Unclassified 563
487 Ga0207677_10754271 3300026023 Bacteria 868
488 Ga0207677_10995210 3300026023 Unclassified 760
489 Ga0207677_11512541 3300026023 Bacteria 620
490 Ga0207703_10071899 3300026035 Bacteria 2858
491 Ga0207703_10172471 3300026035 Bacteria 1904
492 Ga0207703_10305432 3300026035 Bacteria 1452
493 Ga0207703_10927191 3300026035 Bacteria 834
494 Ga0207678_10585403 3300026067 Bacteria 978
495 Ga0207678_10919969 3300026067 Bacteria 773
496 Ga0207641_10001555 3300026088 Bacteria 22468
497 Ga0207641_10224163 3300026088 Bacteria 1745
498 Ga0207641_10779401 3300026088 Unclassified 945
499 Ga0207641_12263441 3300026088 Bacteria 543
500 Ga0207648_10096714 3300026089 Bacteria 2584
501 Ga0207648_10128170 3300026089 Bacteria 2233
502 Ga0207648_10449446 3300026089 Bacteria 1173
503 Ga0207676_10032978 3300026095 Bacteria 3909
504 Ga0207676_10037489 3300026095 Bacteria 3695
505 Ga0207676_10493096 3300026095 Unclassified 1162
506 Ga0207676_12171216 3300026095 Unclassified 553
507 Ga0207675_100075067 3300026118 Bacteria 3164
508 Ga0207675_100141576 3300026118 Bacteria 2285
509 Ga0207675_100386941 3300026118 Bacteria 1376
510 Ga0207675_100546833 3300026118 Bacteria 1157
511 Ga0207675_100849284 3300026118 Unclassified 928
512 Ga0207675_102171613 3300026118 Unclassified 571
513 Ga0207683_10171223 3300026121 Bacteria 1966
514 Ga0207698_11318736 3300026142 Bacteria 736
515 Ga0207428_10299276 3300027907 Unclassified 1191
516 Ga0268266_10061892 3300028379 Bacteria 3228
517 Ga0268266_10086858 3300028379 Bacteria 2735
518 Ga0268265_10003704 3300028380 Bacteria 10883
519 Ga0268265_10027957 3300028380 Bacteria 4033
520 Ga0268265_10095912 3300028380 Bacteria 2383
521 Ga0268265_10624052 3300028380 Bacteria 1033
522 Ga0268265_10636839 3300028380 Unclassified 1023
523 Ga0268265_11215044 3300028380 Unclassified 752
524 Ga0268265_11270439 3300028380 Bacteria 735
525 Ga0268265_12476821 3300028380 Bacteria 525
526 Ga0268264_10161519 3300028381 Unclassified 2019
527 Ga0268264_10170044 3300028381 Bacteria 1970
528 Ga0268264_10363128 3300028381 Bacteria 1382
529 Ga0268264_10530594 3300028381 Bacteria 1152
530 Ga0268264_11010484 3300028381 Bacteria 838
531 Ga0268264_11265941 3300028381 Bacteria 748
532 Ga0268264_12203431 3300028381 Unclassified 559
533 Ga0268264_12611343 3300028381 Unclassified 509
534 Ga0265332_10091388 3300031238 Unclassified 1287
535 Ga0265328_10196934 3300031239 Bacteria 764
536 Ga0265316_10369661 3300031344 Unclassified 1036
537 Ga0265316_10934865 3300031344 Unclassified 605
538 Ga0307509_10969113 3300031507 Bacteria 517
539 Ga0265314_10028007 3300031711 Bacteria 4208
540 Ga0373930_0027533 3300034816 Bacteria 1152
541 Ga0373950_0030814 3300034818 Bacteria 992
542 Ga0373959_0000584 3300034820 Bacteria 6372
543 Ga0373938_0000246 3300034957 Bacteria 8499
544 Ga0373928_0245310 3300035084 Bacteria 532
545 Ga0373929_0001107 3300035085 Bacteria 5232
546 Ga0373934_0046037 3300035086 Bacteria 1725
547 Ga0373934_0206651 3300035086 Unclassified 809
548 Ga0373944_0036447 3300035089 Bacteria 1503
549 Ga0373949_0000723 3300035090 Bacteria 10715
550 Ga0373951_0001149 3300035091 Bacteria 7008
551 Ga0373952_0001986 3300035092 Bacteria 3697
552 Ga0373923_0162116 3300035111 Unclassified 1020
553 Ga0373932_0001576 3300035112 Bacteria 6288
554 Ga0373939_0002077 3300035114 Bacteria 4775
555 Ga0373939_0017505 3300035114 Bacteria 1904
556 Ga0373941_0003915 3300035115 Bacteria 3411
557 Ga0373945_0260392 3300035116 Bacteria 735
558 Ga0373953_0189196 3300035117 Bacteria 889
559 Ga0373953_0193407 3300035117 Bacteria 879
560 Ga0373953_0419323 3300035117 Unclassified 590
561 Ga0373954_0578429 3300035118 Bacteria 557
562 Ga0373956_0075397 3300035119 Unclassified 1543
563 Ga0373956_0124532 3300035119 Bacteria 1205
564 Ga0373956_0433110 3300035119 Unclassified 628
565 Ga0373960_0001701 3300035121 Bacteria 4927
566 Ga0373943_0177866 3300035170 Bacteria 1168
567 Ga0373946_0129232 3300035171 Bacteria 1161
568 Ga0373946_0155157 3300035171 Unclassified 1071
569 Ga0373955_0041295 3300035172 Bacteria 2472
570 Ga0373955_0153241 3300035172 Bacteria 1357
571 Ga0373955_0347729 3300035172 Bacteria 898
572 Ga0373942_0002357 3300035207 Bacteria 4593
573 Ga0373942_0034448 3300035207 Bacteria 1355
574 Ga0373961_0019411 3300035241 Bacteria 1785
575 Ga0373961_0048235 3300035241 Unclassified 1254
576 Ga0373962_0001985 3300035242 Bacteria 4878
577 Ga0373962_0032176 3300035242 Bacteria 1442
578 Ga0373924_0127581 3300035410 Bacteria 1106
579 Ga0373931_0004416 3300035691 Bacteria 6423
580 Ga0373931_0050855 3300035691 Bacteria 2206
581 Ga0373933_0152513 3300035724 Bacteria 1464
582 Ga0373933_0354177 3300035724 Unclassified 954
583 Ga0373947_0806222 3300035725 Unclassified 641
584 Ga0373937_0075645 3300036401 Bacteria 3109
585 Ga0373937_0210358 3300036401 Bacteria 1830
586 Ga0373937_0268405 3300036401 Bacteria 1610
587 Ga0373937_0321838 3300036401 Bacteria 1463
588 Ga0373937_1049617 3300036401 Bacteria 764
589 Ga0373937_2042218 3300036401 Unclassified 519
590 Ga0373925_0027078 3300037068 Bacteria 4199
591 Ga0373925_0036527 3300037068 Bacteria 3626
592 Ga0373925_0332679 3300037068 Bacteria 1231
593 Ga0373925_0812581 3300037068 Bacteria 771
594 Ga0373925_1229106 3300037068 Unclassified 615
595 Ga0395898_1163821 3300037466 Bacteria 703
596 Ga0395905_1848998 3300037471 Bacteria 510
597 Ga0436365_0544872 3300039437 Bacteria 506
598 Ga0450917_017715 3300042120 Bacteria 617
599 Ga0466960_0260570 3300044901 Bacteria 966
600 Ga0451576_0068018 3300045051 Bacteria 3707
601 Ga0451576_0589303 3300045051 Bacteria 1168
602 Ga0466967_0651805 3300045976 Bacteria 1041
603 Ga0495592_0011828 3300046454 Bacteria 6611
604 Ga0495592_0395407 3300046454 Bacteria 877
605 Ga0495603_0137326 3300046455 Bacteria 1423
606 Ga0495603_0718015 3300046455 Unclassified 571
607 Ga0495629_0125381 3300046459 Bacteria 1789
608 Ga0495629_0665502 3300046459 Bacteria 693
609 Ga0495641_0600344 3300046461 Unclassified 503
610 Ga0495651_0068786 3300046462 Bacteria 2699
611 Ga0495580_0439618 3300046472 Unclassified 876
612 Ga0495580_0841818 3300046472 Bacteria 593
613 Ga0495582_0091701 3300046473 Bacteria 1695
614 Ga0495639_0126512 3300046475 Bacteria 1222
615 Ga0495662_0084189 3300046476 Bacteria 1548
616 Ga0495664_0229601 3300046477 Bacteria 1123
617 Ga0495594_0305167 3300046499 Bacteria 907
618 Ga0495608_0044205 3300046511 Bacteria 2973
619 Ga0495618_0590617 3300046514 Unclassified 662
620 Ga0495618_0848066 3300046514 Bacteria 530
621 Ga0495628_0138263 3300046516 Bacteria 1860
622 Ga0495628_0156148 3300046516 Bacteria 1735
623 Ga0495628_0205073 3300046516 Unclassified 1484
624 Ga0495630_0007136 3300046517 Bacteria 7965
625 Ga0495630_0861177 3300046517 Bacteria 691
626 Ga0495644_0191708 3300046523 Bacteria 787
627 Ga0495663_0236899 3300046525 Unclassified 645
628 Ga0495652_0112434 3300046529 Bacteria 2188
629 Ga0495665_0163959 3300046531 Unclassified 1158
630 Ga0495665_0267107 3300046531 Bacteria 879
631 Ga0495640_0033709 3300046533 Bacteria 3637
632 Ga0495640_0200915 3300046533 Bacteria 1263
633 Ga0495640_0722172 3300046533 Bacteria 597
634 Ga0495586_0045841 3300046535 Bacteria 2357
635 Ga0495586_0131865 3300046535 Unclassified 1399
636 Ga0495586_0213512 3300046535 Unclassified 1095
637 Ga0495586_0401848 3300046535 Bacteria 788
638 Ga0495598_0074404 3300046537 Bacteria 1077
639 Ga0495621_0182385 3300046539 Unclassified 838
640 Ga0495645_0011781 3300046543 Bacteria 6160
641 Ga0495645_0230738 3300046543 Unclassified 1240
642 Ga0495645_0283070 3300046543 Unclassified 1089
643 Ga0495667_0007822 3300046559 Bacteria 7241
644 Ga0495667_0194889 3300046559 Bacteria 1298
645 Ga0495634_0110740 3300046642 Bacteria 1766
646 Ga0495634_0144189 3300046642 Bacteria 1510
647 Ga0495611_0091020 3300046648 Bacteria 1410
648 Ga0495635_0098590 3300046663 Bacteria 1998
649 Ga0495635_0251159 3300046663 Bacteria 1192
650 Ga0495635_0972412 3300046663 Bacteria 541
651 Ga0495657_0530402 3300046675 Unclassified 685
652 Ga0495657_0672342 3300046675 Bacteria 596
653 Ga0495599_0411459 3300046678 Bacteria 804
654 Ga0495623_0156472 3300046679 Unclassified 1343
655 Ga0495623_0167924 3300046679 Bacteria 1284
656 Ga0495646_0071460 3300046680 Bacteria 2042
657 Ga0495646_0388168 3300046680 Unclassified 727
658 Ga0495647_0013208 3300046681 Bacteria 2858
659 Ga0495647_0213437 3300046681 Bacteria 850
660 Ga0495647_0279320 3300046681 Unclassified 749
661 Ga0495658_0018902 3300046683 Bacteria 3591
662 Ga0495658_0020982 3300046683 Bacteria 3438
663 Ga0495658_0060825 3300046683 Bacteria 2167
664 Ga0495669_0009227 3300046684 Bacteria 4158
665 Ga0495669_0315131 3300046684 Unclassified 755
666 Ga0495613_0001154 3300046689 Bacteria 20186
667 Ga0495613_0143553 3300046689 Bacteria 1705
668 Ga0495613_0282669 3300046689 Bacteria 1152
669 Ga0495613_0460712 3300046689 Bacteria 860
670 Ga0495624_0764243 3300046690 Unclassified 572
671 Ga0495670_0167383 3300046691 Bacteria 1157
672 Ga0495600_0017025 3300046809 Bacteria 4620
673 Ga0495581_0129885 3300047315 Bacteria 1468
674 Ga0495581_0372866 3300047315 Bacteria 833
675 Ga0495604_0031887 3300047317 Bacteria 4178
676 Ga0495674_0097043 3300047319 Unclassified 2511
677 Ga0495674_0141879 3300047319 Bacteria 2019
678 Ga0495674_0217433 3300047319 Unclassified 1581
679 Ga0495674_0562672 3300047319 Bacteria 906
680 Ga0495672_0380707 3300047320 Unclassified 649
681 Ga0495676_0584632 3300047321 Bacteria 728
682 Ga0495676_0995130 3300047321 Unclassified 535
683 Ga0495680_0115530 3300047322 Unclassified 1986
684 Ga0495680_0266158 3300047322 Bacteria 1211
685 Ga0495680_0872400 3300047322 Bacteria 583
686 Ga0495675_0093306 3300047444 Bacteria 1889
687 Ga0495684_0000137 3300047471 Bacteria 53663
688 Ga0495684_0213842 3300047471 Bacteria 1416
689 Ga0495684_0470383 3300047471 Archaea 870
690 Ga0495684_0521818 3300047471 Unclassified 813
691 Ga0495602_0590285 3300048088 Bacteria 765
692 Ga0495614_0289958 3300048089 Bacteria 755
693 Ga0495614_0389494 3300048089 Bacteria 653
694 Ga0496100_0016614 3300048903 Bacteria 4326
695 Ga0496100_0800731 3300048903 Bacteria 738
696 Ga0496101_0009889 3300048904 Bacteria 6284
697 Ga0496102_1337731 3300048905 Unclassified 635
698 Ga0496102_1735985 3300048905 Bacteria 542
699 Ga0496103_0544845 3300048906 Unclassified 741
700 Ga0496104_0026952 3300048907 Bacteria 5313
701 Ga0496104_0066484 3300048907 Bacteria 3423
702 Ga0496104_0121701 3300048907 Bacteria 2506
703 Ga0496104_0192744 3300048907 Unclassified 1950
704 Ga0496104_1877042 3300048907 Bacteria 501
705 Ga0496105_0095316 3300048908 Bacteria 2458
706 Ga0496105_0109543 3300048908 Bacteria 2280
707 Ga0496105_0336405 3300048908 Bacteria 1208
708 Ga0496105_1319409 3300048908 Bacteria 526
709 Ga0496106_0140723 3300048909 Bacteria 1898
710 Ga0496106_0168074 3300048909 Bacteria 1737
711 Ga0496106_0174260 3300048909 Bacteria 1706
712 Ga0496106_0405935 3300048909 Bacteria 1095
713 Ga0496106_1450265 3300048909 Unclassified 529
714 Ga0496107_0127411 3300048910 Bacteria 1878
715 Ga0496107_0340854 3300048910 Bacteria 1115
716 Ga0496108_0004932 3300048911 Bacteria 10779
717 Ga0496108_0329882 3300048911 Bacteria 1330
718 Ga0496109_0141083 3300048912 Bacteria 2253
719 Ga0496109_0375781 3300048912 Unclassified 1342
720 Ga0496110_0495440 3300048913 Bacteria 1113
721 Ga0496110_0569351 3300048913 Bacteria 1029
722 Ga0496110_1519168 3300048913 Unclassified 579
723 Ga0496112_0038295 3300048915 Bacteria 4681
724 Ga0496112_0269627 3300048915 Bacteria 1651
725 Ga0496113_0196249 3300048916 Bacteria 1603
726 Ga0496113_0597596 3300048916 Bacteria 884
727 Ga0496114_0002111 3300048917 Bacteria 15101
728 Ga0496114_0011871 3300048917 Bacteria 6972
729 Ga0496114_0141090 3300048917 Bacteria 2086
730 Ga0496114_0436566 3300048917 Unclassified 1160
731 Ga0496114_0481790 3300048917 Unclassified 1098
732 Ga0496114_0643575 3300048917 Bacteria 933
733 Ga0496114_1225969 3300048917 Archaea 636
734 Ga0501042_0353018 3300049578 Bacteria 1064
735 Ga0501071_1118008 3300049587 Bacteria 609
736 nmdc:mga05p37_1356986_c1 3300050507 Unclassified 720
737 nmdc:mga05p37_15547_c1 3300050507 Bacteria 9147
738 nmdc:mga05p37_156747_c1 3300050507 Bacteria 2782
739 nmdc:mga05p37_19599_c1 3300050507 Bacteria 8181
740 nmdc:mga05p37_233346_c1 3300050507 Bacteria 2216
741 nmdc:mga05p37_24612_c1 3300050507 Bacteria 7319
742 nmdc:mga05p37_273109_c1 3300050507 Bacteria 2019
743 nmdc:mga05p37_48936_c1 3300050507 Bacteria 5198
744 nmdc:mga05p37_5421_c1 3300050507 Bacteria 14991
745 nmdc:mga05p37_628613_c1 3300050507 Bacteria 1207
746 nmdc:mga09592_999104_c1 3300050508 Unclassified 699
747 nmdc:mga08y16_43135_c1 3300050511 Bacteria 4726
748 nmdc:mga0n895_105629_c1 3300050512 Bacteria 2829
749 nmdc:mga0n895_176200_c1 3300050512 Bacteria 2169
750 nmdc:mga0n895_229028_c1 3300050512 Bacteria 1887
751 nmdc:mga0n895_252630_c1 3300050512 Bacteria 1789
752 nmdc:mga0n895_382415_c1 3300050512 Bacteria 1424
753 nmdc:mga0n895_402_c1 3300050512 Bacteria 29129
754 nmdc:mga0n895_56077_c1 3300050512 Bacteria 3881
755 nmdc:mga0n895_79974_c1 3300050512 Bacteria 3256
756 nmdc:mga0rr50_125257_c1 3300050513 Bacteria 2051
757 nmdc:mga0rr50_169463_c1 3300050513 Bacteria 1778
758 nmdc:mga0rr50_226_c1 3300050513 Bacteria 30496
759 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
760 nmdc:mga0rr50_484021_c1 3300050513 Bacteria 1051
761 nmdc:mga0rr50_53978_c1 3300050513 Bacteria 2992
762 nmdc:mga0rr50_54517_c1 3300050513 Bacteria 2979
763 nmdc:mga0rr50_71639_c1 3300050513 Bacteria 2645
764 nmdc:mga0rr50_81607_c1 3300050513 Bacteria 2496
765 nmdc:mga08x19_117904_c1 3300050514 Bacteria 1776
766 nmdc:mga08x19_119_c1 3300050514 Bacteria 70188
767 nmdc:mga08x19_1256428_c1 3300050514 Unclassified 525
768 nmdc:mga08x19_238063_c1 3300050514 Bacteria 1254
769 nmdc:mga08x19_304480_c1 3300050514 Bacteria 1107
770 nmdc:mga08x19_30448_c1 3300050514 Bacteria 3390
771 nmdc:mga08x19_328618_c1 3300050514 Bacteria 1065
772 nmdc:mga08x19_69334_c1 3300050514 Bacteria 2297
773 nmdc:mga08x19_697689_c1 3300050514 Bacteria 720
774 nmdc:mga08x19_917224_c1 3300050514 Unclassified 622
775 nmdc:mga0a205_1500935_c1 3300050515 Unclassified 522
776 nmdc:mga0a205_170437_c1 3300050515 Bacteria 2073
777 nmdc:mga0a205_22181_c1 3300050515 Bacteria 6010
778 nmdc:mga0a205_26937_c1 3300050515 Bacteria 5487
779 nmdc:mga0a205_414813_c1 3300050515 Bacteria 1209
780 Ga0495601_0034318 3300053077 Bacteria 3164
781 Ga0495601_0094193 3300053077 Bacteria 1930
782 Ga0495601_0204753 3300053077 Bacteria 1289
783 Ga0495601_0237016 3300053077 Bacteria 1191
784 Ga0495601_1014920 3300053077 Bacteria 521
785 Ga0495595_0163015 3300053084 Bacteria 1101
786 Ga0495595_0198894 3300053084 Bacteria 997
787 Ga0495619_0092844 3300053085 Bacteria 2045
788 Ga0495619_0108894 3300053085 Bacteria 1891
789 Ga0495619_0159998 3300053085 Bacteria 1555
790 Ga0495619_0257618 3300053085 Bacteria 1209
791 Ga0530510_0807351 3300061734 Bacteria 716
792 Ga0070700_101871701
793 JGI24751J29686_10117863
794 Ga0058859_11474252
795 Ga0065714_10404127
796 Ga0065712_10098102
797 Ga0065715_10100524
798 Ga0065715_10533611
799 Ga0065707_10061121
800 Ga0065707_10134361
801 Ga0070676_10838866
802 Ga0070676_10923538
803 Ga0070683_100601367
804 Ga0070690_100006060
805 Ga0070670_101464691
806 Ga0068869_100113839
807 Ga0068869_100122172
808 Ga0068869_100459983
809 Ga0068869_101142492
810 Ga0068869_101666574
811 Ga0070666_10233764
812 Ga0070666_10377336
813 Ga0070666_10439171
814 Ga0070666_10799285
815 Ga0070666_11509256
816 Ga0070680_100191100
817 Ga0070680_101946472
818 Ga0068868_100041429
819 Ga0068868_100851563
820 Ga0068868_100930969
821 Ga0068868_101428796
822 Ga0070660_100861667
823 Ga0070660_101461498
824 Ga0070689_100309094
825 Ga0070691_10711158
826 Ga0070691_10761896
827 Ga0070691_10887962
828 Ga0070687_100270933
829 Ga0070692_10155628
830 Ga0070692_10860550
831 Ga0070668_102035282
832 Ga0070669_100003633
833 Ga0070669_100118884
834 Ga0070669_100694774
835 Ga0070675_100134147
836 Ga0070671_100064415
837 Ga0070671_100076062
838 Ga0070671_100294067
839 Ga0070674_100019535
840 Ga0070674_100169921
841 Ga0070674_101241648
842 Ga0070674_101323243
843 Ga0070673_101235051
844 Ga0070673_101354664
845 Ga0070688_100208714
846 Ga0070688_100280079
847 Ga0070688_100672979
848 Ga0070659_101379630
849 Ga0070667_100024537
850 Ga0070667_100597469
851 Ga0070667_101150008
852 Ga0070703_10022756
853 Ga0070709_10867008
854 Ga0070714_100032630
855 Ga0070713_100088333
856 Ga0070713_101947095
857 Ga0070710_10549450
858 Ga0070710_10724518
859 Ga0070701_10080311
860 Ga0070701_10191668
861 Ga0070701_10421674
862 Ga0070711_100620703
863 Ga0070711_100964088
864 Ga0070705_100551792
865 Ga0070700_100753601
866 Ga0070694_100059424
867 Ga0070694_100215655
868 Ga0070694_100753733
869 Ga0070694_100757059
870 Ga0070694_101605376
871 Ga0070708_100092413
872 Ga0070663_100909855
873 Ga0070678_100103288
874 Ga0070678_100145297
875 Ga0070662_100052196
876 Ga0070662_100257494
877 Ga0070662_101478190
878 Ga0070681_10134906
879 Ga0070681_10164224
880 Ga0068867_100220140
881 Ga0068867_100245369
882 Ga0068867_101580526
883 Ga0070685_10434089
884 Ga0070685_10619331
885 Ga0070706_100370582
886 Ga0070706_100384491
887 Ga0070706_100640588
888 Ga0070706_100725956
889 Ga0070706_101769844
890 Ga0070707_100013464
891 Ga0070707_100104124
892 Ga0070707_100359875
893 Ga0070707_100523303
894 Ga0070698_100135110
895 Ga0070698_100323115
896 Ga0070698_100397689
897 Ga0070699_100001907
898 Ga0070699_100044406
899 Ga0070699_100497687
900 Ga0070699_100682152
901 Ga0070699_100857634
902 Ga0070699_101219253
903 Ga0070679_100127807
904 Ga0070684_101108183
905 Ga0070684_101248414
906 Ga0070697_100028991
907 Ga0070697_100072856
908 Ga0070697_100609219
909 Ga0070697_100636415
910 Ga0070697_100998043
911 Ga0068853_101402883
912 Ga0070672_100184223
913 Ga0070672_101204893
914 Ga0070672_101958094
915 Ga0070686_100000234
916 Ga0070686_100076446
917 Ga0070686_100550543
918 Ga0070695_100016036
919 Ga0070695_100124067
920 Ga0070695_100790762
921 Ga0070696_100092794
922 Ga0070696_100105440
923 Ga0070696_100487900
924 Ga0070693_101315461
925 Ga0070665_100011419
926 Ga0070665_100024718
927 Ga0070665_100156585
928 Ga0070704_100015280
929 Ga0070704_100186418
930 Ga0070704_100302484
931 Ga0068855_100951615
932 Ga0068855_101247242
933 Ga0070664_100762095
934 Ga0068854_100000719
935 Ga0068854_100348589
936 Ga0070702_100092864
937 Ga0070702_100369671
938 Ga0070702_101411214
939 Ga0068852_100947295
940 Ga0068859_100007657
941 Ga0068859_100121760
942 Ga0068859_100291842
943 Ga0068859_101074700
944 Ga0068859_101443258
945 Ga0068859_102714437
946 Ga0068864_100005804
947 Ga0068864_100034702
948 Ga0068864_101125005
949 Ga0068864_101973282
950 Ga0068866_10061638
951 Ga0068866_10217743
952 Ga0068861_100073288
953 Ga0068861_100093152
954 Ga0068861_100107083
955 Ga0068870_10282905
956 Ga0068863_100005047
957 Ga0068863_100246428
958 Ga0068863_100286761
959 Ga0068863_100886306
960 Ga0068863_101940230
961 Ga0068858_100059676
962 Ga0068858_100307327
963 Ga0068858_100550143
964 Ga0068858_100949784
965 Ga0068858_101000707
966 Ga0068858_101692816
967 Ga0068860_100078222
968 Ga0068860_100523508
969 Ga0068860_100573552
970 Ga0068860_100586808
971 Ga0068860_100877487
972 Ga0068860_100900833
973 Ga0068860_101257057
974 Ga0068860_102433423
975 Ga0068860_102517150
976 Ga0068860_102615055
977 Ga0068860_102863669
978 Ga0068862_100011594
979 Ga0068862_100353249
980 Ga0068862_100433450
981 Ga0068862_100610863
982 Ga0068862_101385079
983 Ga0081455_10012088
984 Ga0081539_10067370
985 Ga0081539_10319827
986 Ga0070716_100193019
987 Ga0070716_101274286
988 Ga0097621_100006473
989 Ga0097621_100008305
990 Ga0097621_100015290
991 Ga0097621_100050137
992 Ga0097621_100363834
993 Ga0097621_100437846
994 Ga0097621_100691348
995 Ga0097621_101026523
996 Ga0097621_101410742
997 Ga0097621_101797594
998 Ga0068871_100008369
999 Ga0068871_100008767
1000 Ga0068871_100035108
1001 Ga0068871_100102171
1002 Ga0068871_100157555
1003 Ga0068871_100605060
1004 Ga0068871_101355640
1005 Ga0068871_101490000
1006 Ga0075428_100121332
1007 Ga0075428_100321399
1008 Ga0075428_101231671
1009 Ga0075428_102308664
1010 Ga0075433_10046879
1011 Ga0075433_10057729
1012 Ga0075433_10066046
1013 Ga0075433_10429958
1014 Ga0075433_11941299
1015 Ga0075434_100000194
1016 Ga0075434_100003151
1017 Ga0075434_100019974
1018 Ga0075434_100121612
1019 Ga0075434_100264919
1020 Ga0075434_100272260
1021 Ga0075434_100354850
1022 Ga0075434_100501754
1023 Ga0075434_100740534
1024 Ga0075434_100853258
1025 Ga0068865_100014479
1026 Ga0068865_100134201
1027 Ga0068865_100170852
1028 Ga0075436_100000036
1029 Ga0075436_100011139
1030 Ga0075436_100043183
1031 Ga0075436_100164865
1032 Ga0075436_100226142
1033 Ga0075436_100356052
1034 Ga0075436_100886071
1035 Ga0075436_101098710
1036 Ga0097620_100007657
1037 Ga0097620_100121749
1038 Ga0097620_100291840
1039 Ga0097620_101074803
1040 Ga0097620_101443115
1041 Ga0097620_102713502
1042 Ga0075435_100000014
1043 Ga0075435_100000237
1044 Ga0075435_100001291
1045 Ga0075435_100012959
1046 Ga0075435_100017553
1047 Ga0075435_100023602
1048 Ga0075435_100188436
1049 Ga0075435_100281507
1050 Ga0075435_100525223
1051 Ga0075435_100568255
1052 Ga0075435_100609576
1053 Ga0075435_100884017
1054 Ga0105250_10268079
1055 Ga0105240_10090990
1056 Ga0105240_10179451
1057 Ga0105240_12017524
1058 Ga0111539_10015152
1059 Ga0111539_10380060
1060 Ga0105245_10095734
1061 Ga0105245_10249570
1062 Ga0105245_10367398
1063 Ga0105245_13230679
1064 Ga0105247_10013772
1065 Ga0105247_10059228
1066 Ga0105247_10070642
1067 Ga0114129_10000263
1068 Ga0114129_10003980
1069 Ga0114129_10005237
1070 Ga0114129_10034954
1071 Ga0114129_10142767
1072 Ga0114129_10177454
1073 Ga0114129_10536117
1074 Ga0114129_11166909
1075 Ga0114129_11772129
1076 Ga0114129_11948831
1077 Ga0105243_10044754
1078 Ga0105243_10223792
1079 Ga0105243_10592348
1080 Ga0105243_11124208
1081 Ga0105241_10422526
1082 Ga0105241_11494975
1083 Ga0105242_10002103
1084 Ga0105242_10017864
1085 Ga0105242_10059610
1086 Ga0105242_10153239
1087 Ga0105242_10349914
1088 Ga0105242_10510671
1089 Ga0105242_10553516
1090 Ga0105242_11967710
1091 Ga0105242_12164034
1092 Ga0105242_12734704
1093 Ga0105242_12962216
1094 Ga0105248_10007870
1095 Ga0105248_10110345
1096 Ga0105248_10211596
1097 Ga0105248_10214423
1098 Ga0105248_10256227
1099 Ga0105248_10295194
1100 Ga0105248_10307327
1101 Ga0105248_10311468
1102 Ga0105248_10393843
1103 Ga0105248_10459896
1104 Ga0105248_11145189
1105 Ga0105248_11324969
1106 Ga0105248_11398797
1107 Ga0105248_11452172
1108 Ga0105248_12292191
1109 Ga0105248_12292196
1110 Ga0105238_10142554
1111 Ga0105238_10185158
1112 Ga0105238_10767431
1113 Ga0105238_11645265
1114 Ga0105249_10572968
1115 Ga0105249_10835929
1116 Ga0105249_11029427
1117 Ga0105249_11687646
1118 Ga0105249_13084504
1119 Ga0105239_12572369
1120 Ga0105246_10237091
1121 Ga0157374_11453658
1122 Ga0157374_11993215
1123 Ga0157374_12410252
1124 Ga0157378_10034531
1125 Ga0157378_10246210
1126 Ga0157378_10348355
1127 Ga0157378_10497354
1128 Ga0157378_12936374
1129 Ga0163162_10282220
1130 Ga0163162_10832964
1131 Ga0163162_11988216
1132 Ga0163162_12124039
1133 Ga0163162_12153532
1134 Ga0157372_10980030
1135 Ga0157375_10116815
1136 Ga0157375_10271412
1137 Ga0157375_10729664
1138 Ga0157375_10875166
1139 Ga0157375_10924017
1140 Ga0157375_11012855
1141 Ga0157375_11469686
1142 Ga0157375_12326949
1143 Ga0157375_13538763
1144 Ga0163163_10005401
1145 Ga0163163_10088295
1146 Ga0163163_10804024
1147 Ga0163163_11087952
1148 Ga0157380_10265505
1149 Ga0157380_11000627
1150 Ga0157380_12803052
1151 Ga0157377_10385520
1152 Ga0157379_10027323
1153 Ga0157379_10043032
1154 Ga0157379_10203191
1155 Ga0157379_10548975
1156 Ga0157379_10917280
1157 Ga0157379_11164513
1158 Ga0157376_10005178
1159 Ga0157376_10057443
1160 Ga0157376_10215274
1161 Ga0157376_10361361
1162 Ga0157376_10531883
1163 Ga0157376_12293643
1164 Ga0182007_10363413
1165 Ga0207653_10210230
1166 Ga0207642_10013167
1167 Ga0207642_10750085
1168 Ga0207710_10121143
1169 Ga0207710_10138988
1170 Ga0207680_10002110
1171 Ga0207680_10047340
1172 Ga0207680_10070303
1173 Ga0207680_10126259
1174 Ga0207680_11047610
1175 Ga0207685_10602009
1176 Ga0207699_10722489
1177 Ga0207645_10156477
1178 Ga0207684_10123488
1179 Ga0207684_11116004
1180 Ga0207684_11306229
1181 Ga0207654_10813593
1182 Ga0207654_10890960
1183 Ga0207707_10209632
1184 Ga0207695_10072756
1185 Ga0207695_10824288
1186 Ga0207663_10409235
1187 Ga0207660_10644824
1188 Ga0207662_10292974
1189 Ga0207657_10618068
1190 Ga0207652_10184887
1191 Ga0207646_10058783
1192 Ga0207646_10095236
1193 Ga0207646_10129300
1194 Ga0207646_10538609
1195 Ga0207646_11040258
1196 Ga0207681_10011839
1197 Ga0207681_10058392
1198 Ga0207681_10120192
1199 Ga0207681_10324945
1200 Ga0207681_10627011
1201 Ga0207694_10469452
1202 Ga0207694_10611317
1203 Ga0207694_11185242
1204 Ga0207694_11728546
1205 Ga0207659_10829591
1206 Ga0207659_11691801
1207 Ga0207659_11751492
1208 Ga0207687_10449910
1209 Ga0207687_10780463
1210 Ga0207687_11357102
1211 Ga0207700_10102821
1212 Ga0207664_10073521
1213 Ga0207644_10102621
1214 Ga0207644_10138846
1215 Ga0207644_10234324
1216 Ga0207690_10990340
1217 Ga0207706_10091412
1218 Ga0207706_10294660
1219 Ga0207706_10955371
1220 Ga0207706_11106088
1221 Ga0207686_10030587
1222 Ga0207686_10034624
1223 Ga0207686_10041831
1224 Ga0207686_10042570
1225 Ga0207686_10224872
1226 Ga0207686_10474482
1227 Ga0207686_10677960
1228 Ga0207709_10022771
1229 Ga0207709_10289468
1230 Ga0207669_10008960
1231 Ga0207669_10043468
1232 Ga0207669_10494343
1233 Ga0207669_11359248
1234 Ga0207704_10088701
1235 Ga0207704_10255623
1236 Ga0207665_10221325
1237 Ga0207665_11005757
1238 Ga0207665_11280107
1239 Ga0207691_10009587
1240 Ga0207691_10084157
1241 Ga0207711_10013072
1242 Ga0207711_10022138
1243 Ga0207711_10202289
1244 Ga0207711_10218306
1245 Ga0207711_10267412
1246 Ga0207711_10281731
1247 Ga0207711_10295294
1248 Ga0207711_10474101
1249 Ga0207711_10488496
1250 Ga0207711_10536121
1251 Ga0207711_10864372
1252 Ga0207711_10884434
1253 Ga0207689_10154656
1254 Ga0207689_10342348
1255 Ga0207689_10594877
1256 Ga0207689_11592055
1257 Ga0207661_10495686
1258 Ga0207661_10835021
1259 Ga0207679_10140813
1260 Ga0207667_10303628
1261 Ga0207667_10866276
1262 Ga0207651_10193853
1263 Ga0207651_10731935
1264 Ga0207651_11600242
1265 Ga0207712_10068530
1266 Ga0207712_10363326
1267 Ga0207712_10447884
1268 Ga0207712_11346513
1269 Ga0207712_11848061
1270 Ga0207668_11135110
1271 Ga0207640_10002210
1272 Ga0207640_10428958
1273 Ga0207640_10533435
1274 Ga0207658_10026045
1275 Ga0207658_10344096
1276 Ga0207658_11499183
1277 Ga0207658_11773000
1278 Ga0207677_10754271
1279 Ga0207677_10995210
1280 Ga0207677_11512541
1281 Ga0207703_10071899
1282 Ga0207703_10172471
1283 Ga0207703_10305432
1284 Ga0207703_10927191
1285 Ga0207678_10585403
1286 Ga0207678_10919969
1287 Ga0207641_10001555
1288 Ga0207641_10224163
1289 Ga0207641_10779401
1290 Ga0207641_12263441
1291 Ga0207648_10096714
1292 Ga0207648_10128170
1293 Ga0207648_10449446
1294 Ga0207676_10032978
1295 Ga0207676_10037489
1296 Ga0207676_10493096
1297 Ga0207676_12171216
1298 Ga0207675_100075067
1299 Ga0207675_100141576
1300 Ga0207675_100386941
1301 Ga0207675_100546833
1302 Ga0207675_100849284
1303 Ga0207675_102171613
1304 Ga0207683_10171223
1305 Ga0207698_11318736
1306 Ga0207428_10299276
1307 Ga0268266_10061892
1308 Ga0268266_10086858
1309 Ga0268265_10003704
1310 Ga0268265_10027957
1311 Ga0268265_10095912
1312 Ga0268265_10624052
1313 Ga0268265_10636839
1314 Ga0268265_11215044
1315 Ga0268265_11270439
1316 Ga0268265_12476821
1317 Ga0268264_10161519
1318 Ga0268264_10170044
1319 Ga0268264_10363128
1320 Ga0268264_10530594
1321 Ga0268264_11010484
1322 Ga0268264_11265941
1323 Ga0268264_12203431
1324 Ga0268264_12611343
1325 Ga0265332_10091388
1326 Ga0265328_10196934
1327 Ga0265316_10369661
1328 Ga0265316_10934865
1329 Ga0307509_10969113
1330 Ga0265314_10028007
1331 Ga0373930_0027533
1332 Ga0373950_0030814
1333 Ga0373959_0000584
1334 Ga0373938_0000246
1335 Ga0373928_0245310
1336 Ga0373929_0001107
1337 Ga0373934_0046037
1338 Ga0373934_0206651
1339 Ga0373944_0036447
1340 Ga0373949_0000723
1341 Ga0373951_0001149
1342 Ga0373952_0001986
1343 Ga0373923_0162116
1344 Ga0373932_0001576
1345 Ga0373939_0002077
1346 Ga0373939_0017505
1347 Ga0373941_0003915
1348 Ga0373945_0260392
1349 Ga0373953_0189196
1350 Ga0373953_0193407
1351 Ga0373953_0419323
1352 Ga0373954_0578429
1353 Ga0373956_0075397
1354 Ga0373956_0124532
1355 Ga0373956_0433110
1356 Ga0373960_0001701
1357 Ga0373943_0177866
1358 Ga0373946_0129232
1359 Ga0373946_0155157
1360 Ga0373955_0041295
1361 Ga0373955_0153241
1362 Ga0373955_0347729
1363 Ga0373942_0002357
1364 Ga0373942_0034448
1365 Ga0373961_0019411
1366 Ga0373961_0048235
1367 Ga0373962_0001985
1368 Ga0373962_0032176
1369 Ga0373924_0127581
1370 Ga0373931_0004416
1371 Ga0373931_0050855
1372 Ga0373933_0152513
1373 Ga0373933_0354177
1374 Ga0373947_0806222
1375 Ga0373937_0075645
1376 Ga0373937_0210358
1377 Ga0373937_0268405
1378 Ga0373937_0321838
1379 Ga0373937_1049617
1380 Ga0373937_2042218
1381 Ga0373925_0027078
1382 Ga0373925_0036527
1383 Ga0373925_0332679
1384 Ga0373925_0812581
1385 Ga0373925_1229106
1386 Ga0395898_1163821
1387 Ga0395905_1848998
1388 Ga0436365_0544872
1389 Ga0450917_017715
1390 Ga0466960_0260570
1391 Ga0451576_0068018
1392 Ga0451576_0589303
1393 Ga0466967_0651805
1394 Ga0495592_0011828
1395 Ga0495592_0395407
1396 Ga0495603_0137326
1397 Ga0495603_0718015
1398 Ga0495629_0125381
1399 Ga0495629_0665502
1400 Ga0495641_0600344
1401 Ga0495651_0068786
1402 Ga0495580_0439618
1403 Ga0495580_0841818
1404 Ga0495582_0091701
1405 Ga0495639_0126512
1406 Ga0495662_0084189
1407 Ga0495664_0229601
1408 Ga0495594_0305167
1409 Ga0495608_0044205
1410 Ga0495618_0590617
1411 Ga0495618_0848066
1412 Ga0495628_0138263
1413 Ga0495628_0156148
1414 Ga0495628_0205073
1415 Ga0495630_0007136
1416 Ga0495630_0861177
1417 Ga0495644_0191708
1418 Ga0495663_0236899
1419 Ga0495652_0112434
1420 Ga0495665_0163959
1421 Ga0495665_0267107
1422 Ga0495640_0033709
1423 Ga0495640_0200915
1424 Ga0495640_0722172
1425 Ga0495586_0045841
1426 Ga0495586_0131865
1427 Ga0495586_0213512
1428 Ga0495586_0401848
1429 Ga0495598_0074404
1430 Ga0495621_0182385
1431 Ga0495645_0011781
1432 Ga0495645_0230738
1433 Ga0495645_0283070
1434 Ga0495667_0007822
1435 Ga0495667_0194889
1436 Ga0495634_0110740
1437 Ga0495634_0144189
1438 Ga0495611_0091020
1439 Ga0495635_0098590
1440 Ga0495635_0251159
1441 Ga0495635_0972412
1442 Ga0495657_0530402
1443 Ga0495657_0672342
1444 Ga0495599_0411459
1445 Ga0495623_0156472
1446 Ga0495623_0167924
1447 Ga0495646_0071460
1448 Ga0495646_0388168
1449 Ga0495647_0013208
1450 Ga0495647_0213437
1451 Ga0495647_0279320
1452 Ga0495658_0018902
1453 Ga0495658_0020982
1454 Ga0495658_0060825
1455 Ga0495669_0009227
1456 Ga0495669_0315131
1457 Ga0495613_0001154
1458 Ga0495613_0143553
1459 Ga0495613_0282669
1460 Ga0495613_0460712
1461 Ga0495624_0764243
1462 Ga0495670_0167383
1463 Ga0495600_0017025
1464 Ga0495581_0129885
1465 Ga0495581_0372866
1466 Ga0495604_0031887
1467 Ga0495674_0097043
1468 Ga0495674_0141879
1469 Ga0495674_0217433
1470 Ga0495674_0562672
1471 Ga0495672_0380707
1472 Ga0495676_0584632
1473 Ga0495676_0995130
1474 Ga0495680_0115530
1475 Ga0495680_0266158
1476 Ga0495680_0872400
1477 Ga0495675_0093306
1478 Ga0495684_0000137
1479 Ga0495684_0213842
1480 Ga0495684_0470383
1481 Ga0495684_0521818
1482 Ga0495602_0590285
1483 Ga0495614_0289958
1484 Ga0495614_0389494
1485 Ga0496100_0016614
1486 Ga0496100_0800731
1487 Ga0496101_0009889
1488 Ga0496102_1337731
1489 Ga0496102_1735985
1490 Ga0496103_0544845
1491 Ga0496104_0026952
1492 Ga0496104_0066484
1493 Ga0496104_0121701
1494 Ga0496104_0192744
1495 Ga0496104_1877042
1496 Ga0496105_0095316
1497 Ga0496105_0109543
1498 Ga0496105_0336405
1499 Ga0496105_1319409
1500 Ga0496106_0140723
1501 Ga0496106_0168074
1502 Ga0496106_0174260
1503 Ga0496106_0405935
1504 Ga0496106_1450265
1505 Ga0496107_0127411
1506 Ga0496107_0340854
1507 Ga0496108_0004932
1508 Ga0496108_0329882
1509 Ga0496109_0141083
1510 Ga0496109_0375781
1511 Ga0496110_0495440
1512 Ga0496110_0569351
1513 Ga0496110_1519168
1514 Ga0496112_0038295
1515 Ga0496112_0269627
1516 Ga0496113_0196249
1517 Ga0496113_0597596
1518 Ga0496114_0002111
1519 Ga0496114_0011871
1520 Ga0496114_0141090
1521 Ga0496114_0436566
1522 Ga0496114_0481790
1523 Ga0496114_0643575
1524 Ga0496114_1225969
1525 Ga0501042_0353018
1526 Ga0501071_1118008
1527 nmdc:mga05p37_1356986_c1
1528 nmdc:mga05p37_15547_c1
1529 nmdc:mga05p37_156747_c1
1530 nmdc:mga05p37_19599_c1
1531 nmdc:mga05p37_233346_c1
1532 nmdc:mga05p37_24612_c1
1533 nmdc:mga05p37_273109_c1
1534 nmdc:mga05p37_48936_c1
1535 nmdc:mga05p37_5421_c1
1536 nmdc:mga05p37_628613_c1
1537 nmdc:mga09592_999104_c1
1538 nmdc:mga08y16_43135_c1
1539 nmdc:mga0n895_105629_c1
1540 nmdc:mga0n895_176200_c1
1541 nmdc:mga0n895_229028_c1
1542 nmdc:mga0n895_252630_c1
1543 nmdc:mga0n895_382415_c1
1544 nmdc:mga0n895_402_c1
1545 nmdc:mga0n895_56077_c1
1546 nmdc:mga0n895_79974_c1
1547 nmdc:mga0rr50_125257_c1
1548 nmdc:mga0rr50_169463_c1
1549 nmdc:mga0rr50_226_c1
1550 nmdc:mga0rr50_2_c1
1551 nmdc:mga0rr50_484021_c1
1552 nmdc:mga0rr50_53978_c1
1553 nmdc:mga0rr50_54517_c1
1554 nmdc:mga0rr50_71639_c1
1555 nmdc:mga0rr50_81607_c1
1556 nmdc:mga08x19_117904_c1
1557 nmdc:mga08x19_119_c1
1558 nmdc:mga08x19_1256428_c1
1559 nmdc:mga08x19_238063_c1
1560 nmdc:mga08x19_304480_c1
1561 nmdc:mga08x19_30448_c1
1562 nmdc:mga08x19_328618_c1
1563 nmdc:mga08x19_69334_c1
1564 nmdc:mga08x19_697689_c1
1565 nmdc:mga08x19_917224_c1
1566 nmdc:mga0a205_1500935_c1
1567 nmdc:mga0a205_170437_c1
1568 nmdc:mga0a205_22181_c1
1569 nmdc:mga0a205_26937_c1
1570 nmdc:mga0a205_414813_c1
1571 Ga0495601_0034318
1572 Ga0495601_0094193
1573 Ga0495601_0204753
1574 Ga0495601_0237016
1575 Ga0495601_1014920
1576 Ga0495595_0163015
1577 Ga0495595_0198894
1578 Ga0495619_0092844
1579 Ga0495619_0108894
1580 Ga0495619_0159998
1581 Ga0495619_0257618
1582 Ga0530510_0807351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

5

74

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cgq-assembly1.cif.gz_A a putative acyl carrier protein(rv0033) from mycobacterium tuberculosis 0.9298 9 77
1x3o-assembly1.cif.gz_A crystal structure of the acyl carrier protein from thermus thermophilus hb8 0.9058 5 77
4r0m-assembly2.cif.gz_A structure of mcyg a-pcp complexed with phenylalanyl-adenylate 0.9023 10 77
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8991 7 77
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.899 9 77
ID Description Score Start End Superfamily
2cgqA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9298 9 77 1.10.1200.10
af_G5ECV9_328_405_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9192 6 83 1.10.1200.10
af_Q9VIC9_329_406_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9138 6 83 1.10.1200.10
af_P40976_871_959_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9126 9 81 1.10.1200.10
af_A0A0R0JYM4_102_183_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9096 9 84 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A7V3T0P0-F1-model_v4 Acyl carrier protein 0.9856 10 77
AF-A0A843SVS0-F1-model_v4 Carrier domain-containing protein 0.9833 3 85 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
GO:0031177
AF-A0A0D0P7Y5-F1-model_v4 Carrier domain-containing protein 0.9756 6 84
AF-A0A6N8BAZ4-F1-model_v4 Acyl carrier protein 0.9671 9 84 GO:0000035
GO:0000036
AF-R5U207-F1-model_v4 deleted 0.9654 6 85

Map