F480830

General Info

Members Datasets Scaffolds Average Seq Length
787 233 1574 173

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11097613|Ga0105238_110976132
Length 208
Sequence MPVEDTAAAGKNLRLGAGAGVAGLRDFLREKKEERALNDFAVWLSTTAPSGFIQVHEDWMIPVIQSLHIIGIAIVVGSSLMMALRVLGWIATDQPVLAVQRRFGPWLTGALCLLLFSGGLLVVAEPVRELITFSFWLKMAFVAALTALAISFQISVRNQEQRWQGLVNRPPVRLVALLVFVVLGCIIILGRLIAYDHIWGTWSPAQRL

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 38.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_11097613 3300009551 Unclassified 818
2 JGI24746J21847_1001635 3300001977 Unclassified 3586
3 JGI24746J21847_1029202 3300001977 Bacteria 761
4 JGI24745J21846_1005124 3300002073 Bacteria 1423
5 JGI24749J21850_1052747 3300002076 Bacteria 609
6 JGI24034J26672_10022036 3300002239 Unclassified 1005
7 JGI24751J29686_10016979 3300002459 Unclassified 1502
8 Ga0065704_10263485 3300005289 Bacteria 960
9 Ga0065712_10011962 3300005290 Unclassified 3863
10 Ga0065712_10154597 3300005290 Unclassified 1344
11 Ga0065712_10195654 3300005290 Unclassified 1129
12 Ga0065712_10440745 3300005290 Unclassified 694
13 Ga0065715_10122397 3300005293 Unclassified 2206
14 Ga0065715_10607517 3300005293 Bacteria 703
15 Ga0065707_10152024 3300005295 Unclassified 1648
16 Ga0065707_10610884 3300005295 Unclassified 666
17 Ga0070676_10010445 3300005328 Bacteria 5038
18 Ga0070676_10010989 3300005328 Unclassified 4917
19 Ga0070683_100000982 3300005329 Bacteria 21272
20 Ga0070683_100020555 3300005329 Bacteria 5874
21 Ga0070683_101219957 3300005329 Unclassified 723
22 Ga0070683_101302219 3300005329 Bacteria 698
23 Ga0070690_100016754 3300005330 Bacteria 4397
24 Ga0070690_100031451 3300005330 Unclassified 3306
25 Ga0070690_100099587 3300005330 Unclassified 1925
26 Ga0070690_100113114 3300005330 Bacteria 1814
27 Ga0070690_100247601 3300005330 Unclassified 1259
28 Ga0070670_100026040 3300005331 Bacteria 5034
29 Ga0070670_100046813 3300005331 Bacteria 3720
30 Ga0070670_100192830 3300005331 Unclassified 1770
31 Ga0070670_100731213 3300005331 Unclassified 891
32 Ga0070677_10024521 3300005333 Unclassified 2244
33 Ga0070677_10069583 3300005333 Unclassified 1477
34 Ga0070677_10084641 3300005333 Unclassified 1365
35 Ga0068869_100094295 3300005334 Unclassified 2256
36 Ga0068869_100112521 3300005334 Bacteria 2072
37 Ga0068869_100134919 3300005334 Bacteria 1901
38 Ga0068869_101508951 3300005334 Bacteria 597
39 Ga0070666_10010322 3300005335 Bacteria 5841
40 Ga0070666_10016025 3300005335 Bacteria 4790
41 Ga0070666_10064586 3300005335 Bacteria 2482
42 Ga0070666_10164670 3300005335 Bacteria 1551
43 Ga0070666_10210741 3300005335 Bacteria 1368
44 Ga0070666_10414298 3300005335 Unclassified 970
45 Ga0070680_100002282 3300005336 Bacteria 14185
46 Ga0070680_100151017 3300005336 Unclassified 1950
47 Ga0070680_100328160 3300005336 Bacteria 1300
48 Ga0068868_100012279 3300005338 Bacteria 6259
49 Ga0068868_100167407 3300005338 Bacteria 1818
50 Ga0070660_100048146 3300005339 Unclassified 3273
51 Ga0070660_100360583 3300005339 Unclassified 1198
52 Ga0070660_100482467 3300005339 Bacteria 1030
53 Ga0070689_100039031 3300005340 Bacteria 3635
54 Ga0070689_100260449 3300005340 Bacteria 1433
55 Ga0070689_100297263 3300005340 Bacteria 1343
56 Ga0070689_100382483 3300005340 Bacteria 1186
57 Ga0070691_10000312 3300005341 Bacteria 17101
58 Ga0070687_100011589 3300005343 Unclassified 3863
59 Ga0070687_100109048 3300005343 Unclassified 1563
60 Ga0070687_100116766 3300005343 Bacteria 1519
61 Ga0070661_100019734 3300005344 Unclassified 4804
62 Ga0070661_100116990 3300005344 Bacteria 1994
63 Ga0070661_100782874 3300005344 Unclassified 782
64 Ga0070668_100303670 3300005347 Unclassified 1339
65 Ga0070669_100003613 3300005353 Bacteria 11161
66 Ga0070669_100026466 3300005353 Unclassified 4173
67 Ga0070669_100073288 3300005353 Bacteria 2536
68 Ga0070669_100115965 3300005353 Unclassified 2038
69 Ga0070669_100355920 3300005353 Bacteria 1189
70 Ga0070675_100005480 3300005354 Bacteria 9714
71 Ga0070675_100017161 3300005354 Bacteria 5753
72 Ga0070675_100091436 3300005354 Unclassified 2550
73 Ga0070675_100118517 3300005354 Bacteria 2247
74 Ga0070675_100215237 3300005354 Unclassified 1672
75 Ga0070675_100264368 3300005354 Unclassified 1508
76 Ga0070675_100449004 3300005354 Unclassified 1156
77 Ga0070675_100543578 3300005354 Bacteria 1050
78 Ga0070675_100758161 3300005354 Bacteria 886
79 Ga0070671_100014454 3300005355 Bacteria 6379
80 Ga0070671_100084169 3300005355 Bacteria 2660
81 Ga0070671_100246769 3300005355 Bacteria 1516
82 Ga0070671_100248563 3300005355 Bacteria 1511
83 Ga0070671_100383942 3300005355 Unclassified 1201
84 Ga0070671_100856321 3300005355 Unclassified 793
85 Ga0070674_100000133 3300005356 Bacteria 34091
86 Ga0070674_100178460 3300005356 Bacteria 1625
87 Ga0070674_100242650 3300005356 Unclassified 1411
88 Ga0070674_100283576 3300005356 Bacteria 1314
89 Ga0070674_100413346 3300005356 Unclassified 1105
90 Ga0070674_100492390 3300005356 Bacteria 1019
91 Ga0070673_100104240 3300005364 Unclassified 2341
92 Ga0070673_100220988 3300005364 Bacteria 1639
93 Ga0070673_100604487 3300005364 Unclassified 1000
94 Ga0070673_100829595 3300005364 Unclassified 855
95 Ga0070688_100057751 3300005365 Unclassified 2440
96 Ga0070688_100318711 3300005365 Unclassified 1129
97 Ga0070688_100626236 3300005365 Unclassified 826
98 Ga0070688_101046148 3300005365 Bacteria 650
99 Ga0070659_100123134 3300005366 Viruses 2102
100 Ga0070659_100150138 3300005366 Unclassified 1901
101 Ga0070659_100645438 3300005366 Bacteria 912
102 Ga0070667_100006352 3300005367 Bacteria 9823
103 Ga0070667_100013148 3300005367 Bacteria 6842
104 Ga0070667_100067535 3300005367 Bacteria 3040
105 Ga0070667_100161188 3300005367 Unclassified 1975
106 Ga0070667_100220895 3300005367 Unclassified 1687
107 Ga0070714_100693939 3300005435 Unclassified 982
108 Ga0070713_100096612 3300005436 Bacteria 2551
109 Ga0070713_100115833 3300005436 Unclassified 2343
110 Ga0070701_10026070 3300005438 Bacteria 2846
111 Ga0070701_10056041 3300005438 Bacteria 2061
112 Ga0070701_10154175 3300005438 Bacteria 1325
113 Ga0070711_101019177 3300005439 Unclassified 711
114 Ga0070700_100023336 3300005441 Bacteria 3616
115 Ga0070700_100028632 3300005441 Unclassified 3316
116 Ga0070700_100254407 3300005441 Bacteria 1262
117 Ga0070694_100469909 3300005444 Unclassified 996
118 Ga0070663_100026742 3300005455 Unclassified 3911
119 Ga0070663_100065402 3300005455 Unclassified 2632
120 Ga0070663_100156527 3300005455 Bacteria 1751
121 Ga0070678_100028365 3300005456 Bacteria 3817
122 Ga0070678_100048747 3300005456 Bacteria 3053
123 Ga0070678_100303847 3300005456 Unclassified 1357
124 Ga0070662_100011707 3300005457 Bacteria 5790
125 Ga0070662_100191441 3300005457 Bacteria 1618
126 Ga0070662_100852181 3300005457 Bacteria 776
127 Ga0070681_10004371 3300005458 Bacteria 13445
128 Ga0070681_10005425 3300005458 Bacteria 12318
129 Ga0070681_10020888 3300005458 Bacteria 6557
130 Ga0070681_10064064 3300005458 Unclassified 3648
131 Ga0068867_100039782 3300005459 Bacteria 3429
132 Ga0068867_100071660 3300005459 Bacteria 2593
133 Ga0068867_100256922 3300005459 Viruses 1423
134 Ga0068867_100269122 3300005459 Bacteria 1392
135 Ga0070685_10005976 3300005466 Bacteria 6198
136 Ga0070685_10142161 3300005466 Bacteria 1512
137 Ga0070698_100302060 3300005471 Bacteria 1531
138 Ga0070679_100033879 3300005530 Bacteria 5058
139 Ga0070679_100056633 3300005530 Bacteria 3906
140 Ga0070684_100007363 3300005535 Bacteria 8557
141 Ga0070684_100028165 3300005535 Unclassified 4750
142 Ga0070684_100049374 3300005535 Unclassified 3652
143 Ga0070684_100109592 3300005535 Unclassified 2475
144 Ga0070684_100173869 3300005535 Bacteria 1957
145 Ga0070684_100641847 3300005535 Unclassified 988
146 Ga0068853_100102969 3300005539 Unclassified 2527
147 Ga0068853_100108085 3300005539 Unclassified 2467
148 Ga0068853_100146181 3300005539 Unclassified 2125
149 Ga0070672_100002446 3300005543 Bacteria 11785
150 Ga0070672_100035479 3300005543 Unclassified 3791
151 Ga0070672_100055818 3300005543 Bacteria 3095
152 Ga0070672_100089992 3300005543 Unclassified 2474
153 Ga0070672_100112544 3300005543 Unclassified 2220
154 Ga0070672_100185677 3300005543 Bacteria 1734
155 Ga0070672_100473191 3300005543 Unclassified 1081
156 Ga0070686_100010015 3300005544 Bacteria 5336
157 Ga0070686_100135426 3300005544 Bacteria 1708
158 Ga0070686_100575426 3300005544 Unclassified 884
159 Ga0070695_100295495 3300005545 Unclassified 1196
160 Ga0070696_100186838 3300005546 Unclassified 1540
161 Ga0070693_100095886 3300005547 Bacteria 1797
162 Ga0070665_100093255 3300005548 Unclassified 3016
163 Ga0070665_100313164 3300005548 Viruses 1573
164 Ga0070665_100681180 3300005548 Bacteria 1041
165 Ga0070665_101705161 3300005548 Bacteria 637
166 Ga0070704_100327963 3300005549 Unclassified 1285
167 Ga0070704_100895053 3300005549 Bacteria 798
168 Ga0068855_100007688 3300005563 Bacteria 13022
169 Ga0068855_100046130 3300005563 Bacteria 5152
170 Ga0068855_100056701 3300005563 Unclassified 4595
171 Ga0068855_100067362 3300005563 Unclassified 4171
172 Ga0068855_100114819 3300005563 Bacteria 3087
173 Ga0068855_101628648 3300005563 Unclassified 660
174 Ga0070664_100000702 3300005564 Bacteria 25579
175 Ga0070664_100002526 3300005564 Bacteria 14754
176 Ga0068857_100010363 3300005577 Bacteria 8099
177 Ga0068857_100221324 3300005577 Unclassified 1729
178 Ga0068857_100558253 3300005577 Unclassified 1079
179 Ga0068854_100617944 3300005578 Unclassified 927
180 Ga0068856_100206117 3300005614 Unclassified 1981
181 Ga0070702_100035530 3300005615 Unclassified 2754
182 Ga0068852_100018230 3300005616 Bacteria 5528
183 Ga0068852_100238336 3300005616 Bacteria 1737
184 Ga0068852_101120781 3300005616 Unclassified 807
185 Ga0068859_100009922 3300005617 Bacteria 9611
186 Ga0068859_100038178 3300005617 Bacteria 4818
187 Ga0068859_100216938 3300005617 Bacteria 2001
188 Ga0068859_100240316 3300005617 Unclassified 1900
189 Ga0068859_100927971 3300005617 Bacteria 954
190 Ga0068864_100024982 3300005618 Bacteria 5028
191 Ga0068864_100028526 3300005618 Bacteria 4719
192 Ga0068864_100036064 3300005618 Bacteria 4214
193 Ga0068864_100202197 3300005618 Unclassified 1825
194 Ga0068864_100499693 3300005618 Unclassified 1170
195 Ga0068866_10048346 3300005718 Unclassified 2150
196 Ga0068866_10366556 3300005718 Unclassified 920
197 Ga0068861_100014097 3300005719 Bacteria 5604
198 Ga0068861_100017564 3300005719 Bacteria 5083
199 Ga0068861_100099368 3300005719 Unclassified 2311
200 Ga0068861_100324924 3300005719 Unclassified 1341
201 Ga0068851_10132458 3300005834 Unclassified 1349
202 Ga0068870_10000968 3300005840 Bacteria 11294
203 Ga0068870_10005293 3300005840 Bacteria 5621
204 Ga0068870_10028367 3300005840 Unclassified 2810
205 Ga0068870_10138927 3300005840 Bacteria 1419
206 Ga0068870_10147022 3300005840 Bacteria 1384
207 Ga0068870_10191010 3300005840 Bacteria 1236
208 Ga0068870_10249725 3300005840 Bacteria 1099
209 Ga0068870_10304284 3300005840 Unclassified 1007
210 Ga0068863_100006154 3300005841 Bacteria 11769
211 Ga0068863_100071165 3300005841 Bacteria 3290
212 Ga0068863_100128515 3300005841 Unclassified 2418
213 Ga0068863_100512482 3300005841 Unclassified 1182
214 Ga0068863_100658331 3300005841 Bacteria 1039
215 Ga0068858_100013449 3300005842 Bacteria 7722
216 Ga0068858_100023733 3300005842 Bacteria 5713
217 Ga0068858_100024437 3300005842 Bacteria 5629
218 Ga0068858_100049284 3300005842 Bacteria 3900
219 Ga0068858_100502274 3300005842 Unclassified 1172
220 Ga0068858_100744227 3300005842 Bacteria 955
221 Ga0068858_101249140 3300005842 Unclassified 730
222 Ga0068860_100027598 3300005843 Bacteria 5466
223 Ga0068860_100039472 3300005843 Unclassified 4515
224 Ga0068860_100453527 3300005843 Unclassified 1275
225 Ga0068862_100001221 3300005844 Bacteria 24241
226 Ga0068862_100267347 3300005844 Bacteria 1563
227 Ga0068862_100749322 3300005844 Bacteria 950
228 Ga0068862_100849385 3300005844 Bacteria 895
229 Ga0068862_101056333 3300005844 Unclassified 805
230 Ga0097621_100023258 3300006237 Bacteria 4822
231 Ga0097621_100023756 3300006237 Bacteria 4777
232 Ga0097621_100025472 3300006237 Bacteria 4630
233 Ga0097621_100077509 3300006237 Bacteria 2759
234 Ga0097621_100078253 3300006237 Bacteria 2747
235 Ga0097621_100167589 3300006237 Bacteria 1892
236 Ga0097621_100192987 3300006237 Unclassified 1765
237 Ga0097621_100287220 3300006237 Bacteria 1449
238 Ga0097621_100440893 3300006237 Unclassified 1172
239 Ga0068871_100015193 3300006358 Bacteria 5757
240 Ga0068871_100027396 3300006358 Unclassified 4457
241 Ga0068871_100031071 3300006358 Bacteria 4208
242 Ga0068871_100051017 3300006358 Bacteria 3348
243 Ga0068871_100108600 3300006358 Bacteria 2332
244 Ga0068871_100120263 3300006358 Unclassified 2218
245 Ga0068871_100160502 3300006358 Bacteria 1922
246 Ga0068871_100168466 3300006358 Bacteria 1876
247 Ga0068871_100181290 3300006358 Bacteria 1810
248 Ga0068871_100185286 3300006358 Unclassified 1790
249 Ga0068871_100204987 3300006358 Bacteria 1704
250 Ga0068871_100284931 3300006358 Unclassified 1446
251 Ga0068871_100391475 3300006358 Unclassified 1236
252 Ga0068871_100921246 3300006358 Bacteria 811
253 Ga0068871_101398894 3300006358 Unclassified 659
254 Ga0075428_100037932 3300006844 Bacteria 5302
255 Ga0075428_100043240 3300006844 Unclassified 4952
256 Ga0075428_100113776 3300006844 Bacteria 2948
257 Ga0075428_100279217 3300006844 Bacteria 1797
258 Ga0075428_101511772 3300006844 Unclassified 703
259 Ga0075430_100020638 3300006846 Bacteria 5604
260 Ga0075430_100154128 3300006846 Bacteria 1913
261 Ga0075430_100260244 3300006846 Unclassified 1437
262 Ga0075431_100008828 3300006847 Bacteria 10101
263 Ga0075431_100097917 3300006847 Bacteria 3028
264 Ga0075433_10003482 3300006852 Bacteria 12158
265 Ga0075433_10033786 3300006852 Bacteria 4387
266 Ga0075433_10068499 3300006852 Plasmid 3116
267 Ga0075433_10964951 3300006852 Bacteria 743
268 Ga0075434_100006199 3300006871 Bacteria 10952
269 Ga0075434_100077203 3300006871 Unclassified 3326
270 Ga0075434_100099613 3300006871 Unclassified 2912
271 Ga0075429_100258259 3300006880 Bacteria 1525
272 Ga0075429_100984957 3300006880 Unclassified 737
273 Ga0068865_100004621 3300006881 Bacteria 8315
274 Ga0068865_100020817 3300006881 Unclassified 4259
275 Ga0068865_100049154 3300006881 Bacteria 2905
276 Ga0068865_100339461 3300006881 Bacteria 1214
277 Ga0068865_100355587 3300006881 Viruses 1188
278 Ga0075436_100849798 3300006914 Unclassified 681
279 Ga0097620_100009922 3300006931 Bacteria 9611
280 Ga0097620_100038178 3300006931 Bacteria 4818
281 Ga0097620_100216920 3300006931 Bacteria 2001
282 Ga0097620_100240327 3300006931 Unclassified 1900
283 Ga0097620_100927947 3300006931 Bacteria 954
284 Ga0075435_100116861 3300007076 Bacteria 2222
285 Ga0075435_100121055 3300007076 Bacteria 2184
286 Ga0105240_10011394 3300009093 Bacteria 12387
287 Ga0105240_10014664 3300009093 Bacteria 10694
288 Ga0105240_10031980 3300009093 Bacteria 6815
289 Ga0105240_10115747 3300009093 Bacteria 3236
290 Ga0105240_10117746 3300009093 Unclassified 3202
291 Ga0105240_10321165 3300009093 Unclassified 1765
292 Ga0111539_10037556 3300009094 Bacteria 5847
293 Ga0111539_10148075 3300009094 Bacteria 2749
294 Ga0111539_10286834 3300009094 Unclassified 1916
295 Ga0105245_10005648 3300009098 Bacteria 10992
296 Ga0105245_10011760 3300009098 Bacteria 7614
297 Ga0105245_10073665 3300009098 Unclassified 3106
298 Ga0105245_10111556 3300009098 Bacteria 2544
299 Ga0105245_10166661 3300009098 Viruses 2095
300 Ga0105247_10031006 3300009101 Bacteria 3243
301 Ga0105247_10103199 3300009101 Unclassified 1826
302 Ga0105247_10246283 3300009101 Bacteria 1220
303 Ga0105247_10711944 3300009101 Unclassified 757
304 Ga0105247_10811217 3300009101 Bacteria 715
305 Ga0114129_10004828 3300009147 Bacteria 19040
306 Ga0114129_10023224 3300009147 Bacteria 8797
307 Ga0114129_10154243 3300009147 Bacteria 3142
308 Ga0114129_10363197 3300009147 Bacteria 1915
309 Ga0105243_10008460 3300009148 Bacteria 7899
310 Ga0105243_10043442 3300009148 Unclassified 3523
311 Ga0105243_10237006 3300009148 Bacteria 1622
312 Ga0105241_10000303 3300009174 Bacteria 36982
313 Ga0105241_10007393 3300009174 Bacteria 8080
314 Ga0105241_10033656 3300009174 Unclassified 3848
315 Ga0105241_10033740 3300009174 Bacteria 3843
316 Ga0105241_10055309 3300009174 Bacteria 3040
317 Ga0105242_10012768 3300009176 Bacteria 6470
318 Ga0105242_10050415 3300009176 Unclassified 3389
319 Ga0105242_10067451 3300009176 Unclassified 2958
320 Ga0105242_10102434 3300009176 Unclassified 2428
321 Ga0105242_10193245 3300009176 Bacteria 1803
322 Ga0105242_10210369 3300009176 Bacteria 1733
323 Ga0105242_10265589 3300009176 Bacteria 1552
324 Ga0105242_10267763 3300009176 Unclassified 1546
325 Ga0105242_11141236 3300009176 Unclassified 795
326 Ga0105242_12001233 3300009176 Unclassified 622
327 Ga0105248_10004703 3300009177 Bacteria 15098
328 Ga0105248_10011617 3300009177 Bacteria 9701
329 Ga0105248_10031055 3300009177 Bacteria 5969
330 Ga0105248_10165856 3300009177 Bacteria 2490
331 Ga0105248_10207006 3300009177 Bacteria 2210
332 Ga0105248_10287927 3300009177 Bacteria 1850
333 Ga0105248_10373589 3300009177 Bacteria 1605
334 Ga0105248_10483220 3300009177 Bacteria 1396
335 Ga0105248_10644080 3300009177 Bacteria 1196
336 Ga0105237_10004222 3300009545 Bacteria 16736
337 Ga0105237_10005683 3300009545 Bacteria 14033
338 Ga0105237_10027554 3300009545 Bacteria 5798
339 Ga0105237_10344549 3300009545 Unclassified 1494
340 Ga0105237_10428105 3300009545 Unclassified 1329
341 Ga0105237_10510745 3300009545 Bacteria 1208
342 Ga0105237_10562149 3300009545 Unclassified 1147
343 Ga0105237_10902899 3300009545 Unclassified 890
344 Ga0105237_11375999 3300009545 Bacteria 712
345 Ga0105237_11594670 3300009545 Bacteria 660
346 Ga0105238_10000684 3300009551 Bacteria 35548
347 Ga0105238_10025760 3300009551 Bacteria 5997
348 Ga0105238_10026823 3300009551 Bacteria 5872
349 Ga0105238_10030272 3300009551 Bacteria 5509
350 Ga0105238_10037407 3300009551 Bacteria 4934
351 Ga0105238_10138405 3300009551 Bacteria 2412
352 Ga0105238_10158416 3300009551 Bacteria 2239
353 Ga0105238_10666670 3300009551 Unclassified 1051
354 Ga0105238_10966388 3300009551 Unclassified 872
355 Ga0105249_10002976 3300009553 Bacteria 14611
356 Ga0105249_10011034 3300009553 Bacteria 7937
357 Ga0105249_10360085 3300009553 Unclassified 1476
358 Ga0105249_10490008 3300009553 Bacteria 1273
359 Ga0105249_12160675 3300009553 Unclassified 629
360 Ga0105249_12296757 3300009553 Unclassified 612
361 Ga0105029_111202 3300009984 Unclassified 686
362 Ga0105239_10001988 3300010375 Bacteria 26584
363 Ga0105239_10073242 3300010375 Bacteria 3766
364 Ga0105239_10084043 3300010375 Bacteria 3506
365 Ga0105239_10185984 3300010375 Unclassified 2325
366 Ga0105239_10410223 3300010375 Bacteria 1534
367 Ga0105239_11320282 3300010375 Unclassified 832
368 Ga0105246_10045009 3300011119 Unclassified 3003
369 Ga0105246_10143601 3300011119 Unclassified 1798
370 Ga0105246_10452721 3300011119 Unclassified 1079
371 Ga0105246_10954559 3300011119 Bacteria 773
372 Ga0157373_10358991 3300013100 Unclassified 1040
373 Ga0157371_10183622 3300013102 Bacteria 1496
374 Ga0157371_10503828 3300013102 Unclassified 894
375 Ga0157370_10004271 3300013104 Bacteria 16459
376 Ga0157370_10005967 3300013104 Bacteria 13556
377 Ga0157370_10032464 3300013104 Bacteria 5099
378 Ga0157370_10280679 3300013104 Bacteria 1539
379 Ga0157370_10327787 3300013104 Bacteria 1412
380 Ga0157369_10004420 3300013105 Bacteria 16593
381 Ga0157369_10013737 3300013105 Bacteria 9153
382 Ga0157369_10022957 3300013105 Bacteria 6958
383 Ga0157369_10174724 3300013105 Unclassified 2262
384 Ga0157369_11377752 3300013105 Bacteria 718
385 Ga0157374_10044024 3300013296 Unclassified 4125
386 Ga0157374_10065117 3300013296 Unclassified 3422
387 Ga0157374_10111375 3300013296 Bacteria 2633
388 Ga0157374_10306299 3300013296 Unclassified 1572
389 Ga0157374_10674393 3300013296 Bacteria 1046
390 Ga0157374_11074360 3300013296 Unclassified 825
391 Ga0157378_10001236 3300013297 Bacteria 23120
392 Ga0157378_10050806 3300013297 Unclassified 3689
393 Ga0157378_10195210 3300013297 Bacteria 1912
394 Ga0157378_10277447 3300013297 Unclassified 1614
395 Ga0163162_10009655 3300013306 Bacteria 9383
396 Ga0163162_10169831 3300013306 Unclassified 2306
397 Ga0163162_10243783 3300013306 Bacteria 1928
398 Ga0163162_10273079 3300013306 Unclassified 1822
399 Ga0163162_10438657 3300013306 Unclassified 1438
400 Ga0163162_10542422 3300013306 Unclassified 1292
401 Ga0163162_10685019 3300013306 Unclassified 1147
402 Ga0163162_10738704 3300013306 Unclassified 1104
403 Ga0163162_11392394 3300013306 Unclassified 798
404 Ga0157372_10001097 3300013307 Bacteria 29436
405 Ga0157372_10065671 3300013307 Bacteria 4075
406 Ga0157372_10139921 3300013307 Unclassified 2788
407 Ga0157372_10285827 3300013307 Bacteria 1918
408 Ga0157372_10363620 3300013307 Unclassified 1686
409 Ga0157372_10501077 3300013307 Unclassified 1416
410 Ga0157372_11517580 3300013307 Bacteria 772
411 Ga0157375_10003917 3300013308 Bacteria 12910
412 Ga0157375_10005219 3300013308 Bacteria 11273
413 Ga0157375_10078515 3300013308 Unclassified 3334
414 Ga0157375_10103154 3300013308 Bacteria 2939
415 Ga0157375_10107283 3300013308 Unclassified 2886
416 Ga0157375_10127095 3300013308 Bacteria 2665
417 Ga0157375_10216083 3300013308 Unclassified 2075
418 Ga0157375_10236724 3300013308 Bacteria 1985
419 Ga0157375_10745837 3300013308 Bacteria 1131
420 Ga0163163_10000943 3300014325 Bacteria 24682
421 Ga0163163_10016443 3300014325 Bacteria 6877
422 Ga0163163_10049745 3300014325 Bacteria 4126
423 Ga0163163_10067984 3300014325 Bacteria 3544
424 Ga0163163_10152339 3300014325 Unclassified 2356
425 Ga0163163_10159402 3300014325 Unclassified 2301
426 Ga0163163_10235903 3300014325 Bacteria 1878
427 Ga0163163_10387706 3300014325 Bacteria 1455
428 Ga0163163_10822312 3300014325 Bacteria 992
429 Ga0163163_11238237 3300014325 Unclassified 809
430 Ga0163163_11278845 3300014325 Unclassified 796
431 Ga0157380_10012655 3300014326 Bacteria 6124
432 Ga0157380_10053866 3300014326 Unclassified 3191
433 Ga0157380_10061391 3300014326 Bacteria 3007
434 Ga0157380_10245059 3300014326 Unclassified 1618
435 Ga0157380_10322192 3300014326 Bacteria 1433
436 Ga0157380_10598612 3300014326 Bacteria 1090
437 Ga0157380_10658193 3300014326 Bacteria 1046
438 Ga0157377_10160284 3300014745 Unclassified 1398
439 Ga0157379_10028324 3300014968 Bacteria 4984
440 Ga0157379_10032536 3300014968 Bacteria 4650
441 Ga0157379_10047429 3300014968 Unclassified 3833
442 Ga0157379_10233983 3300014968 Bacteria 1666
443 Ga0157379_10468400 3300014968 Bacteria 1165
444 Ga0157379_10617858 3300014968 Bacteria 1013
445 Ga0157376_10072930 3300014969 Bacteria 2922
446 Ga0157376_10084296 3300014969 Bacteria 2736
447 Ga0157376_10084667 3300014969 Unclassified 2731
448 Ga0157376_10087688 3300014969 Unclassified 2686
449 Ga0157376_10092973 3300014969 Bacteria 2617
450 Ga0157376_10095904 3300014969 Bacteria 2580
451 Ga0157376_10113697 3300014969 Bacteria 2387
452 Ga0157376_10133931 3300014969 Unclassified 2215
453 Ga0157376_10404885 3300014969 Bacteria 1320
454 Ga0157376_10443433 3300014969 Unclassified 1265
455 Ga0157376_10780685 3300014969 Unclassified 967
456 Ga0163161_10372460 3300017792 Bacteria 1139
457 Ga0207697_10001648 3300025315 Bacteria 12069
458 Ga0207697_10015174 3300025315 Bacteria 3186
459 Ga0207682_10007712 3300025893 Unclassified 4279
460 Ga0207682_10022597 3300025893 Bacteria 2479
461 Ga0207682_10042147 3300025893 Bacteria 1864
462 Ga0207682_10067501 3300025893 Unclassified 1509
463 Ga0207642_10017405 3300025899 Bacteria 2733
464 Ga0207642_10123757 3300025899 Bacteria 1338
465 Ga0207710_10029053 3300025900 Unclassified 2403
466 Ga0207688_10005062 3300025901 Bacteria 7171
467 Ga0207688_10013358 3300025901 Bacteria 4461
468 Ga0207680_10003242 3300025903 Bacteria 7660
469 Ga0207680_10248791 3300025903 Bacteria 1227
470 Ga0207680_10288554 3300025903 Bacteria 1141
471 Ga0207680_10298351 3300025903 Unclassified 1123
472 Ga0207680_10551167 3300025903 Bacteria 823
473 Ga0207699_10031549 3300025906 Bacteria 2976
474 Ga0207645_10003388 3300025907 Bacteria 12118
475 Ga0207645_10006606 3300025907 Bacteria 8291
476 Ga0207645_10040789 3300025907 Bacteria 2973
477 Ga0207643_10002413 3300025908 Bacteria 10115
478 Ga0207643_10033063 3300025908 Bacteria 2893
479 Ga0207643_10072958 3300025908 Bacteria 1978
480 Ga0207643_10084369 3300025908 Bacteria 1844
481 Ga0207643_10104411 3300025908 Bacteria 1664
482 Ga0207643_10104774 3300025908 Bacteria 1661
483 Ga0207654_10001338 3300025911 Bacteria 13076
484 Ga0207654_10022418 3300025911 Bacteria 3369
485 Ga0207654_10476236 3300025911 Bacteria 879
486 Ga0207707_10000492 3300025912 Bacteria 40859
487 Ga0207707_10002436 3300025912 Bacteria 16741
488 Ga0207707_10434877 3300025912 Bacteria 1124
489 Ga0207695_10000688 3300025913 Bacteria 66300
490 Ga0207695_10008378 3300025913 Bacteria 12950
491 Ga0207695_10017577 3300025913 Bacteria 8312
492 Ga0207695_10018161 3300025913 Bacteria 8139
493 Ga0207695_10872858 3300025913 Unclassified 779
494 Ga0207695_10980876 3300025913 Bacteria 725
495 Ga0207671_10007664 3300025914 Bacteria 9325
496 Ga0207671_10009453 3300025914 Bacteria 8149
497 Ga0207671_10068424 3300025914 Viruses 2646
498 Ga0207671_10080404 3300025914 Unclassified 2443
499 Ga0207671_10204834 3300025914 Unclassified 1541
500 Ga0207671_10343905 3300025914 Bacteria 1182
501 Ga0207671_10447609 3300025914 Unclassified 1029
502 Ga0207671_10715063 3300025914 Unclassified 796
503 Ga0207663_10203936 3300025916 Unclassified 1428
504 Ga0207663_10384950 3300025916 Bacteria 1069
505 Ga0207660_10002523 3300025917 Bacteria 12026
506 Ga0207660_10634064 3300025917 Bacteria 871
507 Ga0207662_10005021 3300025918 Bacteria 7005
508 Ga0207662_10071033 3300025918 Unclassified 2107
509 Ga0207662_10181188 3300025918 Unclassified 1356
510 Ga0207657_10044276 3300025919 Unclassified 3914
511 Ga0207657_10292712 3300025919 Unclassified 1291
512 Ga0207657_10316943 3300025919 Bacteria 1234
513 Ga0207657_10790768 3300025919 Unclassified 734
514 Ga0207649_10042309 3300025920 Unclassified 2778
515 Ga0207649_10191106 3300025920 Unclassified 1440
516 Ga0207649_10502629 3300025920 Unclassified 922
517 Ga0207652_10114981 3300025921 Unclassified 2390
518 Ga0207681_10049948 3300025923 Bacteria 2829
519 Ga0207681_10105635 3300025923 Bacteria 2039
520 Ga0207681_10107758 3300025923 Unclassified 2021
521 Ga0207681_10355355 3300025923 Bacteria 1174
522 Ga0207681_10508094 3300025923 Bacteria 987
523 Ga0207694_10005291 3300025924 Bacteria 9945
524 Ga0207694_10028773 3300025924 Bacteria 4238
525 Ga0207694_10189954 3300025924 Bacteria 1668
526 Ga0207694_10225540 3300025924 Unclassified 1529
527 Ga0207694_10470375 3300025924 Unclassified 1051
528 Ga0207650_10035742 3300025925 Bacteria 3611
529 Ga0207650_10088151 3300025925 Unclassified 2366
530 Ga0207650_10267583 3300025925 Unclassified 1388
531 Ga0207650_10625263 3300025925 Unclassified 907
532 Ga0207659_10019767 3300025926 Bacteria 4439
533 Ga0207659_10057148 3300025926 Unclassified 2796
534 Ga0207659_10072104 3300025926 Bacteria 2524
535 Ga0207659_10079829 3300025926 Bacteria 2415
536 Ga0207659_10127484 3300025926 Bacteria 1959
537 Ga0207659_10137698 3300025926 Unclassified 1892
538 Ga0207659_10946777 3300025926 Bacteria 741
539 Ga0207687_10005586 3300025927 Bacteria 8310
540 Ga0207687_10006181 3300025927 Bacteria 7927
541 Ga0207687_10038690 3300025927 Viruses 3261
542 Ga0207687_10077300 3300025927 Unclassified 2393
543 Ga0207687_10310312 3300025927 Unclassified 1273
544 Ga0207687_10916728 3300025927 Bacteria 750
545 Ga0207700_10020988 3300025928 Unclassified 4450
546 Ga0207700_10077844 3300025928 Bacteria 2577
547 Ga0207700_10481563 3300025928 Unclassified 1096
548 Ga0207644_10052317 3300025931 Unclassified 2934
549 Ga0207644_10077928 3300025931 Unclassified 2442
550 Ga0207644_10123546 3300025931 Unclassified 1973
551 Ga0207644_10224368 3300025931 Bacteria 1491
552 Ga0207644_10597418 3300025931 Bacteria 916
553 Ga0207690_10152890 3300025932 Unclassified 1712
554 Ga0207690_11185561 3300025932 Unclassified 637
555 Ga0207706_10014665 3300025933 Bacteria 7097
556 Ga0207706_10138670 3300025933 Bacteria 2139
557 Ga0207706_10606384 3300025933 Unclassified 940
558 Ga0207686_10052488 3300025934 Unclassified 2545
559 Ga0207686_10068579 3300025934 Unclassified 2272
560 Ga0207686_10090164 3300025934 Bacteria 2022
561 Ga0207686_10162790 3300025934 Unclassified 1565
562 Ga0207686_10166173 3300025934 Bacteria 1552
563 Ga0207686_10213635 3300025934 Viruses 1388
564 Ga0207709_10058611 3300025935 Bacteria 2394
565 Ga0207670_10134433 3300025936 Bacteria 1816
566 Ga0207670_10728934 3300025936 Bacteria 822
567 Ga0207669_10027118 3300025937 Bacteria 3129
568 Ga0207669_10520984 3300025937 Bacteria 954
569 Ga0207669_10596149 3300025937 Bacteria 897
570 Ga0207669_11165972 3300025937 Unclassified 652
571 Ga0207704_10004007 3300025938 Bacteria 6705
572 Ga0207704_10006688 3300025938 Bacteria 5400
573 Ga0207704_10207002 3300025938 Unclassified 1441
574 Ga0207691_10005619 3300025940 Bacteria 12118
575 Ga0207691_10025920 3300025940 Bacteria 5502
576 Ga0207691_10036174 3300025940 Bacteria 4575
577 Ga0207691_10107018 3300025940 Unclassified 2490
578 Ga0207691_10139230 3300025940 Unclassified 2139
579 Ga0207691_10165798 3300025940 Bacteria 1936
580 Ga0207711_10000564 3300025941 Bacteria 37778
581 Ga0207711_10014591 3300025941 Bacteria 6529
582 Ga0207711_10019365 3300025941 Bacteria 5667
583 Ga0207711_10103758 3300025941 Bacteria 2518
584 Ga0207711_10133710 3300025941 Unclassified 2226
585 Ga0207711_11271401 3300025941 Bacteria 678
586 Ga0207689_10003959 3300025942 Bacteria 13486
587 Ga0207689_10009438 3300025942 Bacteria 8424
588 Ga0207661_10003033 3300025944 Bacteria 11609
589 Ga0207661_10004556 3300025944 Bacteria 9719
590 Ga0207661_10169913 3300025944 Unclassified 1897
591 Ga0207661_10232607 3300025944 Unclassified 1633
592 Ga0207661_10253860 3300025944 Bacteria 1564
593 Ga0207661_10452813 3300025944 Bacteria 1169
594 Ga0207661_10664241 3300025944 Unclassified 958
595 Ga0207661_10742785 3300025944 Unclassified 903
596 Ga0207661_11160739 3300025944 Unclassified 711
597 Ga0207679_10015076 3300025945 Bacteria 5096
598 Ga0207679_10033244 3300025945 Bacteria 3628
599 Ga0207679_10212373 3300025945 Bacteria 1623
600 Ga0207679_10558567 3300025945 Bacteria 1028
601 Ga0207679_10931887 3300025945 Unclassified 795
602 Ga0207667_10000671 3300025949 Bacteria 44329
603 Ga0207667_10003608 3300025949 Bacteria 19092
604 Ga0207667_10013071 3300025949 Bacteria 9527
605 Ga0207667_10084910 3300025949 Unclassified 3277
606 Ga0207667_10279658 3300025949 Unclassified 1705
607 Ga0207651_10015914 3300025960 Bacteria 4388
608 Ga0207651_10147726 3300025960 Bacteria 1825
609 Ga0207651_10195272 3300025960 Unclassified 1617
610 Ga0207651_10256043 3300025960 Bacteria 1434
611 Ga0207712_10047889 3300025961 Unclassified 2971
612 Ga0207712_10594385 3300025961 Unclassified 957
613 Ga0207712_10610026 3300025961 Bacteria 945
614 Ga0207668_10050498 3300025972 Bacteria 2867
615 Ga0207668_10153704 3300025972 Unclassified 1785
616 Ga0207640_10256229 3300025981 Bacteria 1361
617 Ga0207640_10287698 3300025981 Unclassified 1294
618 Ga0207658_10017884 3300025986 Bacteria 4886
619 Ga0207658_10026093 3300025986 Bacteria 4094
620 Ga0207658_10054843 3300025986 Bacteria 2951
621 Ga0207658_10108142 3300025986 Unclassified 2193
622 Ga0207658_10245863 3300025986 Unclassified 1518
623 Ga0207677_10011915 3300026023 Bacteria 4976
624 Ga0207677_10026579 3300026023 Bacteria 3633
625 Ga0207677_10027278 3300026023 Unclassified 3595
626 Ga0207677_10690222 3300026023 Bacteria 905
627 Ga0207703_10041326 3300026035 Bacteria 3693
628 Ga0207703_10051491 3300026035 Unclassified 3337
629 Ga0207703_10093655 3300026035 Bacteria 2530
630 Ga0207703_10227053 3300026035 Bacteria 1672
631 Ga0207703_10394572 3300026035 Unclassified 1283
632 Ga0207703_10506323 3300026035 Bacteria 1134
633 Ga0207703_10750656 3300026035 Unclassified 930
634 Ga0207703_10892056 3300026035 Bacteria 851
635 Ga0207703_11277062 3300026035 Unclassified 706
636 Ga0207639_10075833 3300026041 Unclassified 2646
637 Ga0207639_10331201 3300026041 Unclassified 1355
638 Ga0207678_10016394 3300026067 Bacteria 6505
639 Ga0207678_10190737 3300026067 Bacteria 1751
640 Ga0207678_10353116 3300026067 Bacteria 1268
641 Ga0207708_10006488 3300026075 Bacteria 8666
642 Ga0207708_10026968 3300026075 Bacteria 4350
643 Ga0207702_10009956 3300026078 Bacteria 7971
644 Ga0207702_10109244 3300026078 Bacteria 2455
645 Ga0207641_10023337 3300026088 Bacteria 5097
646 Ga0207641_10028331 3300026088 Bacteria 4628
647 Ga0207641_10080795 3300026088 Bacteria 2821
648 Ga0207641_10113188 3300026088 Unclassified 2409
649 Ga0207641_10148550 3300026088 Bacteria 2121
650 Ga0207641_10394419 3300026088 Bacteria 1328
651 Ga0207641_10442943 3300026088 Unclassified 1254
652 Ga0207641_10901139 3300026088 Unclassified 878
653 Ga0207641_10962822 3300026088 Unclassified 849
654 Ga0207641_11015408 3300026088 Unclassified 826
655 Ga0207648_10005401 3300026089 Bacteria 12881
656 Ga0207648_10102275 3300026089 Bacteria 2511
657 Ga0207648_10148180 3300026089 Bacteria 2070
658 Ga0207648_10382401 3300026089 Bacteria 1273
659 Ga0207648_10425171 3300026089 Bacteria 1207
660 Ga0207676_10015022 3300026095 Bacteria 5582
661 Ga0207676_10015911 3300026095 Bacteria 5441
662 Ga0207676_10105672 3300026095 Bacteria 2344
663 Ga0207676_10111225 3300026095 Bacteria 2292
664 Ga0207676_10236186 3300026095 Unclassified 1637
665 Ga0207676_10266519 3300026095 Bacteria 1549
666 Ga0207676_10320736 3300026095 Bacteria 1422
667 Ga0207676_10438150 3300026095 Bacteria 1229
668 Ga0207674_10000101 3300026116 Bacteria 97551
669 Ga0207674_10012805 3300026116 Bacteria 9364
670 Ga0207674_10261829 3300026116 Unclassified 1676
671 Ga0207674_10553945 3300026116 Unclassified 1111
672 Ga0207675_100029618 3300026118 Bacteria 5098
673 Ga0207675_100043959 3300026118 Unclassified 4172
674 Ga0207675_100086437 3300026118 Bacteria 2945
675 Ga0207675_100238471 3300026118 Unclassified 1757
676 Ga0207675_100352179 3300026118 Bacteria 1443
677 Ga0207675_100682396 3300026118 Bacteria 1035
678 Ga0207683_10006075 3300026121 Bacteria 10341
679 Ga0207683_10025317 3300026121 Bacteria 5118
680 Ga0207683_10090957 3300026121 Unclassified 2718
681 Ga0207683_10143374 3300026121 Unclassified 2153
682 Ga0207683_10195757 3300026121 Bacteria 1836
683 Ga0207698_10547615 3300026142 Unclassified 1133
684 Ga0207698_11051477 3300026142 Bacteria 826
685 Ga0209974_10044197 3300027876 Unclassified 1485
686 Ga0207428_10023972 3300027907 Bacteria 5125
687 Ga0268266_10006325 3300028379 Bacteria 10853
688 Ga0268266_10235963 3300028379 Unclassified 1686
689 Ga0268266_10613847 3300028379 Unclassified 1045
690 Ga0268266_10801645 3300028379 Bacteria 910
691 Ga0268265_10012300 3300028380 Bacteria 5799
692 Ga0268265_10170763 3300028380 Bacteria 1858
693 Ga0268265_10619752 3300028380 Unclassified 1036
694 Ga0268265_10719526 3300028380 Bacteria 966
695 Ga0268265_11036018 3300028380 Unclassified 812
696 Ga0268264_10009848 3300028381 Bacteria 7908
697 Ga0268264_10042468 3300028381 Bacteria 3764
698 Ga0268264_11221459 3300028381 Unclassified 761
699 Ga0265340_10111794 3300031247 Unclassified 1262
700 Ga0265331_10302959 3300031250 Unclassified 716
701 Ga0265313_10026751 3300031595 Unclassified 3032
702 Ga0265313_10161522 3300031595 Bacteria 951
703 Ga0265314_10004738 3300031711 Bacteria 12467
704 Ga0265314_10018614 3300031711 Bacteria 5409
705 Ga0307409_100526489 3300031995 Unclassified 1156
706 Ga0373948_0116602 3300034817 Bacteria 642
707 Ga0373950_0051005 3300034818 Bacteria 813
708 Ga0373940_0029384 3300035088 Unclassified 1456
709 Ga0373952_0073647 3300035092 Bacteria 859
710 Ga0373939_0036729 3300035114 Unclassified 1451
711 Ga0373953_0107101 3300035117 Unclassified 1180
712 Ga0373955_0199791 3300035172 Unclassified 1190
713 Ga0373933_0208696 3300035724 Unclassified 1251
714 Ga0373933_0581068 3300035724 Unclassified 735
715 Ga0373937_0005505 3300036401 Bacteria 10853
716 Ga0373937_0077127 3300036401 Bacteria 3079
717 Ga0373937_0675181 3300036401 Unclassified 979
718 Ga0373937_0950829 3300036401 Bacteria 808
719 Ga0439435_0003672 3300042436 Bacteria 3217
720 Ga0439464_0116325 3300042439 Bacteria 821
721 Ga0439440_0033819 3300042993 Bacteria 1220
722 Ga0439440_0042665 3300042993 Bacteria 1111
723 Ga0439440_0057940 3300042993 Unclassified 983
724 Ga0451576_0245048 3300045051 Unclassified 1872
725 Ga0495592_0162829 3300046454 Bacteria 1533
726 Ga0495592_0201445 3300046454 Unclassified 1343
727 Ga0495629_0007722 3300046459 Bacteria 7915
728 Ga0495580_0253375 3300046472 Unclassified 1205
729 Ga0495580_0362618 3300046472 Unclassified 981
730 Ga0495582_0001891 3300046473 Bacteria 11807
731 Ga0495664_0046799 3300046477 Unclassified 2567
732 Ga0495594_0003803 3300046499 Bacteria 7747
733 Ga0495608_0025352 3300046511 Unclassified 4048
734 Ga0495586_0009620 3300046535 Bacteria 5150
735 Ga0495586_0044743 3300046535 Bacteria 2385
736 Ga0495586_0468218 3300046535 Unclassified 727
737 Ga0495587_0002920 3300046536 Bacteria 11440
738 Ga0495598_0026363 3300046537 Bacteria 1593
739 Ga0495621_0145680 3300046539 Bacteria 929
740 Ga0495621_0171925 3300046539 Unclassified 861
741 Ga0495645_0121696 3300046543 Unclassified 1837
742 Ga0495667_0002353 3300046559 Bacteria 12640
743 Ga0495634_0049605 3300046642 Bacteria 2822
744 Ga0495659_0155982 3300046664 Bacteria 919
745 Ga0495657_0006734 3300046675 Bacteria 8959
746 Ga0495658_0079337 3300046683 Bacteria 1923
747 Ga0495613_0033454 3300046689 Bacteria 3820
748 Ga0495613_0073760 3300046689 Bacteria 2486
749 Ga0495613_0621556 3300046689 Unclassified 717
750 Ga0495670_0155538 3300046691 Bacteria 1200
751 Ga0495604_0892486 3300047317 Unclassified 556
752 Ga0495636_0011465 3300047318 Bacteria 3508
753 Ga0495674_0098399 3300047319 Bacteria 2491
754 Ga0495674_0414776 3300047319 Unclassified 1085
755 Ga0495675_0421258 3300047444 Unclassified 776
756 Ga0495684_0067877 3300047471 Bacteria 2712
757 Ga0495684_0670478 3300047471 Bacteria 691
758 Ga0496109_1093742 3300048912 Bacteria 734
759 Ga0496114_0975487 3300048917 Unclassified 730
760 Ga0496126_0004856 3300048929 Bacteria 15742
761 nmdc:mga05p37_11781_c1 3300050507 Bacteria 10424
762 nmdc:mga05p37_140681_c1 3300050507 Bacteria 2957
763 nmdc:mga05p37_188855_c1 3300050507 Bacteria 2503
764 nmdc:mga05p37_2989_c1 3300050507 Bacteria 19637
765 nmdc:mga05p37_600852_c1 3300050507 Bacteria 1242
766 nmdc:mga05p37_93797_c1 3300050507 Bacteria 3699
767 nmdc:mga09592_132811_c1 3300050508 Bacteria 2143
768 nmdc:mga09592_13731_c1 3300050508 Bacteria 6617
769 nmdc:mga0qj67_11252_c1 3300050509 Bacteria 6702
770 nmdc:mga0qj67_46195_c1 3300050509 Bacteria 3437
771 nmdc:mga06r32_3004_c1 3300050510 Bacteria 15109
772 nmdc:mga06r32_616869_c1 3300050510 Bacteria 1055
773 nmdc:mga08y16_200614_c1 3300050511 Unclassified 2067
774 nmdc:mga08y16_7619_c1 3300050511 Bacteria 11331
775 nmdc:mga0n895_130394_c1 3300050512 Bacteria 2539
776 nmdc:mga0n895_424190_c1 3300050512 Unclassified 1344
777 nmdc:mga0n895_54180_c1 3300050512 Bacteria 3944
778 nmdc:mga0n895_79582_c1 3300050512 Unclassified 3264
779 nmdc:mga0n895_90049_c1 3300050512 Bacteria 3069
780 nmdc:mga0rr50_101872_c1 3300050513 Bacteria 2258
781 nmdc:mga0rr50_226868_c1 3300050513 Bacteria 1544
782 nmdc:mga08x19_648132_c1 3300050514 Unclassified 749
783 nmdc:mga0a205_39612_c1 3300050515 Bacteria 4534
784 nmdc:mga0a205_4439_c1 3300050515 Bacteria 12597
785 Ga0495601_0103524 3300053077 Unclassified 1840
786 Ga0500572_002697 3300053111 Bacteria 4201
787 Ga0500622_0039109 3300053156 Unclassified 2473
788 Ga0105238_11097613
789 JGI24746J21847_1001635
790 JGI24746J21847_1029202
791 JGI24745J21846_1005124
792 JGI24749J21850_1052747
793 JGI24034J26672_10022036
794 JGI24751J29686_10016979
795 Ga0065704_10263485
796 Ga0065712_10011962
797 Ga0065712_10154597
798 Ga0065712_10195654
799 Ga0065712_10440745
800 Ga0065715_10122397
801 Ga0065715_10607517
802 Ga0065707_10152024
803 Ga0065707_10610884
804 Ga0070676_10010445
805 Ga0070676_10010989
806 Ga0070683_100000982
807 Ga0070683_100020555
808 Ga0070683_101219957
809 Ga0070683_101302219
810 Ga0070690_100016754
811 Ga0070690_100031451
812 Ga0070690_100099587
813 Ga0070690_100113114
814 Ga0070690_100247601
815 Ga0070670_100026040
816 Ga0070670_100046813
817 Ga0070670_100192830
818 Ga0070670_100731213
819 Ga0070677_10024521
820 Ga0070677_10069583
821 Ga0070677_10084641
822 Ga0068869_100094295
823 Ga0068869_100112521
824 Ga0068869_100134919
825 Ga0068869_101508951
826 Ga0070666_10010322
827 Ga0070666_10016025
828 Ga0070666_10064586
829 Ga0070666_10164670
830 Ga0070666_10210741
831 Ga0070666_10414298
832 Ga0070680_100002282
833 Ga0070680_100151017
834 Ga0070680_100328160
835 Ga0068868_100012279
836 Ga0068868_100167407
837 Ga0070660_100048146
838 Ga0070660_100360583
839 Ga0070660_100482467
840 Ga0070689_100039031
841 Ga0070689_100260449
842 Ga0070689_100297263
843 Ga0070689_100382483
844 Ga0070691_10000312
845 Ga0070687_100011589
846 Ga0070687_100109048
847 Ga0070687_100116766
848 Ga0070661_100019734
849 Ga0070661_100116990
850 Ga0070661_100782874
851 Ga0070668_100303670
852 Ga0070669_100003613
853 Ga0070669_100026466
854 Ga0070669_100073288
855 Ga0070669_100115965
856 Ga0070669_100355920
857 Ga0070675_100005480
858 Ga0070675_100017161
859 Ga0070675_100091436
860 Ga0070675_100118517
861 Ga0070675_100215237
862 Ga0070675_100264368
863 Ga0070675_100449004
864 Ga0070675_100543578
865 Ga0070675_100758161
866 Ga0070671_100014454
867 Ga0070671_100084169
868 Ga0070671_100246769
869 Ga0070671_100248563
870 Ga0070671_100383942
871 Ga0070671_100856321
872 Ga0070674_100000133
873 Ga0070674_100178460
874 Ga0070674_100242650
875 Ga0070674_100283576
876 Ga0070674_100413346
877 Ga0070674_100492390
878 Ga0070673_100104240
879 Ga0070673_100220988
880 Ga0070673_100604487
881 Ga0070673_100829595
882 Ga0070688_100057751
883 Ga0070688_100318711
884 Ga0070688_100626236
885 Ga0070688_101046148
886 Ga0070659_100123134
887 Ga0070659_100150138
888 Ga0070659_100645438
889 Ga0070667_100006352
890 Ga0070667_100013148
891 Ga0070667_100067535
892 Ga0070667_100161188
893 Ga0070667_100220895
894 Ga0070714_100693939
895 Ga0070713_100096612
896 Ga0070713_100115833
897 Ga0070701_10026070
898 Ga0070701_10056041
899 Ga0070701_10154175
900 Ga0070711_101019177
901 Ga0070700_100023336
902 Ga0070700_100028632
903 Ga0070700_100254407
904 Ga0070694_100469909
905 Ga0070663_100026742
906 Ga0070663_100065402
907 Ga0070663_100156527
908 Ga0070678_100028365
909 Ga0070678_100048747
910 Ga0070678_100303847
911 Ga0070662_100011707
912 Ga0070662_100191441
913 Ga0070662_100852181
914 Ga0070681_10004371
915 Ga0070681_10005425
916 Ga0070681_10020888
917 Ga0070681_10064064
918 Ga0068867_100039782
919 Ga0068867_100071660
920 Ga0068867_100256922
921 Ga0068867_100269122
922 Ga0070685_10005976
923 Ga0070685_10142161
924 Ga0070698_100302060
925 Ga0070679_100033879
926 Ga0070679_100056633
927 Ga0070684_100007363
928 Ga0070684_100028165
929 Ga0070684_100049374
930 Ga0070684_100109592
931 Ga0070684_100173869
932 Ga0070684_100641847
933 Ga0068853_100102969
934 Ga0068853_100108085
935 Ga0068853_100146181
936 Ga0070672_100002446
937 Ga0070672_100035479
938 Ga0070672_100055818
939 Ga0070672_100089992
940 Ga0070672_100112544
941 Ga0070672_100185677
942 Ga0070672_100473191
943 Ga0070686_100010015
944 Ga0070686_100135426
945 Ga0070686_100575426
946 Ga0070695_100295495
947 Ga0070696_100186838
948 Ga0070693_100095886
949 Ga0070665_100093255
950 Ga0070665_100313164
951 Ga0070665_100681180
952 Ga0070665_101705161
953 Ga0070704_100327963
954 Ga0070704_100895053
955 Ga0068855_100007688
956 Ga0068855_100046130
957 Ga0068855_100056701
958 Ga0068855_100067362
959 Ga0068855_100114819
960 Ga0068855_101628648
961 Ga0070664_100000702
962 Ga0070664_100002526
963 Ga0068857_100010363
964 Ga0068857_100221324
965 Ga0068857_100558253
966 Ga0068854_100617944
967 Ga0068856_100206117
968 Ga0070702_100035530
969 Ga0068852_100018230
970 Ga0068852_100238336
971 Ga0068852_101120781
972 Ga0068859_100009922
973 Ga0068859_100038178
974 Ga0068859_100216938
975 Ga0068859_100240316
976 Ga0068859_100927971
977 Ga0068864_100024982
978 Ga0068864_100028526
979 Ga0068864_100036064
980 Ga0068864_100202197
981 Ga0068864_100499693
982 Ga0068866_10048346
983 Ga0068866_10366556
984 Ga0068861_100014097
985 Ga0068861_100017564
986 Ga0068861_100099368
987 Ga0068861_100324924
988 Ga0068851_10132458
989 Ga0068870_10000968
990 Ga0068870_10005293
991 Ga0068870_10028367
992 Ga0068870_10138927
993 Ga0068870_10147022
994 Ga0068870_10191010
995 Ga0068870_10249725
996 Ga0068870_10304284
997 Ga0068863_100006154
998 Ga0068863_100071165
999 Ga0068863_100128515
1000 Ga0068863_100512482
1001 Ga0068863_100658331
1002 Ga0068858_100013449
1003 Ga0068858_100023733
1004 Ga0068858_100024437
1005 Ga0068858_100049284
1006 Ga0068858_100502274
1007 Ga0068858_100744227
1008 Ga0068858_101249140
1009 Ga0068860_100027598
1010 Ga0068860_100039472
1011 Ga0068860_100453527
1012 Ga0068862_100001221
1013 Ga0068862_100267347
1014 Ga0068862_100749322
1015 Ga0068862_100849385
1016 Ga0068862_101056333
1017 Ga0097621_100023258
1018 Ga0097621_100023756
1019 Ga0097621_100025472
1020 Ga0097621_100077509
1021 Ga0097621_100078253
1022 Ga0097621_100167589
1023 Ga0097621_100192987
1024 Ga0097621_100287220
1025 Ga0097621_100440893
1026 Ga0068871_100015193
1027 Ga0068871_100027396
1028 Ga0068871_100031071
1029 Ga0068871_100051017
1030 Ga0068871_100108600
1031 Ga0068871_100120263
1032 Ga0068871_100160502
1033 Ga0068871_100168466
1034 Ga0068871_100181290
1035 Ga0068871_100185286
1036 Ga0068871_100204987
1037 Ga0068871_100284931
1038 Ga0068871_100391475
1039 Ga0068871_100921246
1040 Ga0068871_101398894
1041 Ga0075428_100037932
1042 Ga0075428_100043240
1043 Ga0075428_100113776
1044 Ga0075428_100279217
1045 Ga0075428_101511772
1046 Ga0075430_100020638
1047 Ga0075430_100154128
1048 Ga0075430_100260244
1049 Ga0075431_100008828
1050 Ga0075431_100097917
1051 Ga0075433_10003482
1052 Ga0075433_10033786
1053 Ga0075433_10068499
1054 Ga0075433_10964951
1055 Ga0075434_100006199
1056 Ga0075434_100077203
1057 Ga0075434_100099613
1058 Ga0075429_100258259
1059 Ga0075429_100984957
1060 Ga0068865_100004621
1061 Ga0068865_100020817
1062 Ga0068865_100049154
1063 Ga0068865_100339461
1064 Ga0068865_100355587
1065 Ga0075436_100849798
1066 Ga0097620_100009922
1067 Ga0097620_100038178
1068 Ga0097620_100216920
1069 Ga0097620_100240327
1070 Ga0097620_100927947
1071 Ga0075435_100116861
1072 Ga0075435_100121055
1073 Ga0105240_10011394
1074 Ga0105240_10014664
1075 Ga0105240_10031980
1076 Ga0105240_10115747
1077 Ga0105240_10117746
1078 Ga0105240_10321165
1079 Ga0111539_10037556
1080 Ga0111539_10148075
1081 Ga0111539_10286834
1082 Ga0105245_10005648
1083 Ga0105245_10011760
1084 Ga0105245_10073665
1085 Ga0105245_10111556
1086 Ga0105245_10166661
1087 Ga0105247_10031006
1088 Ga0105247_10103199
1089 Ga0105247_10246283
1090 Ga0105247_10711944
1091 Ga0105247_10811217
1092 Ga0114129_10004828
1093 Ga0114129_10023224
1094 Ga0114129_10154243
1095 Ga0114129_10363197
1096 Ga0105243_10008460
1097 Ga0105243_10043442
1098 Ga0105243_10237006
1099 Ga0105241_10000303
1100 Ga0105241_10007393
1101 Ga0105241_10033656
1102 Ga0105241_10033740
1103 Ga0105241_10055309
1104 Ga0105242_10012768
1105 Ga0105242_10050415
1106 Ga0105242_10067451
1107 Ga0105242_10102434
1108 Ga0105242_10193245
1109 Ga0105242_10210369
1110 Ga0105242_10265589
1111 Ga0105242_10267763
1112 Ga0105242_11141236
1113 Ga0105242_12001233
1114 Ga0105248_10004703
1115 Ga0105248_10011617
1116 Ga0105248_10031055
1117 Ga0105248_10165856
1118 Ga0105248_10207006
1119 Ga0105248_10287927
1120 Ga0105248_10373589
1121 Ga0105248_10483220
1122 Ga0105248_10644080
1123 Ga0105237_10004222
1124 Ga0105237_10005683
1125 Ga0105237_10027554
1126 Ga0105237_10344549
1127 Ga0105237_10428105
1128 Ga0105237_10510745
1129 Ga0105237_10562149
1130 Ga0105237_10902899
1131 Ga0105237_11375999
1132 Ga0105237_11594670
1133 Ga0105238_10000684
1134 Ga0105238_10025760
1135 Ga0105238_10026823
1136 Ga0105238_10030272
1137 Ga0105238_10037407
1138 Ga0105238_10138405
1139 Ga0105238_10158416
1140 Ga0105238_10666670
1141 Ga0105238_10966388
1142 Ga0105249_10002976
1143 Ga0105249_10011034
1144 Ga0105249_10360085
1145 Ga0105249_10490008
1146 Ga0105249_12160675
1147 Ga0105249_12296757
1148 Ga0105029_111202
1149 Ga0105239_10001988
1150 Ga0105239_10073242
1151 Ga0105239_10084043
1152 Ga0105239_10185984
1153 Ga0105239_10410223
1154 Ga0105239_11320282
1155 Ga0105246_10045009
1156 Ga0105246_10143601
1157 Ga0105246_10452721
1158 Ga0105246_10954559
1159 Ga0157373_10358991
1160 Ga0157371_10183622
1161 Ga0157371_10503828
1162 Ga0157370_10004271
1163 Ga0157370_10005967
1164 Ga0157370_10032464
1165 Ga0157370_10280679
1166 Ga0157370_10327787
1167 Ga0157369_10004420
1168 Ga0157369_10013737
1169 Ga0157369_10022957
1170 Ga0157369_10174724
1171 Ga0157369_11377752
1172 Ga0157374_10044024
1173 Ga0157374_10065117
1174 Ga0157374_10111375
1175 Ga0157374_10306299
1176 Ga0157374_10674393
1177 Ga0157374_11074360
1178 Ga0157378_10001236
1179 Ga0157378_10050806
1180 Ga0157378_10195210
1181 Ga0157378_10277447
1182 Ga0163162_10009655
1183 Ga0163162_10169831
1184 Ga0163162_10243783
1185 Ga0163162_10273079
1186 Ga0163162_10438657
1187 Ga0163162_10542422
1188 Ga0163162_10685019
1189 Ga0163162_10738704
1190 Ga0163162_11392394
1191 Ga0157372_10001097
1192 Ga0157372_10065671
1193 Ga0157372_10139921
1194 Ga0157372_10285827
1195 Ga0157372_10363620
1196 Ga0157372_10501077
1197 Ga0157372_11517580
1198 Ga0157375_10003917
1199 Ga0157375_10005219
1200 Ga0157375_10078515
1201 Ga0157375_10103154
1202 Ga0157375_10107283
1203 Ga0157375_10127095
1204 Ga0157375_10216083
1205 Ga0157375_10236724
1206 Ga0157375_10745837
1207 Ga0163163_10000943
1208 Ga0163163_10016443
1209 Ga0163163_10049745
1210 Ga0163163_10067984
1211 Ga0163163_10152339
1212 Ga0163163_10159402
1213 Ga0163163_10235903
1214 Ga0163163_10387706
1215 Ga0163163_10822312
1216 Ga0163163_11238237
1217 Ga0163163_11278845
1218 Ga0157380_10012655
1219 Ga0157380_10053866
1220 Ga0157380_10061391
1221 Ga0157380_10245059
1222 Ga0157380_10322192
1223 Ga0157380_10598612
1224 Ga0157380_10658193
1225 Ga0157377_10160284
1226 Ga0157379_10028324
1227 Ga0157379_10032536
1228 Ga0157379_10047429
1229 Ga0157379_10233983
1230 Ga0157379_10468400
1231 Ga0157379_10617858
1232 Ga0157376_10072930
1233 Ga0157376_10084296
1234 Ga0157376_10084667
1235 Ga0157376_10087688
1236 Ga0157376_10092973
1237 Ga0157376_10095904
1238 Ga0157376_10113697
1239 Ga0157376_10133931
1240 Ga0157376_10404885
1241 Ga0157376_10443433
1242 Ga0157376_10780685
1243 Ga0163161_10372460
1244 Ga0207697_10001648
1245 Ga0207697_10015174
1246 Ga0207682_10007712
1247 Ga0207682_10022597
1248 Ga0207682_10042147
1249 Ga0207682_10067501
1250 Ga0207642_10017405
1251 Ga0207642_10123757
1252 Ga0207710_10029053
1253 Ga0207688_10005062
1254 Ga0207688_10013358
1255 Ga0207680_10003242
1256 Ga0207680_10248791
1257 Ga0207680_10288554
1258 Ga0207680_10298351
1259 Ga0207680_10551167
1260 Ga0207699_10031549
1261 Ga0207645_10003388
1262 Ga0207645_10006606
1263 Ga0207645_10040789
1264 Ga0207643_10002413
1265 Ga0207643_10033063
1266 Ga0207643_10072958
1267 Ga0207643_10084369
1268 Ga0207643_10104411
1269 Ga0207643_10104774
1270 Ga0207654_10001338
1271 Ga0207654_10022418
1272 Ga0207654_10476236
1273 Ga0207707_10000492
1274 Ga0207707_10002436
1275 Ga0207707_10434877
1276 Ga0207695_10000688
1277 Ga0207695_10008378
1278 Ga0207695_10017577
1279 Ga0207695_10018161
1280 Ga0207695_10872858
1281 Ga0207695_10980876
1282 Ga0207671_10007664
1283 Ga0207671_10009453
1284 Ga0207671_10068424
1285 Ga0207671_10080404
1286 Ga0207671_10204834
1287 Ga0207671_10343905
1288 Ga0207671_10447609
1289 Ga0207671_10715063
1290 Ga0207663_10203936
1291 Ga0207663_10384950
1292 Ga0207660_10002523
1293 Ga0207660_10634064
1294 Ga0207662_10005021
1295 Ga0207662_10071033
1296 Ga0207662_10181188
1297 Ga0207657_10044276
1298 Ga0207657_10292712
1299 Ga0207657_10316943
1300 Ga0207657_10790768
1301 Ga0207649_10042309
1302 Ga0207649_10191106
1303 Ga0207649_10502629
1304 Ga0207652_10114981
1305 Ga0207681_10049948
1306 Ga0207681_10105635
1307 Ga0207681_10107758
1308 Ga0207681_10355355
1309 Ga0207681_10508094
1310 Ga0207694_10005291
1311 Ga0207694_10028773
1312 Ga0207694_10189954
1313 Ga0207694_10225540
1314 Ga0207694_10470375
1315 Ga0207650_10035742
1316 Ga0207650_10088151
1317 Ga0207650_10267583
1318 Ga0207650_10625263
1319 Ga0207659_10019767
1320 Ga0207659_10057148
1321 Ga0207659_10072104
1322 Ga0207659_10079829
1323 Ga0207659_10127484
1324 Ga0207659_10137698
1325 Ga0207659_10946777
1326 Ga0207687_10005586
1327 Ga0207687_10006181
1328 Ga0207687_10038690
1329 Ga0207687_10077300
1330 Ga0207687_10310312
1331 Ga0207687_10916728
1332 Ga0207700_10020988
1333 Ga0207700_10077844
1334 Ga0207700_10481563
1335 Ga0207644_10052317
1336 Ga0207644_10077928
1337 Ga0207644_10123546
1338 Ga0207644_10224368
1339 Ga0207644_10597418
1340 Ga0207690_10152890
1341 Ga0207690_11185561
1342 Ga0207706_10014665
1343 Ga0207706_10138670
1344 Ga0207706_10606384
1345 Ga0207686_10052488
1346 Ga0207686_10068579
1347 Ga0207686_10090164
1348 Ga0207686_10162790
1349 Ga0207686_10166173
1350 Ga0207686_10213635
1351 Ga0207709_10058611
1352 Ga0207670_10134433
1353 Ga0207670_10728934
1354 Ga0207669_10027118
1355 Ga0207669_10520984
1356 Ga0207669_10596149
1357 Ga0207669_11165972
1358 Ga0207704_10004007
1359 Ga0207704_10006688
1360 Ga0207704_10207002
1361 Ga0207691_10005619
1362 Ga0207691_10025920
1363 Ga0207691_10036174
1364 Ga0207691_10107018
1365 Ga0207691_10139230
1366 Ga0207691_10165798
1367 Ga0207711_10000564
1368 Ga0207711_10014591
1369 Ga0207711_10019365
1370 Ga0207711_10103758
1371 Ga0207711_10133710
1372 Ga0207711_11271401
1373 Ga0207689_10003959
1374 Ga0207689_10009438
1375 Ga0207661_10003033
1376 Ga0207661_10004556
1377 Ga0207661_10169913
1378 Ga0207661_10232607
1379 Ga0207661_10253860
1380 Ga0207661_10452813
1381 Ga0207661_10664241
1382 Ga0207661_10742785
1383 Ga0207661_11160739
1384 Ga0207679_10015076
1385 Ga0207679_10033244
1386 Ga0207679_10212373
1387 Ga0207679_10558567
1388 Ga0207679_10931887
1389 Ga0207667_10000671
1390 Ga0207667_10003608
1391 Ga0207667_10013071
1392 Ga0207667_10084910
1393 Ga0207667_10279658
1394 Ga0207651_10015914
1395 Ga0207651_10147726
1396 Ga0207651_10195272
1397 Ga0207651_10256043
1398 Ga0207712_10047889
1399 Ga0207712_10594385
1400 Ga0207712_10610026
1401 Ga0207668_10050498
1402 Ga0207668_10153704
1403 Ga0207640_10256229
1404 Ga0207640_10287698
1405 Ga0207658_10017884
1406 Ga0207658_10026093
1407 Ga0207658_10054843
1408 Ga0207658_10108142
1409 Ga0207658_10245863
1410 Ga0207677_10011915
1411 Ga0207677_10026579
1412 Ga0207677_10027278
1413 Ga0207677_10690222
1414 Ga0207703_10041326
1415 Ga0207703_10051491
1416 Ga0207703_10093655
1417 Ga0207703_10227053
1418 Ga0207703_10394572
1419 Ga0207703_10506323
1420 Ga0207703_10750656
1421 Ga0207703_10892056
1422 Ga0207703_11277062
1423 Ga0207639_10075833
1424 Ga0207639_10331201
1425 Ga0207678_10016394
1426 Ga0207678_10190737
1427 Ga0207678_10353116
1428 Ga0207708_10006488
1429 Ga0207708_10026968
1430 Ga0207702_10009956
1431 Ga0207702_10109244
1432 Ga0207641_10023337
1433 Ga0207641_10028331
1434 Ga0207641_10080795
1435 Ga0207641_10113188
1436 Ga0207641_10148550
1437 Ga0207641_10394419
1438 Ga0207641_10442943
1439 Ga0207641_10901139
1440 Ga0207641_10962822
1441 Ga0207641_11015408
1442 Ga0207648_10005401
1443 Ga0207648_10102275
1444 Ga0207648_10148180
1445 Ga0207648_10382401
1446 Ga0207648_10425171
1447 Ga0207676_10015022
1448 Ga0207676_10015911
1449 Ga0207676_10105672
1450 Ga0207676_10111225
1451 Ga0207676_10236186
1452 Ga0207676_10266519
1453 Ga0207676_10320736
1454 Ga0207676_10438150
1455 Ga0207674_10000101
1456 Ga0207674_10012805
1457 Ga0207674_10261829
1458 Ga0207674_10553945
1459 Ga0207675_100029618
1460 Ga0207675_100043959
1461 Ga0207675_100086437
1462 Ga0207675_100238471
1463 Ga0207675_100352179
1464 Ga0207675_100682396
1465 Ga0207683_10006075
1466 Ga0207683_10025317
1467 Ga0207683_10090957
1468 Ga0207683_10143374
1469 Ga0207683_10195757
1470 Ga0207698_10547615
1471 Ga0207698_11051477
1472 Ga0209974_10044197
1473 Ga0207428_10023972
1474 Ga0268266_10006325
1475 Ga0268266_10235963
1476 Ga0268266_10613847
1477 Ga0268266_10801645
1478 Ga0268265_10012300
1479 Ga0268265_10170763
1480 Ga0268265_10619752
1481 Ga0268265_10719526
1482 Ga0268265_11036018
1483 Ga0268264_10009848
1484 Ga0268264_10042468
1485 Ga0268264_11221459
1486 Ga0265340_10111794
1487 Ga0265331_10302959
1488 Ga0265313_10026751
1489 Ga0265313_10161522
1490 Ga0265314_10004738
1491 Ga0265314_10018614
1492 Ga0307409_100526489
1493 Ga0373948_0116602
1494 Ga0373950_0051005
1495 Ga0373940_0029384
1496 Ga0373952_0073647
1497 Ga0373939_0036729
1498 Ga0373953_0107101
1499 Ga0373955_0199791
1500 Ga0373933_0208696
1501 Ga0373933_0581068
1502 Ga0373937_0005505
1503 Ga0373937_0077127
1504 Ga0373937_0675181
1505 Ga0373937_0950829
1506 Ga0439435_0003672
1507 Ga0439464_0116325
1508 Ga0439440_0033819
1509 Ga0439440_0042665
1510 Ga0439440_0057940
1511 Ga0451576_0245048
1512 Ga0495592_0162829
1513 Ga0495592_0201445
1514 Ga0495629_0007722
1515 Ga0495580_0253375
1516 Ga0495580_0362618
1517 Ga0495582_0001891
1518 Ga0495664_0046799
1519 Ga0495594_0003803
1520 Ga0495608_0025352
1521 Ga0495586_0009620
1522 Ga0495586_0044743
1523 Ga0495586_0468218
1524 Ga0495587_0002920
1525 Ga0495598_0026363
1526 Ga0495621_0145680
1527 Ga0495621_0171925
1528 Ga0495645_0121696
1529 Ga0495667_0002353
1530 Ga0495634_0049605
1531 Ga0495659_0155982
1532 Ga0495657_0006734
1533 Ga0495658_0079337
1534 Ga0495613_0033454
1535 Ga0495613_0073760
1536 Ga0495613_0621556
1537 Ga0495670_0155538
1538 Ga0495604_0892486
1539 Ga0495636_0011465
1540 Ga0495674_0098399
1541 Ga0495674_0414776
1542 Ga0495675_0421258
1543 Ga0495684_0067877
1544 Ga0495684_0670478
1545 Ga0496109_1093742
1546 Ga0496114_0975487
1547 Ga0496126_0004856
1548 nmdc:mga05p37_11781_c1
1549 nmdc:mga05p37_140681_c1
1550 nmdc:mga05p37_188855_c1
1551 nmdc:mga05p37_2989_c1
1552 nmdc:mga05p37_600852_c1
1553 nmdc:mga05p37_93797_c1
1554 nmdc:mga09592_132811_c1
1555 nmdc:mga09592_13731_c1
1556 nmdc:mga0qj67_11252_c1
1557 nmdc:mga0qj67_46195_c1
1558 nmdc:mga06r32_3004_c1
1559 nmdc:mga06r32_616869_c1
1560 nmdc:mga08y16_200614_c1
1561 nmdc:mga08y16_7619_c1
1562 nmdc:mga0n895_130394_c1
1563 nmdc:mga0n895_424190_c1
1564 nmdc:mga0n895_54180_c1
1565 nmdc:mga0n895_79582_c1
1566 nmdc:mga0n895_90049_c1
1567 nmdc:mga0rr50_101872_c1
1568 nmdc:mga0rr50_226868_c1
1569 nmdc:mga08x19_648132_c1
1570 nmdc:mga0a205_39612_c1
1571 nmdc:mga0a205_4439_c1
1572 Ga0495601_0103524
1573 Ga0500572_002697
1574 Ga0500622_0039109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20349

DUF6644

Family of unknown function (DUF6644)

40

196

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bfi-assembly1.cif.gz_A vinculin homolog in a sponge (phylum porifera) reveals vertebrate-like cell adhesions involved in early multicellular evolution 0.652 32 161
6s18-assembly1.cif.gz_A ligand binding domain of the p. putida receptor pcay_pp in complex with glycerol 0.6136 16 161
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.6054 27 165
5a7d-assembly4.cif.gz_N tetrameric assembly of lgn with inscuteable 0.6005 25 163
5a7d-assembly2.cif.gz_Q tetrameric assembly of lgn with inscuteable 0.5913 25 163
ID Description Score Start End Superfamily
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7028 28 156 3.10.20.90
af_Q54K81_983_1144_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.683 25 161 1.20.1420.10
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6727 28 156 3.10.20.90
af_G5EGK1_1982_2150_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6373 25 161 1.20.1420.10
af_G5EGK1_1860_1981_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6264 25 154 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A2V8GMI9-F1-model_v4 DUF6644 domain-containing protein 0.9532 2 168 GO:0016020
AF-A0A2V8NSJ2-F1-model_v4 DUF6644 domain-containing protein 0.9339 2 94 GO:0016020
AF-A0A1M3P5M1-F1-model_v4 DUF6644 domain-containing protein 0.9329 3 160 GO:0016020
AF-A0A524HWC5-F1-model_v4 DUF2214 domain-containing protein 0.9267 3 163 GO:0016020
AF-G4R731-F1-model_v4 DUF6644 domain-containing protein 0.9185 1 160 GO:0016020

Map