F480915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 276 | 1578 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_2477707|Ga0451853_2477707_298_753 |
| Length | 146 |
| Sequence | LTTKFERQGTILRLVQEQPLSTQAEVAKAVQATGIDASRDIQQLGLVKVRNAEGRLVYAMQGAADLRRLDELTFALRRWAGGFTPAGNLCVIVTPRGFAAALADAIDAADLDEVAGTIAGDNTVFAAARDGVSGAELAHILRDHLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 124 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 131 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 149 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 150 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 153 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 154 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 155 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 169 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 1.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.38 |
| Nodule | 0 |
| Rhizoplane | 9.63 |
| Rhizosphere | 88.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451853_2477707 | 3300041512 | Bacteria | 1267 |
| 2 | Ga0070658_10297627 | 3300005327 | Bacteria | 1375 |
| 3 | Ga0070658_11539116 | 3300005327 | Bacteria | 577 |
| 4 | Ga0070658_11744009 | 3300005327 | Unclassified | 539 |
| 5 | Ga0070683_100022473 | 3300005329 | Bacteria | 5636 |
| 6 | Ga0070683_100242695 | 3300005329 | Bacteria | 1713 |
| 7 | Ga0070683_100984344 | 3300005329 | Bacteria | 809 |
| 8 | Ga0070680_100098219 | 3300005336 | Bacteria | 2428 |
| 9 | Ga0070680_100310611 | 3300005336 | Bacteria | 1337 |
| 10 | Ga0070680_100351774 | 3300005336 | Bacteria | 1253 |
| 11 | Ga0070680_100592359 | 3300005336 | Bacteria | 951 |
| 12 | Ga0070682_100463393 | 3300005337 | Bacteria | 973 |
| 13 | Ga0070682_100540571 | 3300005337 | Bacteria | 910 |
| 14 | Ga0068868_100207268 | 3300005338 | Bacteria | 1637 |
| 15 | Ga0068868_102227841 | 3300005338 | Bacteria | 522 |
| 16 | Ga0070660_100001563 | 3300005339 | Bacteria | 15742 |
| 17 | Ga0070660_100014598 | 3300005339 | Bacteria | 5665 |
| 18 | Ga0070660_100122754 | 3300005339 | Bacteria | 2073 |
| 19 | Ga0070660_100132660 | 3300005339 | Bacteria | 1994 |
| 20 | Ga0070660_100254577 | 3300005339 | Bacteria | 1432 |
| 21 | Ga0070660_100359697 | 3300005339 | Bacteria | 1199 |
| 22 | Ga0070660_100684568 | 3300005339 | Unclassified | 859 |
| 23 | Ga0070661_100042521 | 3300005344 | Bacteria | 3317 |
| 24 | Ga0070661_100206345 | 3300005344 | Bacteria | 1503 |
| 25 | Ga0070661_100295638 | 3300005344 | Bacteria | 1259 |
| 26 | Ga0070661_100425663 | 3300005344 | Bacteria | 1053 |
| 27 | Ga0070661_100434384 | 3300005344 | Bacteria | 1042 |
| 28 | Ga0070674_100336369 | 3300005356 | Bacteria | 1215 |
| 29 | Ga0070659_100019410 | 3300005366 | Bacteria | 5151 |
| 30 | Ga0070659_100293702 | 3300005366 | Bacteria | 1354 |
| 31 | Ga0070659_100536331 | 3300005366 | Bacteria | 1001 |
| 32 | Ga0070709_10206892 | 3300005434 | Bacteria | 1393 |
| 33 | Ga0070714_100398938 | 3300005435 | Bacteria | 1300 |
| 34 | Ga0070714_100598460 | 3300005435 | Bacteria | 1059 |
| 35 | Ga0070714_100801835 | 3300005435 | Bacteria | 912 |
| 36 | Ga0070714_100863759 | 3300005435 | Bacteria | 878 |
| 37 | Ga0070714_101543006 | 3300005435 | Bacteria | 649 |
| 38 | Ga0070713_100010445 | 3300005436 | Bacteria | 6705 |
| 39 | Ga0070713_100250283 | 3300005436 | Bacteria | 1616 |
| 40 | Ga0070713_100268019 | 3300005436 | Bacteria | 1563 |
| 41 | Ga0070713_100280070 | 3300005436 | Bacteria | 1530 |
| 42 | Ga0070713_100688237 | 3300005436 | Bacteria | 976 |
| 43 | Ga0070713_100721030 | 3300005436 | Bacteria | 953 |
| 44 | Ga0070710_10490985 | 3300005437 | Bacteria | 839 |
| 45 | Ga0070700_101554377 | 3300005441 | Bacteria | 564 |
| 46 | Ga0070708_101475342 | 3300005445 | Bacteria | 634 |
| 47 | Ga0070678_100305726 | 3300005456 | Bacteria | 1353 |
| 48 | Ga0070662_100845822 | 3300005457 | Bacteria | 779 |
| 49 | Ga0070681_10006856 | 3300005458 | Bacteria | 11085 |
| 50 | Ga0070681_10053018 | 3300005458 | Bacteria | 4042 |
| 51 | Ga0070681_10076791 | 3300005458 | Bacteria | 3298 |
| 52 | Ga0070681_10141621 | 3300005458 | Bacteria | 2334 |
| 53 | Ga0070681_10279660 | 3300005458 | Bacteria | 1579 |
| 54 | Ga0070681_10569448 | 3300005458 | Bacteria | 1046 |
| 55 | Ga0070681_10610813 | 3300005458 | Bacteria | 1005 |
| 56 | Ga0070681_10816871 | 3300005458 | Bacteria | 849 |
| 57 | Ga0070681_11021840 | 3300005458 | Bacteria | 747 |
| 58 | Ga0070685_10641475 | 3300005466 | Bacteria | 769 |
| 59 | Ga0070706_100017050 | 3300005467 | Bacteria | 6709 |
| 60 | Ga0070706_101100065 | 3300005467 | Unclassified | 731 |
| 61 | Ga0070707_100001665 | 3300005468 | Bacteria | 21503 |
| 62 | Ga0070707_100006647 | 3300005468 | Bacteria | 10717 |
| 63 | Ga0070707_100101818 | 3300005468 | Bacteria | 2783 |
| 64 | Ga0070698_100291060 | 3300005471 | Bacteria | 1564 |
| 65 | Ga0070699_100050482 | 3300005518 | Bacteria | 3601 |
| 66 | Ga0070679_100003508 | 3300005530 | Bacteria | 14361 |
| 67 | Ga0070679_100015519 | 3300005530 | Bacteria | 7319 |
| 68 | Ga0070679_100068761 | 3300005530 | Bacteria | 3532 |
| 69 | Ga0070679_100074134 | 3300005530 | Bacteria | 3394 |
| 70 | Ga0070679_100091236 | 3300005530 | Bacteria | 3034 |
| 71 | Ga0070679_100311297 | 3300005530 | Bacteria | 1524 |
| 72 | Ga0070679_100362081 | 3300005530 | Bacteria | 1398 |
| 73 | Ga0070679_100457389 | 3300005530 | Bacteria | 1221 |
| 74 | Ga0070679_100672635 | 3300005530 | Bacteria | 978 |
| 75 | Ga0070679_101045870 | 3300005530 | Bacteria | 761 |
| 76 | Ga0070684_100021794 | 3300005535 | Bacteria | 5336 |
| 77 | Ga0070684_100105020 | 3300005535 | Bacteria | 2528 |
| 78 | Ga0070684_100152126 | 3300005535 | Bacteria | 2096 |
| 79 | Ga0070684_100397980 | 3300005535 | Bacteria | 1269 |
| 80 | Ga0070697_100481746 | 3300005536 | Bacteria | 1083 |
| 81 | Ga0070697_100746823 | 3300005536 | Unclassified | 864 |
| 82 | Ga0070697_101164896 | 3300005536 | Bacteria | 687 |
| 83 | Ga0068853_100069038 | 3300005539 | Bacteria | 3073 |
| 84 | Ga0068853_100201476 | 3300005539 | Bacteria | 1811 |
| 85 | Ga0068853_100602946 | 3300005539 | Bacteria | 1043 |
| 86 | Ga0068853_101285537 | 3300005539 | Bacteria | 707 |
| 87 | Ga0070665_100053200 | 3300005548 | Bacteria | 4060 |
| 88 | Ga0068855_100028984 | 3300005563 | Bacteria | 6622 |
| 89 | Ga0068855_100086021 | 3300005563 | Bacteria | 3636 |
| 90 | Ga0068855_100114356 | 3300005563 | Bacteria | 3094 |
| 91 | Ga0068855_100295912 | 3300005563 | Bacteria | 1793 |
| 92 | Ga0068855_100375238 | 3300005563 | Bacteria | 1562 |
| 93 | Ga0068855_100553823 | 3300005563 | Bacteria | 1244 |
| 94 | Ga0068855_100718278 | 3300005563 | Bacteria | 1068 |
| 95 | Ga0070664_100249298 | 3300005564 | Bacteria | 1596 |
| 96 | Ga0070664_101521673 | 3300005564 | Bacteria | 633 |
| 97 | Ga0068857_100298956 | 3300005577 | Bacteria | 1484 |
| 98 | Ga0068857_100731573 | 3300005577 | Bacteria | 941 |
| 99 | Ga0068857_101652661 | 3300005577 | Bacteria | 626 |
| 100 | Ga0068856_100105286 | 3300005614 | Bacteria | 2815 |
| 101 | Ga0068856_100368364 | 3300005614 | Bacteria | 1455 |
| 102 | Ga0068856_100637773 | 3300005614 | Bacteria | 1086 |
| 103 | Ga0068856_101222339 | 3300005614 | Bacteria | 767 |
| 104 | Ga0068852_100032182 | 3300005616 | Bacteria | 4339 |
| 105 | Ga0068852_100827841 | 3300005616 | Bacteria | 941 |
| 106 | Ga0068852_100989682 | 3300005616 | Bacteria | 859 |
| 107 | Ga0068852_101276563 | 3300005616 | Bacteria | 756 |
| 108 | Ga0068861_101240069 | 3300005719 | Unclassified | 723 |
| 109 | Ga0068858_100941662 | 3300005842 | Bacteria | 845 |
| 110 | Ga0081455_10037042 | 3300005937 | Bacteria | 4335 |
| 111 | Ga0081539_10003715 | 3300005985 | Bacteria | 18186 |
| 112 | Ga0070717_10062788 | 3300006028 | Bacteria | 3081 |
| 113 | Ga0070717_10499693 | 3300006028 | Bacteria | 1099 |
| 114 | Ga0070717_10787000 | 3300006028 | Unclassified | 865 |
| 115 | Ga0070717_11238554 | 3300006028 | Bacteria | 679 |
| 116 | Ga0070717_11373737 | 3300006028 | Bacteria | 642 |
| 117 | Ga0075365_10651116 | 3300006038 | Bacteria | 745 |
| 118 | Ga0070715_10163896 | 3300006163 | Bacteria | 1101 |
| 119 | Ga0070716_100654966 | 3300006173 | Bacteria | 797 |
| 120 | Ga0097621_100927612 | 3300006237 | Bacteria | 812 |
| 121 | Ga0075433_10027992 | 3300006852 | Bacteria | 4787 |
| 122 | Ga0075433_10105522 | 3300006852 | Bacteria | 2497 |
| 123 | Ga0075434_100053016 | 3300006871 | Bacteria | 4031 |
| 124 | Ga0075434_100306901 | 3300006871 | Bacteria | 1607 |
| 125 | Ga0068865_100670812 | 3300006881 | Bacteria | 883 |
| 126 | Ga0105240_10016409 | 3300009093 | Bacteria | 10027 |
| 127 | Ga0105240_10039954 | 3300009093 | Bacteria | 6005 |
| 128 | Ga0105240_10065328 | 3300009093 | Bacteria | 4517 |
| 129 | Ga0105240_10301138 | 3300009093 | Bacteria | 1834 |
| 130 | Ga0105240_10366328 | 3300009093 | Bacteria | 1631 |
| 131 | Ga0111539_10932179 | 3300009094 | Bacteria | 1010 |
| 132 | Ga0105245_10457419 | 3300009098 | Bacteria | 1286 |
| 133 | Ga0105245_10774638 | 3300009098 | Bacteria | 996 |
| 134 | Ga0114129_10400667 | 3300009147 | Bacteria | 1808 |
| 135 | Ga0105243_10487009 | 3300009148 | Bacteria | 1165 |
| 136 | Ga0105243_11241542 | 3300009148 | Bacteria | 760 |
| 137 | Ga0105243_11717408 | 3300009148 | Bacteria | 657 |
| 138 | Ga0105241_10072352 | 3300009174 | Bacteria | 2679 |
| 139 | Ga0105241_10602099 | 3300009174 | Bacteria | 993 |
| 140 | Ga0105242_10180013 | 3300009176 | Bacteria | 1864 |
| 141 | Ga0105248_11730582 | 3300009177 | Bacteria | 709 |
| 142 | Ga0105237_10161314 | 3300009545 | Bacteria | 2241 |
| 143 | Ga0105237_10369831 | 3300009545 | Bacteria | 1438 |
| 144 | Ga0105238_10038048 | 3300009551 | Bacteria | 4888 |
| 145 | Ga0105238_10308563 | 3300009551 | Bacteria | 1567 |
| 146 | Ga0105238_10693693 | 3300009551 | Bacteria | 1030 |
| 147 | Ga0105239_11109036 | 3300010375 | Bacteria | 911 |
| 148 | Ga0157373_10291678 | 3300013100 | Bacteria | 1157 |
| 149 | Ga0157371_10488453 | 3300013102 | Unclassified | 908 |
| 150 | Ga0157370_10009810 | 3300013104 | Bacteria | 10154 |
| 151 | Ga0157370_10014464 | 3300013104 | Bacteria | 8067 |
| 152 | Ga0157370_10096394 | 3300013104 | Bacteria | 2775 |
| 153 | Ga0157370_10533748 | 3300013104 | Bacteria | 1076 |
| 154 | Ga0157369_10001071 | 3300013105 | Bacteria | 34352 |
| 155 | Ga0157369_10016070 | 3300013105 | Bacteria | 8421 |
| 156 | Ga0157369_10020561 | 3300013105 | Bacteria | 7379 |
| 157 | Ga0157369_10335394 | 3300013105 | Bacteria | 1571 |
| 158 | Ga0157369_10439785 | 3300013105 | Bacteria | 1351 |
| 159 | Ga0157369_10475513 | 3300013105 | Bacteria | 1293 |
| 160 | Ga0157369_11028817 | 3300013105 | Bacteria | 843 |
| 161 | Ga0157369_11966829 | 3300013105 | Bacteria | 593 |
| 162 | Ga0157369_11999771 | 3300013105 | Bacteria | 588 |
| 163 | Ga0157369_12088788 | 3300013105 | Bacteria | 575 |
| 164 | Ga0157374_10060063 | 3300013296 | Bacteria | 3557 |
| 165 | Ga0157374_11137416 | 3300013296 | Unclassified | 801 |
| 166 | Ga0157374_11284492 | 3300013296 | Bacteria | 754 |
| 167 | Ga0157372_10052796 | 3300013307 | Bacteria | 4528 |
| 168 | Ga0157372_10178808 | 3300013307 | Bacteria | 2456 |
| 169 | Ga0157372_10334115 | 3300013307 | Bacteria | 1765 |
| 170 | Ga0157372_11035183 | 3300013307 | Bacteria | 950 |
| 171 | Ga0157375_11136478 | 3300013308 | Bacteria | 915 |
| 172 | Ga0157375_11939025 | 3300013308 | Bacteria | 700 |
| 173 | Ga0182008_10032238 | 3300014497 | Bacteria | 2633 |
| 174 | Ga0157377_10097013 | 3300014745 | Bacteria | 1750 |
| 175 | Ga0157379_10989473 | 3300014968 | Bacteria | 801 |
| 176 | Ga0157376_10359766 | 3300014969 | Bacteria | 1395 |
| 177 | Ga0197907_11105880 | 3300020069 | Bacteria | 805 |
| 178 | Ga0197907_11227914 | 3300020069 | Bacteria | 1387 |
| 179 | Ga0206356_10193339 | 3300020070 | Unclassified | 777 |
| 180 | Ga0206356_10930650 | 3300020070 | Bacteria | 8554 |
| 181 | Ga0206354_10305434 | 3300020081 | Bacteria | 652 |
| 182 | Ga0206354_11045300 | 3300020081 | Bacteria | 2570 |
| 183 | Ga0206354_11164945 | 3300020081 | Bacteria | 1041 |
| 184 | Ga0206353_10000463 | 3300020082 | Bacteria | 1149 |
| 185 | Ga0206353_10049000 | 3300020082 | Bacteria | 3592 |
| 186 | Ga0206353_10527348 | 3300020082 | Bacteria | 8728 |
| 187 | Ga0206353_10931732 | 3300020082 | Unclassified | 651 |
| 188 | Ga0206353_10973097 | 3300020082 | Bacteria | 715 |
| 189 | Ga0206353_11000335 | 3300020082 | Bacteria | 6237 |
| 190 | Ga0206353_11609747 | 3300020082 | Bacteria | 995 |
| 191 | Ga0207656_10069209 | 3300025321 | Bacteria | 1565 |
| 192 | Ga0207647_10520589 | 3300025904 | Bacteria | 662 |
| 193 | Ga0207705_10130780 | 3300025909 | Bacteria | 1868 |
| 194 | Ga0207705_10158889 | 3300025909 | Bacteria | 1697 |
| 195 | Ga0207705_10160591 | 3300025909 | Bacteria | 1688 |
| 196 | Ga0207705_10214652 | 3300025909 | Bacteria | 1460 |
| 197 | Ga0207705_10652648 | 3300025909 | Bacteria | 818 |
| 198 | Ga0207705_10686594 | 3300025909 | Bacteria | 796 |
| 199 | Ga0207705_10939050 | 3300025909 | Bacteria | 669 |
| 200 | Ga0207705_11511273 | 3300025909 | Unclassified | 508 |
| 201 | Ga0207684_10081036 | 3300025910 | Bacteria | 2762 |
| 202 | Ga0207654_10302984 | 3300025911 | Bacteria | 1087 |
| 203 | Ga0207654_11013570 | 3300025911 | Bacteria | 604 |
| 204 | Ga0207707_10023981 | 3300025912 | Bacteria | 5334 |
| 205 | Ga0207707_10036910 | 3300025912 | Bacteria | 4270 |
| 206 | Ga0207707_10078664 | 3300025912 | Bacteria | 2880 |
| 207 | Ga0207707_10110325 | 3300025912 | Bacteria | 2404 |
| 208 | Ga0207707_10396455 | 3300025912 | Bacteria | 1185 |
| 209 | Ga0207707_10498039 | 3300025912 | Bacteria | 1039 |
| 210 | Ga0207707_10745347 | 3300025912 | Bacteria | 819 |
| 211 | Ga0207707_10983596 | 3300025912 | Bacteria | 693 |
| 212 | Ga0207707_11202671 | 3300025912 | Bacteria | 613 |
| 213 | Ga0207695_10152370 | 3300025913 | Bacteria | 2250 |
| 214 | Ga0207695_10425550 | 3300025913 | Bacteria | 1212 |
| 215 | Ga0207695_10519743 | 3300025913 | Bacteria | 1072 |
| 216 | Ga0207695_10898103 | 3300025913 | Bacteria | 766 |
| 217 | Ga0207671_10148356 | 3300025914 | Bacteria | 1811 |
| 218 | Ga0207671_10232402 | 3300025914 | Bacteria | 1447 |
| 219 | Ga0207671_10559414 | 3300025914 | Bacteria | 912 |
| 220 | Ga0207693_10167727 | 3300025915 | Bacteria | 1729 |
| 221 | Ga0207663_10045812 | 3300025916 | Bacteria | 2692 |
| 222 | Ga0207663_10668296 | 3300025916 | Bacteria | 821 |
| 223 | Ga0207663_10881054 | 3300025916 | Bacteria | 715 |
| 224 | Ga0207660_10032553 | 3300025917 | Bacteria | 3599 |
| 225 | Ga0207660_10273555 | 3300025917 | Bacteria | 1338 |
| 226 | Ga0207660_10389440 | 3300025917 | Bacteria | 1121 |
| 227 | Ga0207660_10930209 | 3300025917 | Unclassified | 709 |
| 228 | Ga0207657_10000220 | 3300025919 | Bacteria | 59453 |
| 229 | Ga0207657_10001478 | 3300025919 | Bacteria | 25119 |
| 230 | Ga0207657_10002441 | 3300025919 | Bacteria | 20078 |
| 231 | Ga0207657_10014169 | 3300025919 | Bacteria | 7798 |
| 232 | Ga0207657_10166873 | 3300025919 | Bacteria | 1785 |
| 233 | Ga0207657_10318909 | 3300025919 | Bacteria | 1229 |
| 234 | Ga0207657_10574718 | 3300025919 | Bacteria | 880 |
| 235 | Ga0207649_10065276 | 3300025920 | Bacteria | 2303 |
| 236 | Ga0207649_10113235 | 3300025920 | Bacteria | 1817 |
| 237 | Ga0207649_10332815 | 3300025920 | Bacteria | 1119 |
| 238 | Ga0207649_10950654 | 3300025920 | Bacteria | 675 |
| 239 | Ga0207649_11080166 | 3300025920 | Bacteria | 633 |
| 240 | Ga0207652_10033280 | 3300025921 | Bacteria | 4339 |
| 241 | Ga0207652_10080977 | 3300025921 | Bacteria | 2840 |
| 242 | Ga0207652_10204633 | 3300025921 | Bacteria | 1776 |
| 243 | Ga0207652_10210834 | 3300025921 | Bacteria | 1749 |
| 244 | Ga0207652_10363939 | 3300025921 | Bacteria | 1305 |
| 245 | Ga0207652_10458032 | 3300025921 | Bacteria | 1150 |
| 246 | Ga0207652_10480013 | 3300025921 | Bacteria | 1120 |
| 247 | Ga0207652_10830295 | 3300025921 | Bacteria | 819 |
| 248 | Ga0207646_10012253 | 3300025922 | Bacteria | 8248 |
| 249 | Ga0207646_10039425 | 3300025922 | Bacteria | 4252 |
| 250 | Ga0207646_10367987 | 3300025922 | Bacteria | 1299 |
| 251 | Ga0207646_10738673 | 3300025922 | Bacteria | 879 |
| 252 | Ga0207646_10740298 | 3300025922 | Bacteria | 878 |
| 253 | Ga0207646_11117184 | 3300025922 | Bacteria | 693 |
| 254 | Ga0207646_11206096 | 3300025922 | Bacteria | 663 |
| 255 | Ga0207687_10851795 | 3300025927 | Bacteria | 779 |
| 256 | Ga0207687_11634380 | 3300025927 | Bacteria | 553 |
| 257 | Ga0207700_10261689 | 3300025928 | Bacteria | 1482 |
| 258 | Ga0207700_10263505 | 3300025928 | Bacteria | 1477 |
| 259 | Ga0207700_10453635 | 3300025928 | Bacteria | 1130 |
| 260 | Ga0207664_10320467 | 3300025929 | Bacteria | 1368 |
| 261 | Ga0207664_10438796 | 3300025929 | Bacteria | 1164 |
| 262 | Ga0207664_10650324 | 3300025929 | Bacteria | 947 |
| 263 | Ga0207664_10753456 | 3300025929 | Bacteria | 876 |
| 264 | Ga0207664_11090259 | 3300025929 | Bacteria | 714 |
| 265 | Ga0207690_10045701 | 3300025932 | Bacteria | 2895 |
| 266 | Ga0207690_10700491 | 3300025932 | Unclassified | 833 |
| 267 | Ga0207706_10696237 | 3300025933 | Bacteria | 868 |
| 268 | Ga0207686_10067130 | 3300025934 | Bacteria | 2293 |
| 269 | Ga0207665_10367794 | 3300025939 | Bacteria | 1089 |
| 270 | Ga0207665_10639807 | 3300025939 | Bacteria | 833 |
| 271 | Ga0207661_10053233 | 3300025944 | Bacteria | 3238 |
| 272 | Ga0207661_10114694 | 3300025944 | Bacteria | 2285 |
| 273 | Ga0207661_10224795 | 3300025944 | Bacteria | 1660 |
| 274 | Ga0207661_10251466 | 3300025944 | Bacteria | 1571 |
| 275 | Ga0207661_10341871 | 3300025944 | Bacteria | 1348 |
| 276 | Ga0207679_10628209 | 3300025945 | Bacteria | 970 |
| 277 | Ga0207679_11040583 | 3300025945 | Bacteria | 751 |
| 278 | Ga0207679_11089395 | 3300025945 | Bacteria | 733 |
| 279 | Ga0207667_10049918 | 3300025949 | Bacteria | 4416 |
| 280 | Ga0207667_10216073 | 3300025949 | Bacteria | 1965 |
| 281 | Ga0207667_10312419 | 3300025949 | Bacteria | 1605 |
| 282 | Ga0207667_10549967 | 3300025949 | Bacteria | 1168 |
| 283 | Ga0207667_10719894 | 3300025949 | Bacteria | 999 |
| 284 | Ga0207667_10735936 | 3300025949 | Bacteria | 986 |
| 285 | Ga0207651_11258648 | 3300025960 | Bacteria | 665 |
| 286 | Ga0207658_10068216 | 3300025986 | Bacteria | 2682 |
| 287 | Ga0207677_10067514 | 3300026023 | Bacteria | 2506 |
| 288 | Ga0207677_10146104 | 3300026023 | Bacteria | 1817 |
| 289 | Ga0207677_11530180 | 3300026023 | Unclassified | 617 |
| 290 | Ga0207703_10435840 | 3300026035 | Bacteria | 1222 |
| 291 | Ga0207639_10407372 | 3300026041 | Bacteria | 1226 |
| 292 | Ga0207639_10541782 | 3300026041 | Bacteria | 1068 |
| 293 | Ga0207639_10846265 | 3300026041 | Unclassified | 854 |
| 294 | Ga0207639_11078545 | 3300026041 | Bacteria | 753 |
| 295 | Ga0207678_10327284 | 3300026067 | Bacteria | 1319 |
| 296 | Ga0207678_10553304 | 3300026067 | Bacteria | 1006 |
| 297 | Ga0207708_10322855 | 3300026075 | Bacteria | 1260 |
| 298 | Ga0207708_10377468 | 3300026075 | Bacteria | 1168 |
| 299 | Ga0207702_10715460 | 3300026078 | Bacteria | 987 |
| 300 | Ga0207702_10799348 | 3300026078 | Bacteria | 932 |
| 301 | Ga0207702_10881688 | 3300026078 | Bacteria | 886 |
| 302 | Ga0207648_11297177 | 3300026089 | Unclassified | 684 |
| 303 | Ga0207674_10302412 | 3300026116 | Bacteria | 1549 |
| 304 | Ga0207674_10306046 | 3300026116 | Bacteria | 1538 |
| 305 | Ga0207674_10620217 | 3300026116 | Bacteria | 1045 |
| 306 | Ga0207674_11404506 | 3300026116 | Bacteria | 667 |
| 307 | Ga0207675_101166318 | 3300026118 | Bacteria | 790 |
| 308 | Ga0207683_10318746 | 3300026121 | Bacteria | 1424 |
| 309 | Ga0207683_11432704 | 3300026121 | Bacteria | 638 |
| 310 | Ga0207683_11838775 | 3300026121 | Bacteria | 555 |
| 311 | Ga0207698_10068622 | 3300026142 | Bacteria | 2800 |
| 312 | Ga0207698_10133039 | 3300026142 | Bacteria | 2129 |
| 313 | Ga0207698_10183190 | 3300026142 | Bacteria | 1857 |
| 314 | Ga0207698_11537840 | 3300026142 | Bacteria | 681 |
| 315 | Ga0207698_12353404 | 3300026142 | Bacteria | 544 |
| 316 | Ga0265337_1191827 | 3300028556 | Bacteria | 555 |
| 317 | Ga0265334_10241825 | 3300028573 | Bacteria | 622 |
| 318 | Ga0265318_10065389 | 3300028577 | Bacteria | 1352 |
| 319 | Ga0265338_10091901 | 3300028800 | Bacteria | 2505 |
| 320 | Ga0265320_10029612 | 3300031240 | Bacteria | 2832 |
| 321 | Ga0265340_10046139 | 3300031247 | Bacteria | 2126 |
| 322 | Ga0265327_10032369 | 3300031251 | Bacteria | 2927 |
| 323 | Ga0265327_10067598 | 3300031251 | Bacteria | 1800 |
| 324 | Ga0265327_10118298 | 3300031251 | Bacteria | 1259 |
| 325 | Ga0307408_100060606 | 3300031548 | Bacteria | 2759 |
| 326 | Ga0265313_10324886 | 3300031595 | Bacteria | 614 |
| 327 | Ga0307405_10074418 | 3300031731 | Bacteria | 2197 |
| 328 | Ga0307409_100252630 | 3300031995 | Bacteria | 1613 |
| 329 | Ga0307416_100024326 | 3300032002 | Bacteria | 4418 |
| 330 | Ga0373926_0032329 | 3300035083 | Bacteria | 1846 |
| 331 | Ga0373944_0001935 | 3300035089 | Bacteria | 5242 |
| 332 | Ga0373944_0067965 | 3300035089 | Bacteria | 1155 |
| 333 | Ga0373923_0121925 | 3300035111 | Bacteria | 1166 |
| 334 | Ga0373945_0009874 | 3300035116 | Bacteria | 3132 |
| 335 | Ga0373945_0014644 | 3300035116 | Bacteria | 2631 |
| 336 | Ga0373953_0147648 | 3300035117 | Bacteria | 1007 |
| 337 | Ga0373954_0386497 | 3300035118 | Bacteria | 692 |
| 338 | Ga0373956_0139111 | 3300035119 | Bacteria | 1139 |
| 339 | Ga0373957_0161422 | 3300035120 | Bacteria | 923 |
| 340 | Ga0373960_0086528 | 3300035121 | Bacteria | 996 |
| 341 | Ga0373943_0001066 | 3300035170 | Bacteria | 12184 |
| 342 | Ga0373943_0013614 | 3300035170 | Bacteria | 3676 |
| 343 | Ga0373943_0023582 | 3300035170 | Bacteria | 2862 |
| 344 | Ga0373946_0001825 | 3300035171 | Bacteria | 7440 |
| 345 | Ga0373935_0041286 | 3300035692 | Bacteria | 2898 |
| 346 | Ga0373935_0053773 | 3300035692 | Bacteria | 2562 |
| 347 | Ga0373927_0037309 | 3300035695 | Bacteria | 3159 |
| 348 | Ga0373927_0090601 | 3300035695 | Bacteria | 1986 |
| 349 | Ga0373933_0010494 | 3300035724 | Bacteria | 5079 |
| 350 | Ga0373947_0001921 | 3300035725 | Bacteria | 12712 |
| 351 | Ga0373947_0002906 | 3300035725 | Bacteria | 10220 |
| 352 | Ga0373947_0039053 | 3300035725 | Bacteria | 2823 |
| 353 | Ga0373937_0695097 | 3300036401 | Bacteria | 963 |
| 354 | Ga0373925_0002713 | 3300037068 | Bacteria | 14018 |
| 355 | Ga0373925_0004151 | 3300037068 | Bacteria | 10987 |
| 356 | Ga0373925_0062082 | 3300037068 | Bacteria | 2809 |
| 357 | Ga0395899_0035839 | 3300037312 | Bacteria | 3723 |
| 358 | Ga0395899_0070373 | 3300037312 | Bacteria | 2561 |
| 359 | Ga0395899_0127530 | 3300037312 | Bacteria | 1819 |
| 360 | Ga0395899_0250122 | 3300037312 | Bacteria | 1216 |
| 361 | Ga0395899_0504198 | 3300037312 | Bacteria | 785 |
| 362 | Ga0395900_0005127 | 3300037418 | Bacteria | 13760 |
| 363 | Ga0395900_0047010 | 3300037418 | Bacteria | 4444 |
| 364 | Ga0395900_0061715 | 3300037418 | Bacteria | 3853 |
| 365 | Ga0395900_0074383 | 3300037418 | Bacteria | 3493 |
| 366 | Ga0395900_0109191 | 3300037418 | Bacteria | 2842 |
| 367 | Ga0395900_0160286 | 3300037418 | Bacteria | 2295 |
| 368 | Ga0395900_0324311 | 3300037418 | Bacteria | 1519 |
| 369 | Ga0395900_1048412 | 3300037418 | Bacteria | 734 |
| 370 | Ga0395900_1060316 | 3300037418 | Bacteria | 729 |
| 371 | Ga0395898_0005749 | 3300037466 | Bacteria | 13347 |
| 372 | Ga0395898_0020761 | 3300037466 | Bacteria | 6667 |
| 373 | Ga0395898_0029723 | 3300037466 | Bacteria | 5470 |
| 374 | Ga0395898_0127157 | 3300037466 | Bacteria | 2441 |
| 375 | Ga0395898_0281840 | 3300037466 | Bacteria | 1585 |
| 376 | Ga0395898_0301356 | 3300037466 | Bacteria | 1529 |
| 377 | Ga0395898_0517134 | 3300037466 | Bacteria | 1135 |
| 378 | Ga0395898_1400336 | 3300037466 | Bacteria | 627 |
| 379 | Ga0395905_0009643 | 3300037471 | Bacteria | 9423 |
| 380 | Ga0395905_0076069 | 3300037471 | Bacteria | 3146 |
| 381 | Ga0395905_0081770 | 3300037471 | Bacteria | 3027 |
| 382 | Ga0395905_0281511 | 3300037471 | Bacteria | 1549 |
| 383 | Ga0395905_0512612 | 3300037471 | Bacteria | 1100 |
| 384 | Ga0395905_0758924 | 3300037471 | Bacteria | 872 |
| 385 | Ga0395905_1146901 | 3300037471 | Bacteria | 681 |
| 386 | Ga0436364_0948865 | 3300037853 | Bacteria | 1956 |
| 387 | Ga0395901_0032994 | 3300038443 | Bacteria | 5342 |
| 388 | Ga0395901_0044500 | 3300038443 | Bacteria | 4604 |
| 389 | Ga0395901_0049065 | 3300038443 | Bacteria | 4385 |
| 390 | Ga0395901_0064432 | 3300038443 | Bacteria | 3815 |
| 391 | Ga0395901_0109775 | 3300038443 | Bacteria | 2896 |
| 392 | Ga0395901_0191907 | 3300038443 | Bacteria | 2142 |
| 393 | Ga0395901_0213862 | 3300038443 | Bacteria | 2017 |
| 394 | Ga0395901_0226100 | 3300038443 | Bacteria | 1955 |
| 395 | Ga0395901_1400939 | 3300038443 | Unclassified | 657 |
| 396 | Ga0436365_0147594 | 3300039437 | Bacteria | 924 |
| 397 | Ga0436365_0677001 | 3300039437 | Bacteria | 683 |
| 398 | Ga0436365_1160885 | 3300039437 | Bacteria | 2084 |
| 399 | Ga0436365_1307848 | 3300039437 | Bacteria | 1855 |
| 400 | Ga0436363_0247609 | 3300039450 | Bacteria | 1736 |
| 401 | Ga0436363_0854260 | 3300039450 | Bacteria | 1393 |
| 402 | Ga0439438_019009 | 3300041405 | Bacteria | 1948 |
| 403 | Ga0439466_0140567 | 3300041411 | Bacteria | 741 |
| 404 | Ga0451804_0706969 | 3300041463 | Unclassified | 724 |
| 405 | Ga0439448_0102477 | 3300042005 | Bacteria | 974 |
| 406 | Ga0439448_0238141 | 3300042005 | Bacteria | 641 |
| 407 | Ga0439451_025585 | 3300042009 | Unclassified | 1189 |
| 408 | Ga0450920_044314 | 3300042122 | Bacteria | 888 |
| 409 | Ga0439446_0015880 | 3300042156 | Bacteria | 2093 |
| 410 | Ga0450918_088542 | 3300042531 | Bacteria | 596 |
| 411 | Ga0466969_0278869 | 3300044656 | Bacteria | 757 |
| 412 | Ga0466965_0195583 | 3300044683 | Bacteria | 1071 |
| 413 | Ga0466966_0004226 | 3300044684 | Bacteria | 9480 |
| 414 | Ga0466966_0020777 | 3300044684 | Bacteria | 4316 |
| 415 | Ga0466966_0592655 | 3300044684 | Bacteria | 667 |
| 416 | Ga0466961_0011243 | 3300044693 | Bacteria | 5722 |
| 417 | Ga0466961_0179202 | 3300044693 | Bacteria | 1316 |
| 418 | Ga0466961_0335041 | 3300044693 | Bacteria | 922 |
| 419 | Ga0466963_0004592 | 3300044694 | Bacteria | 8039 |
| 420 | Ga0466963_0008879 | 3300044694 | Bacteria | 6031 |
| 421 | Ga0466963_0011662 | 3300044694 | Bacteria | 5354 |
| 422 | Ga0466963_0028128 | 3300044694 | Bacteria | 3606 |
| 423 | Ga0466963_0223067 | 3300044694 | Bacteria | 1320 |
| 424 | Ga0466963_1194122 | 3300044694 | Bacteria | 534 |
| 425 | Ga0466964_0018618 | 3300044706 | Bacteria | 2666 |
| 426 | Ga0466964_0036651 | 3300044706 | Bacteria | 1967 |
| 427 | Ga0466964_0653907 | 3300044706 | Bacteria | 582 |
| 428 | Ga0466971_0000979 | 3300044719 | Bacteria | 11752 |
| 429 | Ga0466971_0070413 | 3300044719 | Bacteria | 1588 |
| 430 | Ga0466971_0439354 | 3300044719 | Bacteria | 639 |
| 431 | Ga0466968_0007673 | 3300044735 | Bacteria | 4109 |
| 432 | Ga0466968_0026526 | 3300044735 | Bacteria | 2379 |
| 433 | Ga0466970_0064399 | 3300044765 | Bacteria | 1966 |
| 434 | Ga0466970_0237507 | 3300044765 | Bacteria | 1019 |
| 435 | Ga0466957_0005709 | 3300044842 | Bacteria | 6997 |
| 436 | Ga0466957_0039713 | 3300044842 | Bacteria | 2840 |
| 437 | Ga0466957_0079213 | 3300044842 | Bacteria | 2044 |
| 438 | Ga0466957_0486060 | 3300044842 | Bacteria | 854 |
| 439 | Ga0466957_0719865 | 3300044842 | Bacteria | 705 |
| 440 | Ga0466960_0292621 | 3300044901 | Bacteria | 916 |
| 441 | Ga0466959_0015296 | 3300045049 | Bacteria | 5587 |
| 442 | Ga0466959_0051023 | 3300045049 | Bacteria | 3036 |
| 443 | Ga0466959_0285589 | 3300045049 | Bacteria | 1132 |
| 444 | Ga0466959_0324836 | 3300045049 | Bacteria | 1051 |
| 445 | Ga0466958_0004045 | 3300045836 | Bacteria | 7685 |
| 446 | Ga0466958_0006549 | 3300045836 | Bacteria | 6347 |
| 447 | Ga0466958_0121303 | 3300045836 | Bacteria | 1637 |
| 448 | Ga0466958_0183473 | 3300045836 | Bacteria | 1328 |
| 449 | Ga0466958_0225307 | 3300045836 | Bacteria | 1196 |
| 450 | Ga0466958_0474200 | 3300045836 | Bacteria | 811 |
| 451 | Ga0466967_0005201 | 3300045976 | Bacteria | 8961 |
| 452 | Ga0466967_0023128 | 3300045976 | Bacteria | 5088 |
| 453 | Ga0466967_0046393 | 3300045976 | Bacteria | 3782 |
| 454 | Ga0466967_0052795 | 3300045976 | Bacteria | 3570 |
| 455 | Ga0466967_0091166 | 3300045976 | Bacteria | 2769 |
| 456 | Ga0466967_0157754 | 3300045976 | Bacteria | 2127 |
| 457 | Ga0466967_0200982 | 3300045976 | Bacteria | 1887 |
| 458 | Ga0466967_0332884 | 3300045976 | Bacteria | 1466 |
| 459 | Ga0466967_0333058 | 3300045976 | Bacteria | 1466 |
| 460 | Ga0466967_0657931 | 3300045976 | Bacteria | 1036 |
| 461 | Ga0466967_1408241 | 3300045976 | Bacteria | 694 |
| 462 | Ga0495592_0199930 | 3300046454 | Bacteria | 1349 |
| 463 | Ga0495592_0229783 | 3300046454 | Bacteria | 1236 |
| 464 | Ga0495592_0573014 | 3300046454 | Bacteria | 691 |
| 465 | Ga0495603_0123652 | 3300046455 | Bacteria | 1508 |
| 466 | Ga0495629_0000665 | 3300046459 | Bacteria | 27803 |
| 467 | Ga0495629_0133291 | 3300046459 | Bacteria | 1730 |
| 468 | Ga0495641_0163602 | 3300046461 | Bacteria | 995 |
| 469 | Ga0495641_0260361 | 3300046461 | Bacteria | 780 |
| 470 | Ga0495641_0478563 | 3300046461 | Unclassified | 567 |
| 471 | Ga0495651_0031780 | 3300046462 | Bacteria | 4115 |
| 472 | Ga0495651_0064363 | 3300046462 | Bacteria | 2802 |
| 473 | Ga0495651_0227349 | 3300046462 | Bacteria | 1287 |
| 474 | Ga0495651_0270840 | 3300046462 | Bacteria | 1151 |
| 475 | Ga0495651_0387159 | 3300046462 | Bacteria | 915 |
| 476 | Ga0495653_0030994 | 3300046463 | Bacteria | 4254 |
| 477 | Ga0495653_0054198 | 3300046463 | Bacteria | 3065 |
| 478 | Ga0495653_0337489 | 3300046463 | Bacteria | 972 |
| 479 | Ga0495653_0700205 | 3300046463 | Bacteria | 615 |
| 480 | Ga0495582_0000703 | 3300046473 | Bacteria | 18466 |
| 481 | Ga0495582_0110820 | 3300046473 | Bacteria | 1542 |
| 482 | Ga0495582_0411262 | 3300046473 | Bacteria | 780 |
| 483 | Ga0495582_0572041 | 3300046473 | Bacteria | 654 |
| 484 | Ga0495639_0001381 | 3300046475 | Bacteria | 10886 |
| 485 | Ga0495662_0000116 | 3300046476 | Bacteria | 30019 |
| 486 | Ga0495664_0109866 | 3300046477 | Bacteria | 1664 |
| 487 | Ga0495664_0515772 | 3300046477 | Bacteria | 713 |
| 488 | Ga0495608_0036271 | 3300046511 | Bacteria | 3320 |
| 489 | Ga0495608_0043568 | 3300046511 | Bacteria | 2998 |
| 490 | Ga0495608_0044126 | 3300046511 | Bacteria | 2976 |
| 491 | Ga0495608_0084644 | 3300046511 | Bacteria | 2057 |
| 492 | Ga0495608_0119594 | 3300046511 | Bacteria | 1690 |
| 493 | Ga0495608_0544989 | 3300046511 | Bacteria | 699 |
| 494 | Ga0495618_0227326 | 3300046514 | Bacteria | 1175 |
| 495 | Ga0495618_0324003 | 3300046514 | Bacteria | 954 |
| 496 | Ga0495618_0394081 | 3300046514 | Bacteria | 848 |
| 497 | Ga0495628_0081706 | 3300046516 | Bacteria | 2510 |
| 498 | Ga0495628_0095359 | 3300046516 | Bacteria | 2299 |
| 499 | Ga0495628_0110904 | 3300046516 | Bacteria | 2110 |
| 500 | Ga0495628_0280561 | 3300046516 | Bacteria | 1237 |
| 501 | Ga0495628_0338460 | 3300046516 | Bacteria | 1108 |
| 502 | Ga0495630_0003948 | 3300046517 | Bacteria | 10368 |
| 503 | Ga0495630_0004843 | 3300046517 | Bacteria | 9443 |
| 504 | Ga0495630_0030306 | 3300046517 | Bacteria | 4024 |
| 505 | Ga0495630_0068361 | 3300046517 | Bacteria | 2671 |
| 506 | Ga0495630_0084859 | 3300046517 | Bacteria | 2391 |
| 507 | Ga0495630_0125587 | 3300046517 | Bacteria | 1947 |
| 508 | Ga0495630_0180537 | 3300046517 | Bacteria | 1609 |
| 509 | Ga0495630_0458420 | 3300046517 | Bacteria | 977 |
| 510 | Ga0495666_0007368 | 3300046526 | Bacteria | 5516 |
| 511 | Ga0495652_0046438 | 3300046529 | Bacteria | 3729 |
| 512 | Ga0495652_0123489 | 3300046529 | Bacteria | 2061 |
| 513 | Ga0495652_0147845 | 3300046529 | Bacteria | 1839 |
| 514 | Ga0495652_0180161 | 3300046529 | Bacteria | 1622 |
| 515 | Ga0495665_0000801 | 3300046531 | Bacteria | 16452 |
| 516 | Ga0495665_0084160 | 3300046531 | Bacteria | 1672 |
| 517 | Ga0495640_0007990 | 3300046533 | Bacteria | 8315 |
| 518 | Ga0495640_0023288 | 3300046533 | Bacteria | 4515 |
| 519 | Ga0495640_0040320 | 3300046533 | Bacteria | 3270 |
| 520 | Ga0495640_0067577 | 3300046533 | Unclassified | 2407 |
| 521 | Ga0495640_0434557 | 3300046533 | Bacteria | 803 |
| 522 | Ga0495586_0019496 | 3300046535 | Bacteria | 3611 |
| 523 | Ga0495586_0068786 | 3300046535 | Bacteria | 1932 |
| 524 | Ga0495586_0231314 | 3300046535 | Bacteria | 1052 |
| 525 | Ga0495587_0059611 | 3300046536 | Bacteria | 2239 |
| 526 | Ga0495587_0277597 | 3300046536 | Bacteria | 939 |
| 527 | Ga0495645_0123487 | 3300046543 | Bacteria | 1821 |
| 528 | Ga0495645_0131190 | 3300046543 | Bacteria | 1756 |
| 529 | Ga0495645_0161069 | 3300046543 | Bacteria | 1551 |
| 530 | Ga0495645_0263760 | 3300046543 | Bacteria | 1139 |
| 531 | Ga0495645_0661290 | 3300046543 | Bacteria | 637 |
| 532 | Ga0495667_0009317 | 3300046559 | Bacteria | 6654 |
| 533 | Ga0495667_0043012 | 3300046559 | Bacteria | 2994 |
| 534 | Ga0495667_0050580 | 3300046559 | Bacteria | 2743 |
| 535 | Ga0495667_0105977 | 3300046559 | Bacteria | 1817 |
| 536 | Ga0495667_0544875 | 3300046559 | Bacteria | 725 |
| 537 | Ga0495667_0557236 | 3300046559 | Unclassified | 716 |
| 538 | Ga0495667_0925915 | 3300046559 | Bacteria | 534 |
| 539 | Ga0495656_0055459 | 3300046615 | Bacteria | 1709 |
| 540 | Ga0495634_0224360 | 3300046642 | Bacteria | 1158 |
| 541 | Ga0495634_0433691 | 3300046642 | Bacteria | 777 |
| 542 | Ga0495635_0012743 | 3300046663 | Bacteria | 5894 |
| 543 | Ga0495635_0053742 | 3300046663 | Bacteria | 2775 |
| 544 | Ga0495635_0065339 | 3300046663 | Bacteria | 2496 |
| 545 | Ga0495635_0157545 | 3300046663 | Bacteria | 1545 |
| 546 | Ga0495588_0479637 | 3300046674 | Bacteria | 652 |
| 547 | Ga0495588_0632178 | 3300046674 | Bacteria | 560 |
| 548 | Ga0495657_0045807 | 3300046675 | Bacteria | 2965 |
| 549 | Ga0495657_0788800 | 3300046675 | Unclassified | 543 |
| 550 | Ga0495599_0084468 | 3300046678 | Bacteria | 1983 |
| 551 | Ga0495599_0117241 | 3300046678 | Bacteria | 1656 |
| 552 | Ga0495599_0175736 | 3300046678 | Bacteria | 1320 |
| 553 | Ga0495599_0187756 | 3300046678 | Bacteria | 1272 |
| 554 | Ga0495623_0009051 | 3300046679 | Bacteria | 6458 |
| 555 | Ga0495623_0147813 | 3300046679 | Bacteria | 1392 |
| 556 | Ga0495646_0144672 | 3300046680 | Bacteria | 1326 |
| 557 | Ga0495646_0415756 | 3300046680 | Bacteria | 698 |
| 558 | Ga0495647_0008216 | 3300046681 | Bacteria | 3506 |
| 559 | Ga0495658_0000830 | 3300046683 | Bacteria | 16569 |
| 560 | Ga0495658_0359108 | 3300046683 | Bacteria | 926 |
| 561 | Ga0495613_0001439 | 3300046689 | Bacteria | 18178 |
| 562 | Ga0495613_0041144 | 3300046689 | Bacteria | 3423 |
| 563 | Ga0495613_0394777 | 3300046689 | Bacteria | 944 |
| 564 | Ga0495613_1029557 | 3300046689 | Unclassified | 528 |
| 565 | Ga0495624_0028038 | 3300046690 | Bacteria | 3682 |
| 566 | Ga0495624_0362380 | 3300046690 | Bacteria | 872 |
| 567 | Ga0495600_0054274 | 3300046809 | Bacteria | 2617 |
| 568 | Ga0495600_0058078 | 3300046809 | Bacteria | 2527 |
| 569 | Ga0495600_0195503 | 3300046809 | Bacteria | 1300 |
| 570 | Ga0495600_0390519 | 3300046809 | Bacteria | 867 |
| 571 | Ga0495581_0021885 | 3300047315 | Bacteria | 3706 |
| 572 | Ga0495581_0054401 | 3300047315 | Bacteria | 2311 |
| 573 | Ga0495604_0111210 | 3300047317 | Bacteria | 1997 |
| 574 | Ga0495604_0272615 | 3300047317 | Bacteria | 1146 |
| 575 | Ga0495674_0014116 | 3300047319 | Bacteria | 7482 |
| 576 | Ga0495674_0014734 | 3300047319 | Bacteria | 7314 |
| 577 | Ga0495674_0102143 | 3300047319 | Bacteria | 2439 |
| 578 | Ga0495674_0146617 | 3300047319 | Bacteria | 1981 |
| 579 | Ga0495674_0469494 | 3300047319 | Bacteria | 1009 |
| 580 | Ga0495676_0041364 | 3300047321 | Bacteria | 3795 |
| 581 | Ga0495676_0042327 | 3300047321 | Bacteria | 3740 |
| 582 | Ga0495676_0050800 | 3300047321 | Bacteria | 3323 |
| 583 | Ga0495680_0001597 | 3300047322 | Bacteria | 24161 |
| 584 | Ga0495680_0003809 | 3300047322 | Bacteria | 14638 |
| 585 | Ga0495680_0005975 | 3300047322 | Bacteria | 11385 |
| 586 | Ga0495680_0010259 | 3300047322 | Bacteria | 8358 |
| 587 | Ga0495680_0091470 | 3300047322 | Bacteria | 2281 |
| 588 | Ga0495680_0723308 | 3300047322 | Bacteria | 656 |
| 589 | Ga0495683_0115843 | 3300047323 | Bacteria | 1276 |
| 590 | Ga0495675_0208436 | 3300047444 | Bacteria | 1187 |
| 591 | Ga0495675_0231843 | 3300047444 | Bacteria | 1114 |
| 592 | Ga0495684_0007204 | 3300047471 | Bacteria | 8633 |
| 593 | Ga0495684_0008266 | 3300047471 | Bacteria | 8057 |
| 594 | Ga0495684_0072946 | 3300047471 | Bacteria | 2608 |
| 595 | Ga0495684_0105473 | 3300047471 | Bacteria | 2129 |
| 596 | Ga0495684_0122776 | 3300047471 | Bacteria | 1955 |
| 597 | Ga0495684_0134171 | 3300047471 | Bacteria | 1858 |
| 598 | Ga0495684_0706704 | 3300047471 | Bacteria | 668 |
| 599 | Ga0495593_0149057 | 3300047673 | Bacteria | 1183 |
| 600 | Ga0495602_0080423 | 3300048088 | Bacteria | 2745 |
| 601 | Ga0495602_0099896 | 3300048088 | Bacteria | 2384 |
| 602 | Ga0495602_0138578 | 3300048088 | Bacteria | 1929 |
| 603 | Ga0495602_0236533 | 3300048088 | Bacteria | 1369 |
| 604 | Ga0495602_0803839 | 3300048088 | Bacteria | 631 |
| 605 | Ga0495602_0816288 | 3300048088 | Bacteria | 625 |
| 606 | Ga0495614_0001458 | 3300048089 | Bacteria | 10232 |
| 607 | Ga0495614_0139366 | 3300048089 | Bacteria | 1077 |
| 608 | Ga0495614_0353797 | 3300048089 | Bacteria | 685 |
| 609 | Ga0496100_0010210 | 3300048903 | Bacteria | 5310 |
| 610 | Ga0496100_0069853 | 3300048903 | Bacteria | 2340 |
| 611 | Ga0496100_0857182 | 3300048903 | Bacteria | 713 |
| 612 | Ga0496101_0020298 | 3300048904 | Bacteria | 4545 |
| 613 | Ga0496101_0045211 | 3300048904 | Bacteria | 3153 |
| 614 | Ga0496101_0341906 | 3300048904 | Bacteria | 1175 |
| 615 | Ga0496101_0403483 | 3300048904 | Bacteria | 1076 |
| 616 | Ga0496101_1226522 | 3300048904 | Bacteria | 587 |
| 617 | Ga0496102_0070048 | 3300048905 | Bacteria | 3220 |
| 618 | Ga0496102_0227010 | 3300048905 | Bacteria | 1761 |
| 619 | Ga0496102_0809202 | 3300048905 | Bacteria | 859 |
| 620 | Ga0496103_0057573 | 3300048906 | Bacteria | 2413 |
| 621 | Ga0496103_0079097 | 3300048906 | Bacteria | 2066 |
| 622 | Ga0496104_0104553 | 3300048907 | Bacteria | 2713 |
| 623 | Ga0496104_0301821 | 3300048907 | Bacteria | 1513 |
| 624 | Ga0496104_0338948 | 3300048907 | Archaea | 1416 |
| 625 | Ga0496104_0357626 | 3300048907 | Archaea | 1373 |
| 626 | Ga0496104_1247379 | 3300048907 | Unclassified | 647 |
| 627 | Ga0496105_0037085 | 3300048908 | Bacteria | 4016 |
| 628 | Ga0496105_0164838 | 3300048908 | Bacteria | 1818 |
| 629 | Ga0496105_0442047 | 3300048908 | Unclassified | 1027 |
| 630 | Ga0496106_0126645 | 3300048909 | Bacteria | 2000 |
| 631 | Ga0496106_0492764 | 3300048909 | Bacteria | 984 |
| 632 | Ga0496106_0993555 | 3300048909 | Bacteria | 660 |
| 633 | Ga0496106_1283685 | 3300048909 | Bacteria | 569 |
| 634 | Ga0496107_0028226 | 3300048910 | Bacteria | 3987 |
| 635 | Ga0496107_0033277 | 3300048910 | Bacteria | 3688 |
| 636 | Ga0496107_0412326 | 3300048910 | Bacteria | 1004 |
| 637 | Ga0496108_0002107 | 3300048911 | Bacteria | 15931 |
| 638 | Ga0496108_0168507 | 3300048911 | Bacteria | 1894 |
| 639 | Ga0496108_1129456 | 3300048911 | Bacteria | 665 |
| 640 | Ga0496109_0023858 | 3300048912 | Bacteria | 5430 |
| 641 | Ga0496109_0175221 | 3300048912 | Bacteria | 2013 |
| 642 | Ga0496109_0446745 | 3300048912 | Bacteria | 1221 |
| 643 | Ga0496109_0472876 | 3300048912 | Bacteria | 1183 |
| 644 | Ga0496109_0862445 | 3300048912 | Bacteria | 843 |
| 645 | Ga0496109_1088174 | 3300048912 | Unclassified | 736 |
| 646 | Ga0496109_1514702 | 3300048912 | Bacteria | 606 |
| 647 | Ga0496110_0000524 | 3300048913 | Bacteria | 26088 |
| 648 | Ga0496110_0119765 | 3300048913 | Bacteria | 2371 |
| 649 | Ga0496110_0693018 | 3300048913 | Bacteria | 920 |
| 650 | Ga0496110_0800407 | 3300048913 | Bacteria | 847 |
| 651 | Ga0496111_0002105 | 3300048914 | Bacteria | 11875 |
| 652 | Ga0496111_0093397 | 3300048914 | Bacteria | 2205 |
| 653 | Ga0496111_0410313 | 3300048914 | Bacteria | 1001 |
| 654 | Ga0496111_0544117 | 3300048914 | Bacteria | 853 |
| 655 | Ga0496111_0554096 | 3300048914 | Bacteria | 844 |
| 656 | Ga0496112_0011989 | 3300048915 | Bacteria | 7948 |
| 657 | Ga0496112_0028573 | 3300048915 | Bacteria | 5384 |
| 658 | Ga0496112_0223905 | 3300048915 | Bacteria | 1837 |
| 659 | Ga0496112_0226555 | 3300048915 | Bacteria | 1824 |
| 660 | Ga0496112_0292555 | 3300048915 | Bacteria | 1574 |
| 661 | Ga0496112_0511482 | 3300048915 | Bacteria | 1136 |
| 662 | Ga0496112_0738770 | 3300048915 | Bacteria | 911 |
| 663 | Ga0496112_1028125 | 3300048915 | Bacteria | 743 |
| 664 | Ga0496112_1096425 | 3300048915 | Unclassified | 714 |
| 665 | Ga0496112_1504931 | 3300048915 | Bacteria | 587 |
| 666 | Ga0496113_0003437 | 3300048916 | Bacteria | 9480 |
| 667 | Ga0496113_0278142 | 3300048916 | Bacteria | 1338 |
| 668 | Ga0496113_1138323 | 3300048916 | Bacteria | 611 |
| 669 | Ga0496114_0008117 | 3300048917 | Bacteria | 8318 |
| 670 | Ga0496114_0010884 | 3300048917 | Bacteria | 7248 |
| 671 | Ga0496114_0023573 | 3300048917 | Bacteria | 5024 |
| 672 | Ga0496114_0235007 | 3300048917 | Bacteria | 1611 |
| 673 | Ga0496114_0305032 | 3300048917 | Bacteria | 1406 |
| 674 | Ga0496114_0361785 | 3300048917 | Bacteria | 1283 |
| 675 | Ga0496114_0525387 | 3300048917 | Bacteria | 1046 |
| 676 | Ga0496115_0020493 | 3300048918 | Bacteria | 5102 |
| 677 | Ga0496115_0074122 | 3300048918 | Bacteria | 2764 |
| 678 | Ga0496115_0106122 | 3300048918 | Bacteria | 2306 |
| 679 | Ga0496115_0119435 | 3300048918 | Bacteria | 2168 |
| 680 | Ga0496115_0200633 | 3300048918 | Bacteria | 1648 |
| 681 | Ga0496115_0237667 | 3300048918 | Bacteria | 1502 |
| 682 | Ga0496115_0380123 | 3300048918 | Bacteria | 1149 |
| 683 | Ga0496115_0571147 | 3300048918 | Bacteria | 902 |
| 684 | Ga0501031_0021589 | 3300049568 | Bacteria | 4197 |
| 685 | Ga0501033_0103606 | 3300049570 | Bacteria | 2075 |
| 686 | Ga0501036_0040167 | 3300049572 | Bacteria | 3957 |
| 687 | Ga0501037_0058688 | 3300049573 | Bacteria | 2807 |
| 688 | Ga0501038_0048449 | 3300049574 | Bacteria | 3677 |
| 689 | Ga0501039_0029710 | 3300049575 | Bacteria | 4210 |
| 690 | Ga0501040_0037156 | 3300049576 | Bacteria | 3307 |
| 691 | Ga0501041_0009731 | 3300049577 | Bacteria | 5663 |
| 692 | Ga0501041_0623598 | 3300049577 | Bacteria | 689 |
| 693 | Ga0501041_0980339 | 3300049577 | Unclassified | 544 |
| 694 | Ga0501042_0053702 | 3300049578 | Bacteria | 2874 |
| 695 | Ga0501042_0378446 | 3300049578 | Bacteria | 1025 |
| 696 | Ga0501042_0812148 | 3300049578 | Bacteria | 681 |
| 697 | Ga0501043_0174133 | 3300049579 | Bacteria | 1678 |
| 698 | Ga0501043_0371437 | 3300049579 | Archaea | 1084 |
| 699 | Ga0501046_0021277 | 3300049580 | Bacteria | 5354 |
| 700 | Ga0501047_0069875 | 3300049581 | Bacteria | 3381 |
| 701 | Ga0501048_0068705 | 3300049582 | Bacteria | 2502 |
| 702 | Ga0501067_0021917 | 3300049583 | Bacteria | 3535 |
| 703 | Ga0501068_0063887 | 3300049584 | Bacteria | 2239 |
| 704 | Ga0501068_0670574 | 3300049584 | Bacteria | 677 |
| 705 | Ga0501069_0001355 | 3300049585 | Bacteria | 12016 |
| 706 | Ga0501069_0047017 | 3300049585 | Bacteria | 2395 |
| 707 | Ga0501069_0051949 | 3300049585 | Bacteria | 2282 |
| 708 | Ga0501069_0143340 | 3300049585 | Bacteria | 1371 |
| 709 | Ga0501069_0252557 | 3300049585 | Bacteria | 1029 |
| 710 | Ga0501070_0004258 | 3300049586 | Bacteria | 12303 |
| 711 | Ga0501070_0019087 | 3300049586 | Bacteria | 5752 |
| 712 | Ga0501070_0061955 | 3300049586 | Bacteria | 3099 |
| 713 | Ga0501070_0086706 | 3300049586 | Bacteria | 2591 |
| 714 | Ga0501070_0193311 | 3300049586 | Bacteria | 1672 |
| 715 | Ga0501070_0230010 | 3300049586 | Bacteria | 1519 |
| 716 | Ga0501070_0235285 | 3300049586 | Bacteria | 1500 |
| 717 | Ga0501070_0328254 | 3300049586 | Bacteria | 1244 |
| 718 | Ga0501071_0015104 | 3300049587 | Bacteria | 5295 |
| 719 | Ga0501072_0019787 | 3300049588 | Bacteria | 5208 |
| 720 | Ga0501072_0254605 | 3300049588 | Bacteria | 1398 |
| 721 | Ga0501072_0800845 | 3300049588 | Bacteria | 738 |
| 722 | Ga0501073_0170412 | 3300049589 | Archaea | 1507 |
| 723 | Ga0501073_0453123 | 3300049589 | Bacteria | 887 |
| 724 | Ga0501074_0063483 | 3300049590 | Bacteria | 2660 |
| 725 | Ga0501074_1334355 | 3300049590 | Bacteria | 502 |
| 726 | Ga0501075_0101529 | 3300049591 | Bacteria | 2185 |
| 727 | Ga0501075_0204398 | 3300049591 | Unclassified | 1506 |
| 728 | Ga0501076_0018419 | 3300049592 | Bacteria | 5323 |
| 729 | Ga0501076_0916219 | 3300049592 | Bacteria | 723 |
| 730 | Ga0501077_0004974 | 3300049593 | Bacteria | 8062 |
| 731 | Ga0501077_0123461 | 3300049593 | Bacteria | 1641 |
| 732 | Ga0501077_0689862 | 3300049593 | Bacteria | 656 |
| 733 | Ga0501079_0010527 | 3300049741 | Bacteria | 7031 |
| 734 | Ga0501079_0081206 | 3300049741 | Bacteria | 2507 |
| 735 | Ga0501079_0735104 | 3300049741 | Bacteria | 777 |
| 736 | Ga0501080_0027257 | 3300049742 | Bacteria | 5314 |
| 737 | Ga0501080_0066551 | 3300049742 | Bacteria | 3351 |
| 738 | Ga0501080_0243711 | 3300049742 | Bacteria | 1640 |
| 739 | Ga0501081_0010239 | 3300049743 | Bacteria | 6121 |
| 740 | Ga0501081_0014289 | 3300049743 | Bacteria | 5233 |
| 741 | Ga0501081_0302379 | 3300049743 | Bacteria | 1174 |
| 742 | Ga0501081_0733689 | 3300049743 | Bacteria | 742 |
| 743 | Ga0501083_0500581 | 3300049744 | Bacteria | 791 |
| 744 | Ga0501083_0695841 | 3300049744 | Bacteria | 661 |
| 745 | Ga0501035_0139295 | 3300049822 | Bacteria | 2110 |
| 746 | Ga0501035_0257854 | 3300049822 | Bacteria | 1479 |
| 747 | Ga0501035_0821963 | 3300049822 | Bacteria | 741 |
| 748 | Ga0501035_0932398 | 3300049822 | Bacteria | 686 |
| 749 | Ga0501044_0933168 | 3300049823 | Bacteria | 742 |
| 750 | Ga0501045_0104600 | 3300049824 | Archaea | 2097 |
| 751 | nmdc:mga00v17_343406_c1 | 3300050491 | Bacteria | 970 |
| 752 | nmdc:mga0yw44_421175_c1 | 3300050492 | Bacteria | 904 |
| 753 | nmdc:mga05p37_154299_c1 | 3300050507 | Bacteria | 2807 |
| 754 | nmdc:mga05p37_213592_c1 | 3300050507 | Bacteria | 2331 |
| 755 | nmdc:mga0n895_161297_c1 | 3300050512 | Bacteria | 2274 |
| 756 | nmdc:mga0n895_168320_c1 | 3300050512 | Bacteria | 2223 |
| 757 | nmdc:mga0n895_290946_c1 | 3300050512 | Bacteria | 1656 |
| 758 | nmdc:mga0n895_874738_c1 | 3300050512 | Bacteria | 885 |
| 759 | nmdc:mga08x19_282530_c1 | 3300050514 | Bacteria | 1150 |
| 760 | nmdc:mga0a205_110120_c1 | 3300050515 | Bacteria | 2652 |
| 761 | nmdc:mga0a205_39099_c1 | 3300050515 | Bacteria | 4565 |
| 762 | Ga0495601_0106695 | 3300053077 | Bacteria | 1812 |
| 763 | Ga0495601_0131024 | 3300053077 | Bacteria | 1633 |
| 764 | Ga0495601_0512375 | 3300053077 | Bacteria | 773 |
| 765 | Ga0495612_0022965 | 3300053078 | Bacteria | 2501 |
| 766 | Ga0495612_0041430 | 3300053078 | Bacteria | 1878 |
| 767 | Ga0495612_0110441 | 3300053078 | Bacteria | 1176 |
| 768 | Ga0495595_0035128 | 3300053084 | Bacteria | 2270 |
| 769 | Ga0495595_0133831 | 3300053084 | Bacteria | 1213 |
| 770 | Ga0495595_0186579 | 3300053084 | Unclassified | 1030 |
| 771 | Ga0495595_0227784 | 3300053084 | Bacteria | 931 |
| 772 | Ga0495619_0002131 | 3300053085 | Bacteria | 13124 |
| 773 | Ga0495619_0004992 | 3300053085 | Bacteria | 8428 |
| 774 | Ga0495619_0083680 | 3300053085 | Bacteria | 2152 |
| 775 | Ga0495619_0281272 | 3300053085 | Bacteria | 1153 |
| 776 | Ga0501084_0019487 | 3300054114 | Bacteria | 5653 |
| 777 | Ga0501084_0024112 | 3300054114 | Bacteria | 5074 |
| 778 | Ga0501082_0012526 | 3300060353 | Bacteria | 7286 |
| 779 | Ga0501082_0024778 | 3300060353 | Bacteria | 5172 |
| 780 | Ga0466962_0004592 | 3300061719 | Bacteria | 6624 |
| 781 | Ga0466962_0029507 | 3300061719 | Bacteria | 2626 |
| 782 | Ga0466962_0136430 | 3300061719 | Bacteria | 1187 |
| 783 | Ga0466962_0279427 | 3300061719 | Bacteria | 824 |
| 784 | Ga0466962_0590182 | 3300061719 | Bacteria | 566 |
| 785 | Ga0530510_0022359 | 3300061734 | Bacteria | 4504 |
| 786 | Ga0530510_0024732 | 3300061734 | Bacteria | 4289 |
| 787 | Ga0530510_0066006 | 3300061734 | Bacteria | 2623 |
| 788 | Ga0530510_0181331 | 3300061734 | Bacteria | 1562 |
| 789 | Ga0530510_0996379 | 3300061734 | Unclassified | 641 |
| 790 | Ga0451853_2477707 | |||
| 791 | Ga0070658_10297627 | |||
| 792 | Ga0070658_11539116 | |||
| 793 | Ga0070658_11744009 | |||
| 794 | Ga0070683_100022473 | |||
| 795 | Ga0070683_100242695 | |||
| 796 | Ga0070683_100984344 | |||
| 797 | Ga0070680_100098219 | |||
| 798 | Ga0070680_100310611 | |||
| 799 | Ga0070680_100351774 | |||
| 800 | Ga0070680_100592359 | |||
| 801 | Ga0070682_100463393 | |||
| 802 | Ga0070682_100540571 | |||
| 803 | Ga0068868_100207268 | |||
| 804 | Ga0068868_102227841 | |||
| 805 | Ga0070660_100001563 | |||
| 806 | Ga0070660_100014598 | |||
| 807 | Ga0070660_100122754 | |||
| 808 | Ga0070660_100132660 | |||
| 809 | Ga0070660_100254577 | |||
| 810 | Ga0070660_100359697 | |||
| 811 | Ga0070660_100684568 | |||
| 812 | Ga0070661_100042521 | |||
| 813 | Ga0070661_100206345 | |||
| 814 | Ga0070661_100295638 | |||
| 815 | Ga0070661_100425663 | |||
| 816 | Ga0070661_100434384 | |||
| 817 | Ga0070674_100336369 | |||
| 818 | Ga0070659_100019410 | |||
| 819 | Ga0070659_100293702 | |||
| 820 | Ga0070659_100536331 | |||
| 821 | Ga0070709_10206892 | |||
| 822 | Ga0070714_100398938 | |||
| 823 | Ga0070714_100598460 | |||
| 824 | Ga0070714_100801835 | |||
| 825 | Ga0070714_100863759 | |||
| 826 | Ga0070714_101543006 | |||
| 827 | Ga0070713_100010445 | |||
| 828 | Ga0070713_100250283 | |||
| 829 | Ga0070713_100268019 | |||
| 830 | Ga0070713_100280070 | |||
| 831 | Ga0070713_100688237 | |||
| 832 | Ga0070713_100721030 | |||
| 833 | Ga0070710_10490985 | |||
| 834 | Ga0070700_101554377 | |||
| 835 | Ga0070708_101475342 | |||
| 836 | Ga0070678_100305726 | |||
| 837 | Ga0070662_100845822 | |||
| 838 | Ga0070681_10006856 | |||
| 839 | Ga0070681_10053018 | |||
| 840 | Ga0070681_10076791 | |||
| 841 | Ga0070681_10141621 | |||
| 842 | Ga0070681_10279660 | |||
| 843 | Ga0070681_10569448 | |||
| 844 | Ga0070681_10610813 | |||
| 845 | Ga0070681_10816871 | |||
| 846 | Ga0070681_11021840 | |||
| 847 | Ga0070685_10641475 | |||
| 848 | Ga0070706_100017050 | |||
| 849 | Ga0070706_101100065 | |||
| 850 | Ga0070707_100001665 | |||
| 851 | Ga0070707_100006647 | |||
| 852 | Ga0070707_100101818 | |||
| 853 | Ga0070698_100291060 | |||
| 854 | Ga0070699_100050482 | |||
| 855 | Ga0070679_100003508 | |||
| 856 | Ga0070679_100015519 | |||
| 857 | Ga0070679_100068761 | |||
| 858 | Ga0070679_100074134 | |||
| 859 | Ga0070679_100091236 | |||
| 860 | Ga0070679_100311297 | |||
| 861 | Ga0070679_100362081 | |||
| 862 | Ga0070679_100457389 | |||
| 863 | Ga0070679_100672635 | |||
| 864 | Ga0070679_101045870 | |||
| 865 | Ga0070684_100021794 | |||
| 866 | Ga0070684_100105020 | |||
| 867 | Ga0070684_100152126 | |||
| 868 | Ga0070684_100397980 | |||
| 869 | Ga0070697_100481746 | |||
| 870 | Ga0070697_100746823 | |||
| 871 | Ga0070697_101164896 | |||
| 872 | Ga0068853_100069038 | |||
| 873 | Ga0068853_100201476 | |||
| 874 | Ga0068853_100602946 | |||
| 875 | Ga0068853_101285537 | |||
| 876 | Ga0070665_100053200 | |||
| 877 | Ga0068855_100028984 | |||
| 878 | Ga0068855_100086021 | |||
| 879 | Ga0068855_100114356 | |||
| 880 | Ga0068855_100295912 | |||
| 881 | Ga0068855_100375238 | |||
| 882 | Ga0068855_100553823 | |||
| 883 | Ga0068855_100718278 | |||
| 884 | Ga0070664_100249298 | |||
| 885 | Ga0070664_101521673 | |||
| 886 | Ga0068857_100298956 | |||
| 887 | Ga0068857_100731573 | |||
| 888 | Ga0068857_101652661 | |||
| 889 | Ga0068856_100105286 | |||
| 890 | Ga0068856_100368364 | |||
| 891 | Ga0068856_100637773 | |||
| 892 | Ga0068856_101222339 | |||
| 893 | Ga0068852_100032182 | |||
| 894 | Ga0068852_100827841 | |||
| 895 | Ga0068852_100989682 | |||
| 896 | Ga0068852_101276563 | |||
| 897 | Ga0068861_101240069 | |||
| 898 | Ga0068858_100941662 | |||
| 899 | Ga0081455_10037042 | |||
| 900 | Ga0081539_10003715 | |||
| 901 | Ga0070717_10062788 | |||
| 902 | Ga0070717_10499693 | |||
| 903 | Ga0070717_10787000 | |||
| 904 | Ga0070717_11238554 | |||
| 905 | Ga0070717_11373737 | |||
| 906 | Ga0075365_10651116 | |||
| 907 | Ga0070715_10163896 | |||
| 908 | Ga0070716_100654966 | |||
| 909 | Ga0097621_100927612 | |||
| 910 | Ga0075433_10027992 | |||
| 911 | Ga0075433_10105522 | |||
| 912 | Ga0075434_100053016 | |||
| 913 | Ga0075434_100306901 | |||
| 914 | Ga0068865_100670812 | |||
| 915 | Ga0105240_10016409 | |||
| 916 | Ga0105240_10039954 | |||
| 917 | Ga0105240_10065328 | |||
| 918 | Ga0105240_10301138 | |||
| 919 | Ga0105240_10366328 | |||
| 920 | Ga0111539_10932179 | |||
| 921 | Ga0105245_10457419 | |||
| 922 | Ga0105245_10774638 | |||
| 923 | Ga0114129_10400667 | |||
| 924 | Ga0105243_10487009 | |||
| 925 | Ga0105243_11241542 | |||
| 926 | Ga0105243_11717408 | |||
| 927 | Ga0105241_10072352 | |||
| 928 | Ga0105241_10602099 | |||
| 929 | Ga0105242_10180013 | |||
| 930 | Ga0105248_11730582 | |||
| 931 | Ga0105237_10161314 | |||
| 932 | Ga0105237_10369831 | |||
| 933 | Ga0105238_10038048 | |||
| 934 | Ga0105238_10308563 | |||
| 935 | Ga0105238_10693693 | |||
| 936 | Ga0105239_11109036 | |||
| 937 | Ga0157373_10291678 | |||
| 938 | Ga0157371_10488453 | |||
| 939 | Ga0157370_10009810 | |||
| 940 | Ga0157370_10014464 | |||
| 941 | Ga0157370_10096394 | |||
| 942 | Ga0157370_10533748 | |||
| 943 | Ga0157369_10001071 | |||
| 944 | Ga0157369_10016070 | |||
| 945 | Ga0157369_10020561 | |||
| 946 | Ga0157369_10335394 | |||
| 947 | Ga0157369_10439785 | |||
| 948 | Ga0157369_10475513 | |||
| 949 | Ga0157369_11028817 | |||
| 950 | Ga0157369_11966829 | |||
| 951 | Ga0157369_11999771 | |||
| 952 | Ga0157369_12088788 | |||
| 953 | Ga0157374_10060063 | |||
| 954 | Ga0157374_11137416 | |||
| 955 | Ga0157374_11284492 | |||
| 956 | Ga0157372_10052796 | |||
| 957 | Ga0157372_10178808 | |||
| 958 | Ga0157372_10334115 | |||
| 959 | Ga0157372_11035183 | |||
| 960 | Ga0157375_11136478 | |||
| 961 | Ga0157375_11939025 | |||
| 962 | Ga0182008_10032238 | |||
| 963 | Ga0157377_10097013 | |||
| 964 | Ga0157379_10989473 | |||
| 965 | Ga0157376_10359766 | |||
| 966 | Ga0197907_11105880 | |||
| 967 | Ga0197907_11227914 | |||
| 968 | Ga0206356_10193339 | |||
| 969 | Ga0206356_10930650 | |||
| 970 | Ga0206354_10305434 | |||
| 971 | Ga0206354_11045300 | |||
| 972 | Ga0206354_11164945 | |||
| 973 | Ga0206353_10000463 | |||
| 974 | Ga0206353_10049000 | |||
| 975 | Ga0206353_10527348 | |||
| 976 | Ga0206353_10931732 | |||
| 977 | Ga0206353_10973097 | |||
| 978 | Ga0206353_11000335 | |||
| 979 | Ga0206353_11609747 | |||
| 980 | Ga0207656_10069209 | |||
| 981 | Ga0207647_10520589 | |||
| 982 | Ga0207705_10130780 | |||
| 983 | Ga0207705_10158889 | |||
| 984 | Ga0207705_10160591 | |||
| 985 | Ga0207705_10214652 | |||
| 986 | Ga0207705_10652648 | |||
| 987 | Ga0207705_10686594 | |||
| 988 | Ga0207705_10939050 | |||
| 989 | Ga0207705_11511273 | |||
| 990 | Ga0207684_10081036 | |||
| 991 | Ga0207654_10302984 | |||
| 992 | Ga0207654_11013570 | |||
| 993 | Ga0207707_10023981 | |||
| 994 | Ga0207707_10036910 | |||
| 995 | Ga0207707_10078664 | |||
| 996 | Ga0207707_10110325 | |||
| 997 | Ga0207707_10396455 | |||
| 998 | Ga0207707_10498039 | |||
| 999 | Ga0207707_10745347 | |||
| 1000 | Ga0207707_10983596 | |||
| 1001 | Ga0207707_11202671 | |||
| 1002 | Ga0207695_10152370 | |||
| 1003 | Ga0207695_10425550 | |||
| 1004 | Ga0207695_10519743 | |||
| 1005 | Ga0207695_10898103 | |||
| 1006 | Ga0207671_10148356 | |||
| 1007 | Ga0207671_10232402 | |||
| 1008 | Ga0207671_10559414 | |||
| 1009 | Ga0207693_10167727 | |||
| 1010 | Ga0207663_10045812 | |||
| 1011 | Ga0207663_10668296 | |||
| 1012 | Ga0207663_10881054 | |||
| 1013 | Ga0207660_10032553 | |||
| 1014 | Ga0207660_10273555 | |||
| 1015 | Ga0207660_10389440 | |||
| 1016 | Ga0207660_10930209 | |||
| 1017 | Ga0207657_10000220 | |||
| 1018 | Ga0207657_10001478 | |||
| 1019 | Ga0207657_10002441 | |||
| 1020 | Ga0207657_10014169 | |||
| 1021 | Ga0207657_10166873 | |||
| 1022 | Ga0207657_10318909 | |||
| 1023 | Ga0207657_10574718 | |||
| 1024 | Ga0207649_10065276 | |||
| 1025 | Ga0207649_10113235 | |||
| 1026 | Ga0207649_10332815 | |||
| 1027 | Ga0207649_10950654 | |||
| 1028 | Ga0207649_11080166 | |||
| 1029 | Ga0207652_10033280 | |||
| 1030 | Ga0207652_10080977 | |||
| 1031 | Ga0207652_10204633 | |||
| 1032 | Ga0207652_10210834 | |||
| 1033 | Ga0207652_10363939 | |||
| 1034 | Ga0207652_10458032 | |||
| 1035 | Ga0207652_10480013 | |||
| 1036 | Ga0207652_10830295 | |||
| 1037 | Ga0207646_10012253 | |||
| 1038 | Ga0207646_10039425 | |||
| 1039 | Ga0207646_10367987 | |||
| 1040 | Ga0207646_10738673 | |||
| 1041 | Ga0207646_10740298 | |||
| 1042 | Ga0207646_11117184 | |||
| 1043 | Ga0207646_11206096 | |||
| 1044 | Ga0207687_10851795 | |||
| 1045 | Ga0207687_11634380 | |||
| 1046 | Ga0207700_10261689 | |||
| 1047 | Ga0207700_10263505 | |||
| 1048 | Ga0207700_10453635 | |||
| 1049 | Ga0207664_10320467 | |||
| 1050 | Ga0207664_10438796 | |||
| 1051 | Ga0207664_10650324 | |||
| 1052 | Ga0207664_10753456 | |||
| 1053 | Ga0207664_11090259 | |||
| 1054 | Ga0207690_10045701 | |||
| 1055 | Ga0207690_10700491 | |||
| 1056 | Ga0207706_10696237 | |||
| 1057 | Ga0207686_10067130 | |||
| 1058 | Ga0207665_10367794 | |||
| 1059 | Ga0207665_10639807 | |||
| 1060 | Ga0207661_10053233 | |||
| 1061 | Ga0207661_10114694 | |||
| 1062 | Ga0207661_10224795 | |||
| 1063 | Ga0207661_10251466 | |||
| 1064 | Ga0207661_10341871 | |||
| 1065 | Ga0207679_10628209 | |||
| 1066 | Ga0207679_11040583 | |||
| 1067 | Ga0207679_11089395 | |||
| 1068 | Ga0207667_10049918 | |||
| 1069 | Ga0207667_10216073 | |||
| 1070 | Ga0207667_10312419 | |||
| 1071 | Ga0207667_10549967 | |||
| 1072 | Ga0207667_10719894 | |||
| 1073 | Ga0207667_10735936 | |||
| 1074 | Ga0207651_11258648 | |||
| 1075 | Ga0207658_10068216 | |||
| 1076 | Ga0207677_10067514 | |||
| 1077 | Ga0207677_10146104 | |||
| 1078 | Ga0207677_11530180 | |||
| 1079 | Ga0207703_10435840 | |||
| 1080 | Ga0207639_10407372 | |||
| 1081 | Ga0207639_10541782 | |||
| 1082 | Ga0207639_10846265 | |||
| 1083 | Ga0207639_11078545 | |||
| 1084 | Ga0207678_10327284 | |||
| 1085 | Ga0207678_10553304 | |||
| 1086 | Ga0207708_10322855 | |||
| 1087 | Ga0207708_10377468 | |||
| 1088 | Ga0207702_10715460 | |||
| 1089 | Ga0207702_10799348 | |||
| 1090 | Ga0207702_10881688 | |||
| 1091 | Ga0207648_11297177 | |||
| 1092 | Ga0207674_10302412 | |||
| 1093 | Ga0207674_10306046 | |||
| 1094 | Ga0207674_10620217 | |||
| 1095 | Ga0207674_11404506 | |||
| 1096 | Ga0207675_101166318 | |||
| 1097 | Ga0207683_10318746 | |||
| 1098 | Ga0207683_11432704 | |||
| 1099 | Ga0207683_11838775 | |||
| 1100 | Ga0207698_10068622 | |||
| 1101 | Ga0207698_10133039 | |||
| 1102 | Ga0207698_10183190 | |||
| 1103 | Ga0207698_11537840 | |||
| 1104 | Ga0207698_12353404 | |||
| 1105 | Ga0265337_1191827 | |||
| 1106 | Ga0265334_10241825 | |||
| 1107 | Ga0265318_10065389 | |||
| 1108 | Ga0265338_10091901 | |||
| 1109 | Ga0265320_10029612 | |||
| 1110 | Ga0265340_10046139 | |||
| 1111 | Ga0265327_10032369 | |||
| 1112 | Ga0265327_10067598 | |||
| 1113 | Ga0265327_10118298 | |||
| 1114 | Ga0307408_100060606 | |||
| 1115 | Ga0265313_10324886 | |||
| 1116 | Ga0307405_10074418 | |||
| 1117 | Ga0307409_100252630 | |||
| 1118 | Ga0307416_100024326 | |||
| 1119 | Ga0373926_0032329 | |||
| 1120 | Ga0373944_0001935 | |||
| 1121 | Ga0373944_0067965 | |||
| 1122 | Ga0373923_0121925 | |||
| 1123 | Ga0373945_0009874 | |||
| 1124 | Ga0373945_0014644 | |||
| 1125 | Ga0373953_0147648 | |||
| 1126 | Ga0373954_0386497 | |||
| 1127 | Ga0373956_0139111 | |||
| 1128 | Ga0373957_0161422 | |||
| 1129 | Ga0373960_0086528 | |||
| 1130 | Ga0373943_0001066 | |||
| 1131 | Ga0373943_0013614 | |||
| 1132 | Ga0373943_0023582 | |||
| 1133 | Ga0373946_0001825 | |||
| 1134 | Ga0373935_0041286 | |||
| 1135 | Ga0373935_0053773 | |||
| 1136 | Ga0373927_0037309 | |||
| 1137 | Ga0373927_0090601 | |||
| 1138 | Ga0373933_0010494 | |||
| 1139 | Ga0373947_0001921 | |||
| 1140 | Ga0373947_0002906 | |||
| 1141 | Ga0373947_0039053 | |||
| 1142 | Ga0373937_0695097 | |||
| 1143 | Ga0373925_0002713 | |||
| 1144 | Ga0373925_0004151 | |||
| 1145 | Ga0373925_0062082 | |||
| 1146 | Ga0395899_0035839 | |||
| 1147 | Ga0395899_0070373 | |||
| 1148 | Ga0395899_0127530 | |||
| 1149 | Ga0395899_0250122 | |||
| 1150 | Ga0395899_0504198 | |||
| 1151 | Ga0395900_0005127 | |||
| 1152 | Ga0395900_0047010 | |||
| 1153 | Ga0395900_0061715 | |||
| 1154 | Ga0395900_0074383 | |||
| 1155 | Ga0395900_0109191 | |||
| 1156 | Ga0395900_0160286 | |||
| 1157 | Ga0395900_0324311 | |||
| 1158 | Ga0395900_1048412 | |||
| 1159 | Ga0395900_1060316 | |||
| 1160 | Ga0395898_0005749 | |||
| 1161 | Ga0395898_0020761 | |||
| 1162 | Ga0395898_0029723 | |||
| 1163 | Ga0395898_0127157 | |||
| 1164 | Ga0395898_0281840 | |||
| 1165 | Ga0395898_0301356 | |||
| 1166 | Ga0395898_0517134 | |||
| 1167 | Ga0395898_1400336 | |||
| 1168 | Ga0395905_0009643 | |||
| 1169 | Ga0395905_0076069 | |||
| 1170 | Ga0395905_0081770 | |||
| 1171 | Ga0395905_0281511 | |||
| 1172 | Ga0395905_0512612 | |||
| 1173 | Ga0395905_0758924 | |||
| 1174 | Ga0395905_1146901 | |||
| 1175 | Ga0436364_0948865 | |||
| 1176 | Ga0395901_0032994 | |||
| 1177 | Ga0395901_0044500 | |||
| 1178 | Ga0395901_0049065 | |||
| 1179 | Ga0395901_0064432 | |||
| 1180 | Ga0395901_0109775 | |||
| 1181 | Ga0395901_0191907 | |||
| 1182 | Ga0395901_0213862 | |||
| 1183 | Ga0395901_0226100 | |||
| 1184 | Ga0395901_1400939 | |||
| 1185 | Ga0436365_0147594 | |||
| 1186 | Ga0436365_0677001 | |||
| 1187 | Ga0436365_1160885 | |||
| 1188 | Ga0436365_1307848 | |||
| 1189 | Ga0436363_0247609 | |||
| 1190 | Ga0436363_0854260 | |||
| 1191 | Ga0439438_019009 | |||
| 1192 | Ga0439466_0140567 | |||
| 1193 | Ga0451804_0706969 | |||
| 1194 | Ga0439448_0102477 | |||
| 1195 | Ga0439448_0238141 | |||
| 1196 | Ga0439451_025585 | |||
| 1197 | Ga0450920_044314 | |||
| 1198 | Ga0439446_0015880 | |||
| 1199 | Ga0450918_088542 | |||
| 1200 | Ga0466969_0278869 | |||
| 1201 | Ga0466965_0195583 | |||
| 1202 | Ga0466966_0004226 | |||
| 1203 | Ga0466966_0020777 | |||
| 1204 | Ga0466966_0592655 | |||
| 1205 | Ga0466961_0011243 | |||
| 1206 | Ga0466961_0179202 | |||
| 1207 | Ga0466961_0335041 | |||
| 1208 | Ga0466963_0004592 | |||
| 1209 | Ga0466963_0008879 | |||
| 1210 | Ga0466963_0011662 | |||
| 1211 | Ga0466963_0028128 | |||
| 1212 | Ga0466963_0223067 | |||
| 1213 | Ga0466963_1194122 | |||
| 1214 | Ga0466964_0018618 | |||
| 1215 | Ga0466964_0036651 | |||
| 1216 | Ga0466964_0653907 | |||
| 1217 | Ga0466971_0000979 | |||
| 1218 | Ga0466971_0070413 | |||
| 1219 | Ga0466971_0439354 | |||
| 1220 | Ga0466968_0007673 | |||
| 1221 | Ga0466968_0026526 | |||
| 1222 | Ga0466970_0064399 | |||
| 1223 | Ga0466970_0237507 | |||
| 1224 | Ga0466957_0005709 | |||
| 1225 | Ga0466957_0039713 | |||
| 1226 | Ga0466957_0079213 | |||
| 1227 | Ga0466957_0486060 | |||
| 1228 | Ga0466957_0719865 | |||
| 1229 | Ga0466960_0292621 | |||
| 1230 | Ga0466959_0015296 | |||
| 1231 | Ga0466959_0051023 | |||
| 1232 | Ga0466959_0285589 | |||
| 1233 | Ga0466959_0324836 | |||
| 1234 | Ga0466958_0004045 | |||
| 1235 | Ga0466958_0006549 | |||
| 1236 | Ga0466958_0121303 | |||
| 1237 | Ga0466958_0183473 | |||
| 1238 | Ga0466958_0225307 | |||
| 1239 | Ga0466958_0474200 | |||
| 1240 | Ga0466967_0005201 | |||
| 1241 | Ga0466967_0023128 | |||
| 1242 | Ga0466967_0046393 | |||
| 1243 | Ga0466967_0052795 | |||
| 1244 | Ga0466967_0091166 | |||
| 1245 | Ga0466967_0157754 | |||
| 1246 | Ga0466967_0200982 | |||
| 1247 | Ga0466967_0332884 | |||
| 1248 | Ga0466967_0333058 | |||
| 1249 | Ga0466967_0657931 | |||
| 1250 | Ga0466967_1408241 | |||
| 1251 | Ga0495592_0199930 | |||
| 1252 | Ga0495592_0229783 | |||
| 1253 | Ga0495592_0573014 | |||
| 1254 | Ga0495603_0123652 | |||
| 1255 | Ga0495629_0000665 | |||
| 1256 | Ga0495629_0133291 | |||
| 1257 | Ga0495641_0163602 | |||
| 1258 | Ga0495641_0260361 | |||
| 1259 | Ga0495641_0478563 | |||
| 1260 | Ga0495651_0031780 | |||
| 1261 | Ga0495651_0064363 | |||
| 1262 | Ga0495651_0227349 | |||
| 1263 | Ga0495651_0270840 | |||
| 1264 | Ga0495651_0387159 | |||
| 1265 | Ga0495653_0030994 | |||
| 1266 | Ga0495653_0054198 | |||
| 1267 | Ga0495653_0337489 | |||
| 1268 | Ga0495653_0700205 | |||
| 1269 | Ga0495582_0000703 | |||
| 1270 | Ga0495582_0110820 | |||
| 1271 | Ga0495582_0411262 | |||
| 1272 | Ga0495582_0572041 | |||
| 1273 | Ga0495639_0001381 | |||
| 1274 | Ga0495662_0000116 | |||
| 1275 | Ga0495664_0109866 | |||
| 1276 | Ga0495664_0515772 | |||
| 1277 | Ga0495608_0036271 | |||
| 1278 | Ga0495608_0043568 | |||
| 1279 | Ga0495608_0044126 | |||
| 1280 | Ga0495608_0084644 | |||
| 1281 | Ga0495608_0119594 | |||
| 1282 | Ga0495608_0544989 | |||
| 1283 | Ga0495618_0227326 | |||
| 1284 | Ga0495618_0324003 | |||
| 1285 | Ga0495618_0394081 | |||
| 1286 | Ga0495628_0081706 | |||
| 1287 | Ga0495628_0095359 | |||
| 1288 | Ga0495628_0110904 | |||
| 1289 | Ga0495628_0280561 | |||
| 1290 | Ga0495628_0338460 | |||
| 1291 | Ga0495630_0003948 | |||
| 1292 | Ga0495630_0004843 | |||
| 1293 | Ga0495630_0030306 | |||
| 1294 | Ga0495630_0068361 | |||
| 1295 | Ga0495630_0084859 | |||
| 1296 | Ga0495630_0125587 | |||
| 1297 | Ga0495630_0180537 | |||
| 1298 | Ga0495630_0458420 | |||
| 1299 | Ga0495666_0007368 | |||
| 1300 | Ga0495652_0046438 | |||
| 1301 | Ga0495652_0123489 | |||
| 1302 | Ga0495652_0147845 | |||
| 1303 | Ga0495652_0180161 | |||
| 1304 | Ga0495665_0000801 | |||
| 1305 | Ga0495665_0084160 | |||
| 1306 | Ga0495640_0007990 | |||
| 1307 | Ga0495640_0023288 | |||
| 1308 | Ga0495640_0040320 | |||
| 1309 | Ga0495640_0067577 | |||
| 1310 | Ga0495640_0434557 | |||
| 1311 | Ga0495586_0019496 | |||
| 1312 | Ga0495586_0068786 | |||
| 1313 | Ga0495586_0231314 | |||
| 1314 | Ga0495587_0059611 | |||
| 1315 | Ga0495587_0277597 | |||
| 1316 | Ga0495645_0123487 | |||
| 1317 | Ga0495645_0131190 | |||
| 1318 | Ga0495645_0161069 | |||
| 1319 | Ga0495645_0263760 | |||
| 1320 | Ga0495645_0661290 | |||
| 1321 | Ga0495667_0009317 | |||
| 1322 | Ga0495667_0043012 | |||
| 1323 | Ga0495667_0050580 | |||
| 1324 | Ga0495667_0105977 | |||
| 1325 | Ga0495667_0544875 | |||
| 1326 | Ga0495667_0557236 | |||
| 1327 | Ga0495667_0925915 | |||
| 1328 | Ga0495656_0055459 | |||
| 1329 | Ga0495634_0224360 | |||
| 1330 | Ga0495634_0433691 | |||
| 1331 | Ga0495635_0012743 | |||
| 1332 | Ga0495635_0053742 | |||
| 1333 | Ga0495635_0065339 | |||
| 1334 | Ga0495635_0157545 | |||
| 1335 | Ga0495588_0479637 | |||
| 1336 | Ga0495588_0632178 | |||
| 1337 | Ga0495657_0045807 | |||
| 1338 | Ga0495657_0788800 | |||
| 1339 | Ga0495599_0084468 | |||
| 1340 | Ga0495599_0117241 | |||
| 1341 | Ga0495599_0175736 | |||
| 1342 | Ga0495599_0187756 | |||
| 1343 | Ga0495623_0009051 | |||
| 1344 | Ga0495623_0147813 | |||
| 1345 | Ga0495646_0144672 | |||
| 1346 | Ga0495646_0415756 | |||
| 1347 | Ga0495647_0008216 | |||
| 1348 | Ga0495658_0000830 | |||
| 1349 | Ga0495658_0359108 | |||
| 1350 | Ga0495613_0001439 | |||
| 1351 | Ga0495613_0041144 | |||
| 1352 | Ga0495613_0394777 | |||
| 1353 | Ga0495613_1029557 | |||
| 1354 | Ga0495624_0028038 | |||
| 1355 | Ga0495624_0362380 | |||
| 1356 | Ga0495600_0054274 | |||
| 1357 | Ga0495600_0058078 | |||
| 1358 | Ga0495600_0195503 | |||
| 1359 | Ga0495600_0390519 | |||
| 1360 | Ga0495581_0021885 | |||
| 1361 | Ga0495581_0054401 | |||
| 1362 | Ga0495604_0111210 | |||
| 1363 | Ga0495604_0272615 | |||
| 1364 | Ga0495674_0014116 | |||
| 1365 | Ga0495674_0014734 | |||
| 1366 | Ga0495674_0102143 | |||
| 1367 | Ga0495674_0146617 | |||
| 1368 | Ga0495674_0469494 | |||
| 1369 | Ga0495676_0041364 | |||
| 1370 | Ga0495676_0042327 | |||
| 1371 | Ga0495676_0050800 | |||
| 1372 | Ga0495680_0001597 | |||
| 1373 | Ga0495680_0003809 | |||
| 1374 | Ga0495680_0005975 | |||
| 1375 | Ga0495680_0010259 | |||
| 1376 | Ga0495680_0091470 | |||
| 1377 | Ga0495680_0723308 | |||
| 1378 | Ga0495683_0115843 | |||
| 1379 | Ga0495675_0208436 | |||
| 1380 | Ga0495675_0231843 | |||
| 1381 | Ga0495684_0007204 | |||
| 1382 | Ga0495684_0008266 | |||
| 1383 | Ga0495684_0072946 | |||
| 1384 | Ga0495684_0105473 | |||
| 1385 | Ga0495684_0122776 | |||
| 1386 | Ga0495684_0134171 | |||
| 1387 | Ga0495684_0706704 | |||
| 1388 | Ga0495593_0149057 | |||
| 1389 | Ga0495602_0080423 | |||
| 1390 | Ga0495602_0099896 | |||
| 1391 | Ga0495602_0138578 | |||
| 1392 | Ga0495602_0236533 | |||
| 1393 | Ga0495602_0803839 | |||
| 1394 | Ga0495602_0816288 | |||
| 1395 | Ga0495614_0001458 | |||
| 1396 | Ga0495614_0139366 | |||
| 1397 | Ga0495614_0353797 | |||
| 1398 | Ga0496100_0010210 | |||
| 1399 | Ga0496100_0069853 | |||
| 1400 | Ga0496100_0857182 | |||
| 1401 | Ga0496101_0020298 | |||
| 1402 | Ga0496101_0045211 | |||
| 1403 | Ga0496101_0341906 | |||
| 1404 | Ga0496101_0403483 | |||
| 1405 | Ga0496101_1226522 | |||
| 1406 | Ga0496102_0070048 | |||
| 1407 | Ga0496102_0227010 | |||
| 1408 | Ga0496102_0809202 | |||
| 1409 | Ga0496103_0057573 | |||
| 1410 | Ga0496103_0079097 | |||
| 1411 | Ga0496104_0104553 | |||
| 1412 | Ga0496104_0301821 | |||
| 1413 | Ga0496104_0338948 | |||
| 1414 | Ga0496104_0357626 | |||
| 1415 | Ga0496104_1247379 | |||
| 1416 | Ga0496105_0037085 | |||
| 1417 | Ga0496105_0164838 | |||
| 1418 | Ga0496105_0442047 | |||
| 1419 | Ga0496106_0126645 | |||
| 1420 | Ga0496106_0492764 | |||
| 1421 | Ga0496106_0993555 | |||
| 1422 | Ga0496106_1283685 | |||
| 1423 | Ga0496107_0028226 | |||
| 1424 | Ga0496107_0033277 | |||
| 1425 | Ga0496107_0412326 | |||
| 1426 | Ga0496108_0002107 | |||
| 1427 | Ga0496108_0168507 | |||
| 1428 | Ga0496108_1129456 | |||
| 1429 | Ga0496109_0023858 | |||
| 1430 | Ga0496109_0175221 | |||
| 1431 | Ga0496109_0446745 | |||
| 1432 | Ga0496109_0472876 | |||
| 1433 | Ga0496109_0862445 | |||
| 1434 | Ga0496109_1088174 | |||
| 1435 | Ga0496109_1514702 | |||
| 1436 | Ga0496110_0000524 | |||
| 1437 | Ga0496110_0119765 | |||
| 1438 | Ga0496110_0693018 | |||
| 1439 | Ga0496110_0800407 | |||
| 1440 | Ga0496111_0002105 | |||
| 1441 | Ga0496111_0093397 | |||
| 1442 | Ga0496111_0410313 | |||
| 1443 | Ga0496111_0544117 | |||
| 1444 | Ga0496111_0554096 | |||
| 1445 | Ga0496112_0011989 | |||
| 1446 | Ga0496112_0028573 | |||
| 1447 | Ga0496112_0223905 | |||
| 1448 | Ga0496112_0226555 | |||
| 1449 | Ga0496112_0292555 | |||
| 1450 | Ga0496112_0511482 | |||
| 1451 | Ga0496112_0738770 | |||
| 1452 | Ga0496112_1028125 | |||
| 1453 | Ga0496112_1096425 | |||
| 1454 | Ga0496112_1504931 | |||
| 1455 | Ga0496113_0003437 | |||
| 1456 | Ga0496113_0278142 | |||
| 1457 | Ga0496113_1138323 | |||
| 1458 | Ga0496114_0008117 | |||
| 1459 | Ga0496114_0010884 | |||
| 1460 | Ga0496114_0023573 | |||
| 1461 | Ga0496114_0235007 | |||
| 1462 | Ga0496114_0305032 | |||
| 1463 | Ga0496114_0361785 | |||
| 1464 | Ga0496114_0525387 | |||
| 1465 | Ga0496115_0020493 | |||
| 1466 | Ga0496115_0074122 | |||
| 1467 | Ga0496115_0106122 | |||
| 1468 | Ga0496115_0119435 | |||
| 1469 | Ga0496115_0200633 | |||
| 1470 | Ga0496115_0237667 | |||
| 1471 | Ga0496115_0380123 | |||
| 1472 | Ga0496115_0571147 | |||
| 1473 | Ga0501031_0021589 | |||
| 1474 | Ga0501033_0103606 | |||
| 1475 | Ga0501036_0040167 | |||
| 1476 | Ga0501037_0058688 | |||
| 1477 | Ga0501038_0048449 | |||
| 1478 | Ga0501039_0029710 | |||
| 1479 | Ga0501040_0037156 | |||
| 1480 | Ga0501041_0009731 | |||
| 1481 | Ga0501041_0623598 | |||
| 1482 | Ga0501041_0980339 | |||
| 1483 | Ga0501042_0053702 | |||
| 1484 | Ga0501042_0378446 | |||
| 1485 | Ga0501042_0812148 | |||
| 1486 | Ga0501043_0174133 | |||
| 1487 | Ga0501043_0371437 | |||
| 1488 | Ga0501046_0021277 | |||
| 1489 | Ga0501047_0069875 | |||
| 1490 | Ga0501048_0068705 | |||
| 1491 | Ga0501067_0021917 | |||
| 1492 | Ga0501068_0063887 | |||
| 1493 | Ga0501068_0670574 | |||
| 1494 | Ga0501069_0001355 | |||
| 1495 | Ga0501069_0047017 | |||
| 1496 | Ga0501069_0051949 | |||
| 1497 | Ga0501069_0143340 | |||
| 1498 | Ga0501069_0252557 | |||
| 1499 | Ga0501070_0004258 | |||
| 1500 | Ga0501070_0019087 | |||
| 1501 | Ga0501070_0061955 | |||
| 1502 | Ga0501070_0086706 | |||
| 1503 | Ga0501070_0193311 | |||
| 1504 | Ga0501070_0230010 | |||
| 1505 | Ga0501070_0235285 | |||
| 1506 | Ga0501070_0328254 | |||
| 1507 | Ga0501071_0015104 | |||
| 1508 | Ga0501072_0019787 | |||
| 1509 | Ga0501072_0254605 | |||
| 1510 | Ga0501072_0800845 | |||
| 1511 | Ga0501073_0170412 | |||
| 1512 | Ga0501073_0453123 | |||
| 1513 | Ga0501074_0063483 | |||
| 1514 | Ga0501074_1334355 | |||
| 1515 | Ga0501075_0101529 | |||
| 1516 | Ga0501075_0204398 | |||
| 1517 | Ga0501076_0018419 | |||
| 1518 | Ga0501076_0916219 | |||
| 1519 | Ga0501077_0004974 | |||
| 1520 | Ga0501077_0123461 | |||
| 1521 | Ga0501077_0689862 | |||
| 1522 | Ga0501079_0010527 | |||
| 1523 | Ga0501079_0081206 | |||
| 1524 | Ga0501079_0735104 | |||
| 1525 | Ga0501080_0027257 | |||
| 1526 | Ga0501080_0066551 | |||
| 1527 | Ga0501080_0243711 | |||
| 1528 | Ga0501081_0010239 | |||
| 1529 | Ga0501081_0014289 | |||
| 1530 | Ga0501081_0302379 | |||
| 1531 | Ga0501081_0733689 | |||
| 1532 | Ga0501083_0500581 | |||
| 1533 | Ga0501083_0695841 | |||
| 1534 | Ga0501035_0139295 | |||
| 1535 | Ga0501035_0257854 | |||
| 1536 | Ga0501035_0821963 | |||
| 1537 | Ga0501035_0932398 | |||
| 1538 | Ga0501044_0933168 | |||
| 1539 | Ga0501045_0104600 | |||
| 1540 | nmdc:mga00v17_343406_c1 | |||
| 1541 | nmdc:mga0yw44_421175_c1 | |||
| 1542 | nmdc:mga05p37_154299_c1 | |||
| 1543 | nmdc:mga05p37_213592_c1 | |||
| 1544 | nmdc:mga0n895_161297_c1 | |||
| 1545 | nmdc:mga0n895_168320_c1 | |||
| 1546 | nmdc:mga0n895_290946_c1 | |||
| 1547 | nmdc:mga0n895_874738_c1 | |||
| 1548 | nmdc:mga08x19_282530_c1 | |||
| 1549 | nmdc:mga0a205_110120_c1 | |||
| 1550 | nmdc:mga0a205_39099_c1 | |||
| 1551 | Ga0495601_0106695 | |||
| 1552 | Ga0495601_0131024 | |||
| 1553 | Ga0495601_0512375 | |||
| 1554 | Ga0495612_0022965 | |||
| 1555 | Ga0495612_0041430 | |||
| 1556 | Ga0495612_0110441 | |||
| 1557 | Ga0495595_0035128 | |||
| 1558 | Ga0495595_0133831 | |||
| 1559 | Ga0495595_0186579 | |||
| 1560 | Ga0495595_0227784 | |||
| 1561 | Ga0495619_0002131 | |||
| 1562 | Ga0495619_0004992 | |||
| 1563 | Ga0495619_0083680 | |||
| 1564 | Ga0495619_0281272 | |||
| 1565 | Ga0501084_0019487 | |||
| 1566 | Ga0501084_0024112 | |||
| 1567 | Ga0501082_0012526 | |||
| 1568 | Ga0501082_0024778 | |||
| 1569 | Ga0466962_0004592 | |||
| 1570 | Ga0466962_0029507 | |||
| 1571 | Ga0466962_0136430 | |||
| 1572 | Ga0466962_0279427 | |||
| 1573 | Ga0466962_0590182 | |||
| 1574 | Ga0530510_0022359 | |||
| 1575 | Ga0530510_0024732 | |||
| 1576 | Ga0530510_0066006 | |||
| 1577 | Ga0530510_0181331 | |||
| 1578 | Ga0530510_0996379 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p5l-assembly2.cif.gz_H | crystal structure of a dimer of n-terminal domains of ahrc in complex with an 18bp dna operator site | 0.9687 | 2 | 65 |
| 2zfz-assembly1.cif.gz_A | crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine | 0.9566 | 75 | 150 |
| 2p5l-assembly2.cif.gz_H | crystal structure of a dimer of n-terminal domains of ahrc in complex with an 18bp dna operator site | 0.9542 | 2 | 65 |
| 5jvo-assembly1.cif.gz_A | crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis | 0.9429 | 73 | 150 |
| 6wjp-assembly1.cif.gz_A-2 | crystal structure of arginine repressor p115q mutant from the pathogenic bacterium corynebacterium pseudotuberculosis bound to arginine | 0.9353 | 73 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p5lC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9704 | 3 | 65 | 1.10.10.10 |
| 2p5lH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9687 | 2 | 65 | 1.10.10.10 |
| 2p5kA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9616 | 3 | 65 | 1.10.10.10 |
| 1f9nF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9581 | 11 | 66 | 1.10.10.10 |
| 2p5lC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9557 | 3 | 65 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1JKV4-F1-model_v4 | Arginine repressor | 0.9842 | 2 | 67 |
GO:0003700
GO:0006525 |
| AF-A0A7V3J118-F1-model_v4 | Arginine repressor | 0.9565 | 77 | 150 |
GO:0003677
GO:0003700 GO:0005737 GO:0006526 GO:0034618 GO:0051259 GO:1900079 |
| AF-A0A7X8VLQ8-F1-model_v4 | Arginine repressor | 0.9509 | 73 | 149 |
GO:0003677
GO:0003700 GO:0005737 GO:0006526 GO:0034618 GO:0051259 GO:1900079 |
| AF-A0A3C0MS36-F1-model_v4 | deleted | 0.9455 | 74 | 149 |
|
| AF-A0A6F8XKL4-F1-model_v4 | Arginine repressor | 0.9433 | 81 | 149 |
GO:0003677
GO:0003700 GO:0005737 GO:0006526 GO:0034618 GO:0051259 GO:1900079 |