F480739

General Info

Members Datasets Scaffolds Average Seq Length
785 266 1570 174

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10348837|Ga0105245_103488372
Length 205
Sequence VGAGHAGRTPRRRGFRRDARADKVVAATPAIGEAAWGARAPRLRFLLVFSVILVALFAFQLTPPAQSAFVLPWTEALARISAGLITFFDSHVIVSGKVLQSTTNGFAISIEAGCNGIEAAIVLIAAMLAFPAPWKHRLTGIVAGLAAVQALNVVRVASLFYLGQWRAEIFDFAHLYVWQALIMFDVLIVWLIWMRTLPRRREAAP

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
206 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 3.18
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10348837 3300009098 Bacteria 1466
2 Ga0065712_10406382 3300005290 Bacteria 726
3 Ga0065715_10109547 3300005293 Bacteria 2664
4 Ga0065715_10275836 3300005293 Bacteria 1099
5 Ga0070658_10020938 3300005327 Bacteria 5238
6 Ga0070658_10070878 3300005327 Bacteria 2854
7 Ga0070658_10090942 3300005327 Bacteria 2515
8 Ga0070658_10224345 3300005327 Bacteria 1590
9 Ga0070658_10382411 3300005327 Bacteria 1208
10 Ga0070658_11162168 3300005327 Bacteria 671
11 Ga0070683_100053924 3300005329 Bacteria 3727
12 Ga0070683_100109491 3300005329 Bacteria 2606
13 Ga0070683_100149033 3300005329 Bacteria 2218
14 Ga0070683_100172022 3300005329 Bacteria 2056
15 Ga0070690_100025726 3300005330 Bacteria 3625
16 Ga0070670_100002981 3300005331 Bacteria 14015
17 Ga0070670_100490181 3300005331 Bacteria 1092
18 Ga0070670_101099450 3300005331 Bacteria 725
19 Ga0068869_100000434 3300005334 Bacteria 22808
20 Ga0068869_100011812 3300005334 Bacteria 5743
21 Ga0068869_100055439 3300005334 Bacteria 2889
22 Ga0070666_10025122 3300005335 Bacteria 3882
23 Ga0070666_10037202 3300005335 Unclassified 3235
24 Ga0070666_10223762 3300005335 Bacteria 1328
25 Ga0070666_10268782 3300005335 Bacteria 1210
26 Ga0070680_100135645 3300005336 Bacteria 2061
27 Ga0070680_100539109 3300005336 Bacteria 1000
28 Ga0070680_100664546 3300005336 Bacteria 896
29 Ga0070682_100021337 3300005337 Bacteria 3820
30 Ga0068868_100035315 3300005338 Bacteria 3864
31 Ga0068868_100119554 3300005338 Bacteria 2148
32 Ga0068868_100229707 3300005338 Bacteria 1556
33 Ga0068868_100693362 3300005338 Bacteria 910
34 Ga0068868_100804707 3300005338 Bacteria 848
35 Ga0068868_100914717 3300005338 Bacteria 798
36 Ga0070660_100019660 3300005339 Bacteria 4952
37 Ga0070660_100083319 3300005339 Bacteria 2512
38 Ga0070689_100019451 3300005340 Bacteria 5022
39 Ga0070689_100464292 3300005340 Bacteria 1079
40 Ga0070689_100493837 3300005340 Bacteria 1047
41 Ga0070691_10116036 3300005341 Bacteria 1343
42 Ga0070691_10241811 3300005341 Bacteria 965
43 Ga0070691_10264647 3300005341 Bacteria 927
44 Ga0070687_100081234 3300005343 Bacteria 1769
45 Ga0070661_100000621 3300005344 Bacteria 26402
46 Ga0070661_100003328 3300005344 Bacteria 11098
47 Ga0070661_100005384 3300005344 Bacteria 8821
48 Ga0070661_100047349 3300005344 Bacteria 3146
49 Ga0070668_100009736 3300005347 Bacteria 7126
50 Ga0070668_100015844 3300005347 Bacteria 5639
51 Ga0070668_100092699 3300005347 Unclassified 2383
52 Ga0070668_100127181 3300005347 Bacteria 2042
53 Ga0070668_100135722 3300005347 Bacteria 1979
54 Ga0070668_100235563 3300005347 Bacteria 1515
55 Ga0070668_100320952 3300005347 Bacteria 1304
56 Ga0070669_100009730 3300005353 Bacteria 6849
57 Ga0070669_100022747 3300005353 Bacteria 4482
58 Ga0070669_100031629 3300005353 Bacteria 3823
59 Ga0070669_100055916 3300005353 Bacteria 2892
60 Ga0070675_100033377 3300005354 Bacteria 4173
61 Ga0070675_100129714 3300005354 Bacteria 2147
62 Ga0070675_100134370 3300005354 Bacteria 2110
63 Ga0070675_100193339 3300005354 Bacteria 1764
64 Ga0070675_100563941 3300005354 Bacteria 1031
65 Ga0070675_100761660 3300005354 Bacteria 884
66 Ga0070671_100003277 3300005355 Bacteria 12629
67 Ga0070671_100165999 3300005355 Bacteria 1867
68 Ga0070671_100344539 3300005355 Bacteria 1271
69 Ga0070671_100555655 3300005355 Unclassified 990
70 Ga0070671_100801393 3300005355 Bacteria 820
71 Ga0070671_100886976 3300005355 Bacteria 779
72 Ga0070674_100012730 3300005356 Bacteria 5174
73 Ga0070674_100126614 3300005356 Bacteria 1898
74 Ga0070674_100146809 3300005356 Bacteria 1776
75 Ga0070674_100180717 3300005356 Bacteria 1615
76 Ga0070674_100226143 3300005356 Bacteria 1458
77 Ga0070674_100268380 3300005356 Bacteria 1347
78 Ga0070674_100829193 3300005356 Bacteria 801
79 Ga0070674_101323058 3300005356 Unclassified 643
80 Ga0070673_100043729 3300005364 Bacteria 3463
81 Ga0070673_100082455 3300005364 Bacteria 2610
82 Ga0070673_100106350 3300005364 Bacteria 2319
83 Ga0070673_100256435 3300005364 Bacteria 1526
84 Ga0070673_100798672 3300005364 Bacteria 871
85 Ga0070673_100899941 3300005364 Unclassified 821
86 Ga0070688_100182184 3300005365 Bacteria 1458
87 Ga0070688_100245658 3300005365 Unclassified 1272
88 Ga0070688_100336605 3300005365 Bacteria 1101
89 Ga0070659_100035259 3300005366 Bacteria 3895
90 Ga0070659_100045005 3300005366 Bacteria 3457
91 Ga0070659_100073054 3300005366 Bacteria 2730
92 Ga0070659_100152017 3300005366 Bacteria 1889
93 Ga0070659_100225843 3300005366 Bacteria 1546
94 Ga0070667_100000406 3300005367 Bacteria 46071
95 Ga0070667_100003566 3300005367 Bacteria 13255
96 Ga0070667_100171776 3300005367 Bacteria 1914
97 Ga0070667_100285960 3300005367 Bacteria 1482
98 Ga0070667_100662877 3300005367 Bacteria 964
99 Ga0070709_10015578 3300005434 Bacteria 4329
100 Ga0070709_10032175 3300005434 Bacteria 3161
101 Ga0070714_100012621 3300005435 Bacteria 6748
102 Ga0070714_100105207 3300005435 Bacteria 2491
103 Ga0070713_100021411 3300005436 Bacteria 4972
104 Ga0070713_100854414 3300005436 Bacteria 874
105 Ga0070710_10014981 3300005437 Bacteria 3913
106 Ga0070710_10216090 3300005437 Bacteria 1217
107 Ga0070701_10191001 3300005438 Bacteria 1205
108 Ga0070701_10323620 3300005438 Bacteria 955
109 Ga0070701_10369340 3300005438 Bacteria 901
110 Ga0070711_100088024 3300005439 Bacteria 2231
111 Ga0070705_100025241 3300005440 Bacteria 3219
112 Ga0070705_100283898 3300005440 Bacteria 1178
113 Ga0070700_100203054 3300005441 Bacteria 1393
114 Ga0070700_100450505 3300005441 Bacteria 979
115 Ga0070694_100014268 3300005444 Bacteria 4972
116 Ga0070708_100029734 3300005445 Bacteria 4715
117 Ga0070708_100207067 3300005445 Bacteria 1837
118 Ga0070663_100040566 3300005455 Bacteria 3260
119 Ga0070663_100110402 3300005455 Bacteria 2065
120 Ga0070663_100683462 3300005455 Bacteria 871
121 Ga0070678_100002838 3300005456 Bacteria 9583
122 Ga0070678_100083750 3300005456 Bacteria 2425
123 Ga0070678_100099518 3300005456 Bacteria 2250
124 Ga0070678_100142669 3300005456 Bacteria 1919
125 Ga0070678_100359143 3300005456 Bacteria 1255
126 Ga0070678_100948796 3300005456 Bacteria 788
127 Ga0070662_100023017 3300005457 Bacteria 4276
128 Ga0070662_100051274 3300005457 Bacteria 2979
129 Ga0070662_100234657 3300005457 Bacteria 1469
130 Ga0070681_10041295 3300005458 Bacteria 4623
131 Ga0070681_10113517 3300005458 Bacteria 2649
132 Ga0070681_10240294 3300005458 Unclassified 1725
133 Ga0070681_10247299 3300005458 Bacteria 1696
134 Ga0068867_100004907 3300005459 Bacteria 9417
135 Ga0068867_100070901 3300005459 Bacteria 2606
136 Ga0068867_100075257 3300005459 Bacteria 2532
137 Ga0068867_100210082 3300005459 Bacteria 1563
138 Ga0068867_100756359 3300005459 Bacteria 863
139 Ga0068867_101138174 3300005459 Bacteria 714
140 Ga0070685_10572563 3300005466 Bacteria 809
141 Ga0070706_100057617 3300005467 Bacteria 3585
142 Ga0070706_100164047 3300005467 Bacteria 2075
143 Ga0070707_100018512 3300005468 Bacteria 6553
144 Ga0070707_100043109 3300005468 Bacteria 4319
145 Ga0070698_100118890 3300005471 Bacteria 2604
146 Ga0070698_100128579 3300005471 Bacteria 2489
147 Ga0070698_100973623 3300005471 Unclassified 795
148 Ga0070699_100006764 3300005518 Bacteria 9973
149 Ga0070699_100009568 3300005518 Bacteria 8398
150 Ga0070699_100023288 3300005518 Bacteria 5334
151 Ga0070699_100296566 3300005518 Bacteria 1450
152 Ga0070679_100020157 3300005530 Bacteria 6498
153 Ga0070679_100023077 3300005530 Bacteria 6087
154 Ga0070679_100028166 3300005530 Bacteria 5537
155 Ga0070679_100065633 3300005530 Bacteria 3618
156 Ga0070679_100447726 3300005530 Bacteria 1236
157 Ga0070679_100691159 3300005530 Bacteria 963
158 Ga0070684_100020484 3300005535 Bacteria 5488
159 Ga0070684_100101347 3300005535 Bacteria 2573
160 Ga0070697_100037527 3300005536 Bacteria 3915
161 Ga0070697_100053375 3300005536 Bacteria 3285
162 Ga0070697_100774139 3300005536 Bacteria 848
163 Ga0068853_100006786 3300005539 Bacteria 9125
164 Ga0068853_100037196 3300005539 Bacteria 4141
165 Ga0068853_100062236 3300005539 Bacteria 3229
166 Ga0068853_100211199 3300005539 Bacteria 1769
167 Ga0070672_100002742 3300005543 Bacteria 11279
168 Ga0070672_100004597 3300005543 Bacteria 9037
169 Ga0070672_100036691 3300005543 Bacteria 3736
170 Ga0070672_100060649 3300005543 Bacteria 2979
171 Ga0070672_100144000 3300005543 Bacteria 1968
172 Ga0070672_100373545 3300005543 Unclassified 1219
173 Ga0070672_100471129 3300005543 Bacteria 1084
174 Ga0070695_100005169 3300005545 Bacteria 7695
175 Ga0070695_100290747 3300005545 Unclassified 1204
176 Ga0070696_100005811 3300005546 Bacteria 8237
177 Ga0070693_100042783 3300005547 Bacteria 2554
178 Ga0070693_100243091 3300005547 Bacteria 1190
179 Ga0070693_100353410 3300005547 Bacteria 1006
180 Ga0070693_100436059 3300005547 Bacteria 916
181 Ga0070665_100004484 3300005548 Bacteria 14665
182 Ga0070665_100013587 3300005548 Bacteria 8189
183 Ga0070665_100028645 3300005548 Bacteria 5608
184 Ga0070704_100018865 3300005549 Bacteria 4421
185 Ga0070704_100059550 3300005549 Bacteria 2725
186 Ga0068855_100007662 3300005563 Bacteria 13053
187 Ga0068855_100013893 3300005563 Bacteria 9711
188 Ga0068855_100033610 3300005563 Bacteria 6119
189 Ga0068855_100044646 3300005563 Bacteria 5244
190 Ga0068855_100150391 3300005563 Bacteria 2647
191 Ga0068855_100229378 3300005563 Bacteria 2080
192 Ga0068855_100252653 3300005563 Unclassified 1966
193 Ga0070664_100003211 3300005564 Bacteria 13208
194 Ga0070664_100028009 3300005564 Bacteria 4685
195 Ga0070664_100068871 3300005564 Bacteria 3026
196 Ga0070664_100081004 3300005564 Bacteria 2797
197 Ga0070664_100397095 3300005564 Bacteria 1260
198 Ga0070664_100439350 3300005564 Bacteria 1197
199 Ga0070664_100763561 3300005564 Bacteria 903
200 Ga0068857_100001177 3300005577 Bacteria 20436
201 Ga0068857_100005200 3300005577 Bacteria 11074
202 Ga0068857_100074629 3300005577 Bacteria 3022
203 Ga0068857_100722060 3300005577 Unclassified 948
204 Ga0068854_100014809 3300005578 Bacteria 5148
205 Ga0068854_100022094 3300005578 Bacteria 4327
206 Ga0068854_100111916 3300005578 Bacteria 2060
207 Ga0068854_100622547 3300005578 Bacteria 924
208 Ga0068854_100914618 3300005578 Bacteria 772
209 Ga0068856_100007456 3300005614 Bacteria 10676
210 Ga0068856_100127705 3300005614 Bacteria 2546
211 Ga0068856_100310306 3300005614 Bacteria 1595
212 Ga0070702_100112059 3300005615 Bacteria 1693
213 Ga0068852_100000520 3300005616 Bacteria 25338
214 Ga0068852_100013259 3300005616 Bacteria 6302
215 Ga0068852_100019491 3300005616 Bacteria 5371
216 Ga0068852_100023886 3300005616 Bacteria 4930
217 Ga0068852_100057471 3300005616 Bacteria 3366
218 Ga0068852_101037264 3300005616 Bacteria 839
219 Ga0068852_101754433 3300005616 Bacteria 643
220 Ga0068859_100000527 3300005617 Bacteria 37976
221 Ga0068859_100091574 3300005617 Bacteria 3091
222 Ga0068859_100430576 3300005617 Bacteria 1416
223 Ga0068859_100807043 3300005617 Bacteria 1026
224 Ga0068864_100002334 3300005618 Bacteria 15682
225 Ga0068864_100003671 3300005618 Bacteria 12686
226 Ga0068864_100070697 3300005618 Bacteria 3037
227 Ga0068864_100320942 3300005618 Bacteria 1455
228 Ga0068866_10021854 3300005718 Bacteria 2952
229 Ga0068861_100002417 3300005719 Bacteria 12165
230 Ga0068861_100056159 3300005719 Bacteria 3005
231 Ga0068861_100330188 3300005719 Bacteria 1331
232 Ga0068861_100351123 3300005719 Bacteria 1294
233 Ga0068851_10000990 3300005834 Bacteria 12293
234 Ga0068851_10015088 3300005834 Bacteria 3677
235 Ga0068851_10029146 3300005834 Bacteria 2731
236 Ga0068851_10109675 3300005834 Bacteria 1472
237 Ga0068870_10012867 3300005840 Bacteria 3918
238 Ga0068870_10625721 3300005840 Bacteria 734
239 Ga0068863_100001069 3300005841 Bacteria 27363
240 Ga0068863_100004647 3300005841 Bacteria 13535
241 Ga0068863_100040525 3300005841 Bacteria 4428
242 Ga0068863_100073692 3300005841 Bacteria 3230
243 Ga0068863_100188868 3300005841 Bacteria 1980
244 Ga0068863_100201897 3300005841 Bacteria 1913
245 Ga0068863_100225438 3300005841 Bacteria 1807
246 Ga0068863_100352371 3300005841 Bacteria 1434
247 Ga0068863_101098756 3300005841 Bacteria 800
248 Ga0068863_101584006 3300005841 Bacteria 664
249 Ga0068858_100003144 3300005842 Bacteria 16531
250 Ga0068858_100013017 3300005842 Bacteria 7846
251 Ga0068858_100019760 3300005842 Bacteria 6297
252 Ga0068858_100036390 3300005842 Bacteria 4565
253 Ga0068860_100000976 3300005843 Bacteria 31714
254 Ga0068860_100011703 3300005843 Bacteria 8648
255 Ga0068860_100044122 3300005843 Bacteria 4250
256 Ga0068860_100521229 3300005843 Bacteria 1188
257 Ga0068860_100539397 3300005843 Bacteria 1168
258 Ga0068860_100617306 3300005843 Bacteria 1091
259 Ga0068860_100751370 3300005843 Bacteria 987
260 Ga0068862_100004694 3300005844 Bacteria 11509
261 Ga0068862_100023742 3300005844 Bacteria 5140
262 Ga0068862_100031164 3300005844 Bacteria 4499
263 Ga0068862_100076153 3300005844 Bacteria 2903
264 Ga0068862_101026548 3300005844 Bacteria 817
265 Ga0070717_10110614 3300006028 Bacteria 2343
266 Ga0070716_100022522 3300006173 Bacteria 3331
267 Ga0070716_100054858 3300006173 Bacteria 2278
268 Ga0070716_100470630 3300006173 Bacteria 920
269 Ga0070712_100035277 3300006175 Bacteria 3395
270 Ga0070712_100077240 3300006175 Bacteria 2400
271 Ga0097621_100028801 3300006237 Bacteria 4380
272 Ga0097621_100044860 3300006237 Bacteria 3569
273 Ga0097621_100353148 3300006237 Bacteria 1308
274 Ga0097621_100471106 3300006237 Bacteria 1134
275 Ga0097621_100875284 3300006237 Bacteria 835
276 Ga0068871_100004879 3300006358 Bacteria 9368
277 Ga0068871_100033006 3300006358 Bacteria 4094
278 Ga0068871_100313814 3300006358 Bacteria 1379
279 Ga0068871_100579009 3300006358 Bacteria 1019
280 Ga0068871_100911470 3300006358 Unclassified 815
281 Ga0068871_100946063 3300006358 Bacteria 800
282 Ga0075433_10012647 3300006852 Bacteria 6827
283 Ga0075433_10671168 3300006852 Bacteria 908
284 Ga0075434_100029350 3300006871 Bacteria 5409
285 Ga0075434_100235414 3300006871 Bacteria 1851
286 Ga0068865_100058694 3300006881 Bacteria 2689
287 Ga0068865_100113832 3300006881 Bacteria 2000
288 Ga0068865_100420226 3300006881 Bacteria 1099
289 Ga0068865_100610091 3300006881 Bacteria 923
290 Ga0075436_100046139 3300006914 Bacteria 3005
291 Ga0075436_100132039 3300006914 Bacteria 1751
292 Ga0075436_100754054 3300006914 Bacteria 723
293 Ga0075436_100870479 3300006914 Bacteria 673
294 Ga0097620_100000527 3300006931 Bacteria 37976
295 Ga0097620_100091580 3300006931 Bacteria 3091
296 Ga0097620_100430569 3300006931 Bacteria 1416
297 Ga0097620_100806869 3300006931 Bacteria 1026
298 Ga0097620_100994752 3300006931 Unclassified 921
299 Ga0075435_100004089 3300007076 Bacteria 9989
300 Ga0105240_10002235 3300009093 Bacteria 31494
301 Ga0105240_10025340 3300009093 Bacteria 7796
302 Ga0105240_10037583 3300009093 Bacteria 6221
303 Ga0105240_10041168 3300009093 Bacteria 5900
304 Ga0105240_10048099 3300009093 Bacteria 5392
305 Ga0105240_10081295 3300009093 Bacteria 3982
306 Ga0105240_10124122 3300009093 Bacteria 3106
307 Ga0105240_10176344 3300009093 Bacteria 2527
308 Ga0105240_11910449 3300009093 Bacteria 618
309 Ga0105245_10024377 3300009098 Bacteria 5312
310 Ga0105245_10269080 3300009098 Bacteria 1661
311 Ga0105245_10892759 3300009098 Bacteria 930
312 Ga0105247_10511961 3300009101 Bacteria 876
313 Ga0114129_11071734 3300009147 Bacteria 1010
314 Ga0105243_10145103 3300009148 Bacteria 2030
315 Ga0105243_10618601 3300009148 Bacteria 1045
316 Ga0105241_10234081 3300009174 Bacteria 1550
317 Ga0105242_10047328 3300009176 Bacteria 3492
318 Ga0105242_10179876 3300009176 Bacteria 1865
319 Ga0105248_10053255 3300009177 Bacteria 4541
320 Ga0105248_10149778 3300009177 Bacteria 2632
321 Ga0105248_10282968 3300009177 Bacteria 1867
322 Ga0105248_10285226 3300009177 Bacteria 1859
323 Ga0105248_10667750 3300009177 Bacteria 1173
324 Ga0105248_10830164 3300009177 Bacteria 1043
325 Ga0105237_10096187 3300009545 Bacteria 2952
326 Ga0105237_10102484 3300009545 Bacteria 2854
327 Ga0105237_10118122 3300009545 Bacteria 2646
328 Ga0105237_10541915 3300009545 Bacteria 1170
329 Ga0105237_10625296 3300009545 Bacteria 1084
330 Ga0105238_10002149 3300009551 Bacteria 19936
331 Ga0105238_10061075 3300009551 Bacteria 3772
332 Ga0105238_10090052 3300009551 Bacteria 3055
333 Ga0105238_10356754 3300009551 Bacteria 1451
334 Ga0105249_10041463 3300009553 Bacteria 4185
335 Ga0105249_11459345 3300009553 Bacteria 756
336 Ga0105239_10172738 3300010375 Bacteria 2417
337 Ga0105246_10072385 3300011119 Bacteria 2430
338 Ga0157373_10030841 3300013100 Bacteria 3857
339 Ga0157373_10097954 3300013100 Bacteria 2064
340 Ga0157373_10230888 3300013100 Bacteria 1307
341 Ga0157373_10504489 3300013100 Bacteria 874
342 Ga0157371_10000446 3300013102 Bacteria 50636
343 Ga0157371_10327178 3300013102 Bacteria 1113
344 Ga0157371_10547789 3300013102 Bacteria 857
345 Ga0157370_10003163 3300013104 Bacteria 19485
346 Ga0157370_10007756 3300013104 Bacteria 11632
347 Ga0157370_10017646 3300013104 Bacteria 7196
348 Ga0157370_10018910 3300013104 Bacteria 6927
349 Ga0157370_10040315 3300013104 Bacteria 4509
350 Ga0157370_10052450 3300013104 Bacteria 3894
351 Ga0157370_10857287 3300013104 Bacteria 825
352 Ga0157369_10007686 3300013105 Bacteria 12401
353 Ga0157369_10069403 3300013105 Bacteria 3786
354 Ga0157369_10116409 3300013105 Bacteria 2838
355 Ga0157369_10148429 3300013105 Bacteria 2479
356 Ga0157369_10649533 3300013105 Bacteria 1088
357 Ga0157369_10775279 3300013105 Bacteria 986
358 Ga0157374_10092129 3300013296 Bacteria 2891
359 Ga0157374_10225479 3300013296 Bacteria 1840
360 Ga0157378_10007398 3300013297 Bacteria 9591
361 Ga0157378_10025287 3300013297 Bacteria 5229
362 Ga0157378_10096286 3300013297 Bacteria 2697
363 Ga0157378_10164656 3300013297 Bacteria 2076
364 Ga0157378_10741988 3300013297 Bacteria 1004
365 Ga0157378_10949979 3300013297 Bacteria 892
366 Ga0163162_10038163 3300013306 Bacteria 4794
367 Ga0163162_10077511 3300013306 Bacteria 3388
368 Ga0163162_10119444 3300013306 Bacteria 2739
369 Ga0163162_10645153 3300013306 Bacteria 1183
370 Ga0157372_10000523 3300013307 Bacteria 42408
371 Ga0157372_10007100 3300013307 Bacteria 11937
372 Ga0157372_10018755 3300013307 Bacteria 7444
373 Ga0157372_10036033 3300013307 Bacteria 5451
374 Ga0157372_10145850 3300013307 Bacteria 2729
375 Ga0157372_10146512 3300013307 Bacteria 2723
376 Ga0157372_10169141 3300013307 Bacteria 2528
377 Ga0157372_10200368 3300013307 Bacteria 2312
378 Ga0157372_10320061 3300013307 Bacteria 1806
379 Ga0157372_10525504 3300013307 Bacteria 1379
380 Ga0157372_10527911 3300013307 Bacteria 1376
381 Ga0157372_11142707 3300013307 Bacteria 901
382 Ga0157372_11184833 3300013307 Bacteria 883
383 Ga0157375_10000680 3300013308 Bacteria 30126
384 Ga0157375_10079965 3300013308 Bacteria 3306
385 Ga0157375_10208081 3300013308 Bacteria 2113
386 Ga0157375_10247458 3300013308 Bacteria 1943
387 Ga0163163_10003067 3300014325 Bacteria 14142
388 Ga0163163_10031909 3300014325 Bacteria 5088
389 Ga0163163_10179234 3300014325 Bacteria 2166
390 Ga0163163_10201345 3300014325 Bacteria 2039
391 Ga0163163_10917461 3300014325 Bacteria 939
392 Ga0157380_10031183 3300014326 Bacteria 4091
393 Ga0157380_10110539 3300014326 Bacteria 2308
394 Ga0157380_10363515 3300014326 Bacteria 1359
395 Ga0157380_10564602 3300014326 Bacteria 1119
396 Ga0157380_10943015 3300014326 Bacteria 892
397 Ga0157380_11209103 3300014326 Unclassified 800
398 Ga0182008_10129667 3300014497 Bacteria 1257
399 Ga0182008_10175444 3300014497 Bacteria 1083
400 Ga0157379_10000642 3300014968 Bacteria 28206
401 Ga0157379_10028110 3300014968 Bacteria 5005
402 Ga0157379_10144354 3300014968 Bacteria 2146
403 Ga0157379_10267055 3300014968 Bacteria 1555
404 Ga0157379_10461793 3300014968 Bacteria 1173
405 Ga0157376_10125957 3300014969 Bacteria 2278
406 Ga0157376_10490038 3300014969 Bacteria 1206
407 Ga0157376_10863061 3300014969 Unclassified 921
408 Ga0157376_11059540 3300014969 Bacteria 835
409 Ga0163161_10035171 3300017792 Bacteria 3585
410 Ga0163161_10134175 3300017792 Bacteria 1870
411 Ga0163161_10143581 3300017792 Bacteria 1809
412 Ga0163161_10756145 3300017792 Bacteria 813
413 Ga0207656_10004900 3300025321 Bacteria 4699
414 Ga0207656_10021068 3300025321 Bacteria 2599
415 Ga0207656_10059040 3300025321 Bacteria 1678
416 Ga0207682_10076870 3300025893 Bacteria 1423
417 Ga0207692_10080950 3300025898 Bacteria 1737
418 Ga0207692_10111942 3300025898 Bacteria 1515
419 Ga0207688_10229999 3300025901 Bacteria 1119
420 Ga0207680_10156625 3300025903 Bacteria 1524
421 Ga0207680_10278494 3300025903 Bacteria 1162
422 Ga0207680_10284935 3300025903 Bacteria 1149
423 Ga0207680_10347887 3300025903 Bacteria 1041
424 Ga0207680_10368432 3300025903 Bacteria 1011
425 Ga0207680_10564789 3300025903 Bacteria 813
426 Ga0207699_10012608 3300025906 Bacteria 4304
427 Ga0207699_10097816 3300025906 Bacteria 1855
428 Ga0207699_10239839 3300025906 Bacteria 1245
429 Ga0207645_10007338 3300025907 Bacteria 7793
430 Ga0207645_10246959 3300025907 Bacteria 1180
431 Ga0207643_10546586 3300025908 Bacteria 743
432 Ga0207705_10013769 3300025909 Bacteria 5833
433 Ga0207705_10106227 3300025909 Bacteria 2070
434 Ga0207705_10317630 3300025909 Bacteria 1197
435 Ga0207705_10663016 3300025909 Bacteria 811
436 Ga0207684_10067891 3300025910 Bacteria 3030
437 Ga0207684_10150370 3300025910 Bacteria 2003
438 Ga0207684_10165360 3300025910 Bacteria 1906
439 Ga0207684_10971654 3300025910 Bacteria 711
440 Ga0207654_10093000 3300025911 Bacteria 1843
441 Ga0207707_10005481 3300025912 Bacteria 11094
442 Ga0207707_10026650 3300025912 Bacteria 5052
443 Ga0207707_10112215 3300025912 Bacteria 2383
444 Ga0207707_10189803 3300025912 Bacteria 1793
445 Ga0207707_10210600 3300025912 Unclassified 1693
446 Ga0207707_10624688 3300025912 Bacteria 910
447 Ga0207695_10045039 3300025913 Bacteria 4687
448 Ga0207695_10151943 3300025913 Unclassified 2254
449 Ga0207695_10226213 3300025913 Bacteria 1777
450 Ga0207695_10382593 3300025913 Bacteria 1293
451 Ga0207695_10610936 3300025913 Bacteria 971
452 Ga0207671_10144636 3300025914 Bacteria 1834
453 Ga0207671_10161688 3300025914 Bacteria 1734
454 Ga0207671_11210634 3300025914 Unclassified 590
455 Ga0207693_10010112 3300025915 Bacteria 7664
456 Ga0207693_10061765 3300025915 Bacteria 2935
457 Ga0207693_10601761 3300025915 Bacteria 856
458 Ga0207663_10073535 3300025916 Bacteria 2212
459 Ga0207660_10103512 3300025917 Bacteria 2130
460 Ga0207660_10409542 3300025917 Bacteria 1093
461 Ga0207660_10474843 3300025917 Bacteria 1013
462 Ga0207662_10309976 3300025918 Bacteria 1051
463 Ga0207657_10002525 3300025919 Bacteria 19797
464 Ga0207657_10059947 3300025919 Bacteria 3268
465 Ga0207657_10101040 3300025919 Bacteria 2394
466 Ga0207657_10112265 3300025919 Bacteria 2249
467 Ga0207657_10520108 3300025919 Bacteria 931
468 Ga0207649_10001721 3300025920 Bacteria 12585
469 Ga0207649_10016257 3300025920 Bacteria 4192
470 Ga0207649_10048099 3300025920 Bacteria 2629
471 Ga0207649_10087186 3300025920 Bacteria 2035
472 Ga0207649_10212698 3300025920 Bacteria 1373
473 Ga0207649_10652748 3300025920 Bacteria 813
474 Ga0207652_10051495 3300025921 Bacteria 3530
475 Ga0207652_10068796 3300025921 Bacteria 3072
476 Ga0207652_10376235 3300025921 Bacteria 1282
477 Ga0207652_10531645 3300025921 Bacteria 1057
478 Ga0207652_10544389 3300025921 Bacteria 1043
479 Ga0207652_10560562 3300025921 Bacteria 1026
480 Ga0207646_10046160 3300025922 Bacteria 3909
481 Ga0207646_10071962 3300025922 Bacteria 3088
482 Ga0207646_10450870 3300025922 Bacteria 1161
483 Ga0207681_10007056 3300025923 Bacteria 6893
484 Ga0207681_10014545 3300025923 Bacteria 4893
485 Ga0207681_10033621 3300025923 Bacteria 3364
486 Ga0207694_10010599 3300025924 Bacteria 6959
487 Ga0207694_10311206 3300025924 Bacteria 1298
488 Ga0207650_10002151 3300025925 Bacteria 13770
489 Ga0207650_10013458 3300025925 Bacteria 5665
490 Ga0207650_10114892 3300025925 Bacteria 2088
491 Ga0207659_10109516 3300025926 Bacteria 2097
492 Ga0207659_10229250 3300025926 Bacteria 1497
493 Ga0207687_10111652 3300025927 Bacteria 2030
494 Ga0207700_10053793 3300025928 Bacteria 3018
495 Ga0207700_10084596 3300025928 Bacteria 2487
496 Ga0207664_10001100 3300025929 Bacteria 18018
497 Ga0207664_10012064 3300025929 Bacteria 6171
498 Ga0207664_10014597 3300025929 Bacteria 5679
499 Ga0207664_10560469 3300025929 Bacteria 1025
500 Ga0207644_10013227 3300025931 Bacteria 5497
501 Ga0207644_10067870 3300025931 Bacteria 2600
502 Ga0207644_10186233 3300025931 Bacteria 1630
503 Ga0207644_10938931 3300025931 Bacteria 725
504 Ga0207644_10993345 3300025931 Bacteria 704
505 Ga0207690_10012955 3300025932 Bacteria 4998
506 Ga0207690_10101109 3300025932 Bacteria 2059
507 Ga0207690_10165448 3300025932 Bacteria 1652
508 Ga0207690_10204872 3300025932 Bacteria 1501
509 Ga0207690_10298847 3300025932 Bacteria 1259
510 Ga0207690_10315484 3300025932 Bacteria 1227
511 Ga0207690_10350909 3300025932 Bacteria 1166
512 Ga0207706_10029884 3300025933 Bacteria 4864
513 Ga0207706_10056537 3300025933 Bacteria 3459
514 Ga0207706_10061827 3300025933 Bacteria 3298
515 Ga0207686_10186698 3300025934 Bacteria 1474
516 Ga0207709_10316558 3300025935 Bacteria 1166
517 Ga0207709_10371270 3300025935 Bacteria 1086
518 Ga0207670_10146820 3300025936 Bacteria 1745
519 Ga0207670_10348901 3300025936 Bacteria 1171
520 Ga0207669_10028475 3300025937 Bacteria 3074
521 Ga0207669_10079672 3300025937 Bacteria 2092
522 Ga0207669_10092531 3300025937 Bacteria 1973
523 Ga0207669_10260950 3300025937 Bacteria 1296
524 Ga0207669_10693562 3300025937 Bacteria 836
525 Ga0207704_10025334 3300025938 Bacteria 3235
526 Ga0207704_10029020 3300025938 Bacteria 3078
527 Ga0207704_10304283 3300025938 Bacteria 1223
528 Ga0207704_10405430 3300025938 Bacteria 1077
529 Ga0207665_10019417 3300025939 Bacteria 4468
530 Ga0207691_10000958 3300025940 Bacteria 28614
531 Ga0207691_10004360 3300025940 Bacteria 13720
532 Ga0207691_10060919 3300025940 Bacteria 3428
533 Ga0207691_10099855 3300025940 Bacteria 2591
534 Ga0207691_10209861 3300025940 Bacteria 1692
535 Ga0207691_10565455 3300025940 Bacteria 964
536 Ga0207711_10008335 3300025941 Bacteria 8675
537 Ga0207711_10143382 3300025941 Bacteria 2150
538 Ga0207711_10175105 3300025941 Bacteria 1949
539 Ga0207689_10000421 3300025942 Bacteria 39749
540 Ga0207689_10008322 3300025942 Bacteria 9036
541 Ga0207689_10012711 3300025942 Bacteria 7192
542 Ga0207689_10175515 3300025942 Bacteria 1767
543 Ga0207661_10038609 3300025944 Bacteria 3744
544 Ga0207661_10634711 3300025944 Bacteria 981
545 Ga0207661_11209534 3300025944 Bacteria 695
546 Ga0207679_10005652 3300025945 Bacteria 7842
547 Ga0207679_10034979 3300025945 Bacteria 3550
548 Ga0207679_10087837 3300025945 Bacteria 2395
549 Ga0207679_10093546 3300025945 Bacteria 2332
550 Ga0207679_10096481 3300025945 Bacteria 2300
551 Ga0207679_10688424 3300025945 Bacteria 927
552 Ga0207667_10009110 3300025949 Bacteria 11729
553 Ga0207667_10015818 3300025949 Bacteria 8550
554 Ga0207667_10043973 3300025949 Bacteria 4736
555 Ga0207667_10082346 3300025949 Bacteria 3334
556 Ga0207667_10254369 3300025949 Bacteria 1797
557 Ga0207667_10404571 3300025949 Bacteria 1390
558 Ga0207667_10409093 3300025949 Bacteria 1381
559 Ga0207667_10475790 3300025949 Bacteria 1268
560 Ga0207667_10838196 3300025949 Bacteria 914
561 Ga0207651_10203180 3300025960 Bacteria 1589
562 Ga0207651_10329119 3300025960 Bacteria 1280
563 Ga0207651_10772745 3300025960 Bacteria 850
564 Ga0207712_10211032 3300025961 Bacteria 1546
565 Ga0207668_10005211 3300025972 Bacteria 7650
566 Ga0207668_10018692 3300025972 Bacteria 4368
567 Ga0207668_10026888 3300025972 Bacteria 3743
568 Ga0207668_10037549 3300025972 Bacteria 3243
569 Ga0207668_10077087 3300025972 Unclassified 2402
570 Ga0207668_10658342 3300025972 Bacteria 917
571 Ga0207640_10024047 3300025981 Bacteria 3670
572 Ga0207640_10059529 3300025981 Bacteria 2521
573 Ga0207640_10104314 3300025981 Bacteria 1995
574 Ga0207640_10158548 3300025981 Bacteria 1671
575 Ga0207658_10001847 3300025986 Bacteria 15858
576 Ga0207658_10053434 3300025986 Bacteria 2985
577 Ga0207658_10102479 3300025986 Bacteria 2245
578 Ga0207658_10250327 3300025986 Bacteria 1505
579 Ga0207658_10251502 3300025986 Bacteria 1502
580 Ga0207658_10308845 3300025986 Bacteria 1365
581 Ga0207658_10311722 3300025986 Unclassified 1359
582 Ga0207658_10435540 3300025986 Bacteria 1158
583 Ga0207658_10435696 3300025986 Bacteria 1158
584 Ga0207677_10027808 3300026023 Bacteria 3569
585 Ga0207677_10027875 3300026023 Bacteria 3565
586 Ga0207677_10033868 3300026023 Bacteria 3301
587 Ga0207677_10703140 3300026023 Bacteria 897
588 Ga0207677_10756066 3300026023 Bacteria 867
589 Ga0207677_10764226 3300026023 Bacteria 862
590 Ga0207703_10000854 3300026035 Bacteria 29884
591 Ga0207703_10015810 3300026035 Bacteria 5886
592 Ga0207703_10034964 3300026035 Bacteria 3991
593 Ga0207703_10062700 3300026035 Bacteria 3045
594 Ga0207703_10718472 3300026035 Bacteria 951
595 Ga0207639_10026145 3300026041 Bacteria 4240
596 Ga0207639_10064511 3300026041 Bacteria 2840
597 Ga0207639_10092066 3300026041 Bacteria 2429
598 Ga0207639_10202981 3300026041 Bacteria 1702
599 Ga0207639_10213604 3300026041 Bacteria 1662
600 Ga0207678_10063362 3300026067 Bacteria 3177
601 Ga0207678_10475302 3300026067 Bacteria 1088
602 Ga0207708_10066281 3300026075 Bacteria 2761
603 Ga0207708_10503412 3300026075 Bacteria 1015
604 Ga0207708_10818366 3300026075 Bacteria 803
605 Ga0207702_10082263 3300026078 Bacteria 2799
606 Ga0207702_10392122 3300026078 Bacteria 1337
607 Ga0207702_11126741 3300026078 Bacteria 779
608 Ga0207641_10007366 3300026088 Bacteria 9162
609 Ga0207641_10017490 3300026088 Bacteria 5869
610 Ga0207641_10032524 3300026088 Bacteria 4330
611 Ga0207641_10075421 3300026088 Bacteria 2912
612 Ga0207641_10648359 3300026088 Bacteria 1037
613 Ga0207641_10928518 3300026088 Bacteria 865
614 Ga0207641_11121200 3300026088 Bacteria 785
615 Ga0207648_10004322 3300026089 Bacteria 14629
616 Ga0207648_10006864 3300026089 Bacteria 11285
617 Ga0207648_10043305 3300026089 Bacteria 3952
618 Ga0207648_10057065 3300026089 Bacteria 3407
619 Ga0207648_10059275 3300026089 Bacteria 3338
620 Ga0207648_10478511 3300026089 Bacteria 1137
621 Ga0207648_10542125 3300026089 Bacteria 1068
622 Ga0207676_10000633 3300026095 Bacteria 28376
623 Ga0207676_10016406 3300026095 Bacteria 5363
624 Ga0207676_10984187 3300026095 Bacteria 830
625 Ga0207676_11063705 3300026095 Bacteria 799
626 Ga0207674_10000912 3300026116 Bacteria 38502
627 Ga0207674_10008221 3300026116 Bacteria 12092
628 Ga0207674_10012315 3300026116 Bacteria 9563
629 Ga0207674_10074855 3300026116 Bacteria 3397
630 Ga0207674_10241306 3300026116 Bacteria 1754
631 Ga0207674_10347316 3300026116 Bacteria 1434
632 Ga0207675_100000658 3300026118 Bacteria 33969
633 Ga0207675_100036546 3300026118 Bacteria 4581
634 Ga0207675_100055366 3300026118 Bacteria 3700
635 Ga0207675_100084413 3300026118 Bacteria 2980
636 Ga0207675_100388554 3300026118 Bacteria 1373
637 Ga0207683_10014462 3300026121 Bacteria 6719
638 Ga0207683_10027569 3300026121 Bacteria 4908
639 Ga0207683_10082583 3300026121 Bacteria 2855
640 Ga0207683_10145486 3300026121 Bacteria 2137
641 Ga0207683_10169294 3300026121 Bacteria 1978
642 Ga0207683_10189547 3300026121 Bacteria 1867
643 Ga0207683_10680013 3300026121 Bacteria 954
644 Ga0207698_10001520 3300026142 Bacteria 13515
645 Ga0207698_10133937 3300026142 Bacteria 2122
646 Ga0207698_10197763 3300026142 Bacteria 1797
647 Ga0207698_10329185 3300026142 Bacteria 1434
648 Ga0210000_1020299 3300027462 Unclassified 1014
649 Ga0209971_1039670 3300027682 Bacteria 1133
650 Ga0209974_10010972 3300027876 Bacteria 3050
651 Ga0209974_10022904 3300027876 Bacteria 2067
652 Ga0268266_10005997 3300028379 Bacteria 11215
653 Ga0268266_10338608 3300028379 Bacteria 1412
654 Ga0268265_10007093 3300028380 Bacteria 7572
655 Ga0268265_10010460 3300028380 Bacteria 6267
656 Ga0268265_11177118 3300028380 Bacteria 763
657 Ga0268265_11278807 3300028380 Bacteria 733
658 Ga0268264_10000967 3300028381 Bacteria 29459
659 Ga0268264_10016520 3300028381 Bacteria 6042
660 Ga0268264_10137061 3300028381 Bacteria 2177
661 Ga0268264_10376043 3300028381 Bacteria 1359
662 Ga0268264_10417290 3300028381 Bacteria 1293
663 Ga0307408_100054663 3300031548 Bacteria 2887
664 Ga0307408_100873382 3300031548 Bacteria 821
665 Ga0307413_10016348 3300031824 Bacteria 3830
666 Ga0307410_10010404 3300031852 Bacteria 5266
667 Ga0307406_10005433 3300031901 Bacteria 6973
668 Ga0307412_10055773 3300031911 Bacteria 2630
669 Ga0307409_100974101 3300031995 Bacteria 865
670 Ga0307416_100540983 3300032002 Bacteria 1236
671 Ga0307414_10021760 3300032004 Bacteria 4033
672 Ga0307411_10023149 3300032005 Bacteria 3673
673 Ga0373926_0049359 3300035083 Bacteria 1516
674 Ga0373923_0305937 3300035111 Bacteria 753
675 Ga0373936_0243680 3300035113 Bacteria 802
676 Ga0373945_0140727 3300035116 Bacteria 973
677 Ga0373943_0008870 3300035170 Bacteria 4504
678 Ga0373946_0026666 3300035171 Bacteria 2281
679 Ga0373955_0440477 3300035172 Bacteria 794
680 Ga0373924_0184428 3300035410 Bacteria 919
681 Ga0373931_0095849 3300035691 Bacteria 1661
682 Ga0373931_0263084 3300035691 Bacteria 1053
683 Ga0373935_0018180 3300035692 Bacteria 4273
684 Ga0373935_0241556 3300035692 Bacteria 1261
685 Ga0373927_0022553 3300035695 Bacteria 4124
686 Ga0373927_0073141 3300035695 Bacteria 2219
687 Ga0373933_0090391 3300035724 Bacteria 1888
688 Ga0373947_0226585 3300035725 Bacteria 1230
689 Ga0373937_0008259 3300036401 Bacteria 9038
690 Ga0373937_0699115 3300036401 Bacteria 960
691 Ga0373925_0010870 3300037068 Bacteria 6601
692 Ga0373925_0026320 3300037068 Bacteria 4256
693 Ga0373925_0043611 3300037068 Bacteria 3330
694 Ga0395900_1248256 3300037418 Unclassified 658
695 Ga0400490_29567 3300038726 Bacteria 27216
696 Ga0400488_52598 3300038741 Bacteria 2148
697 Ga0400483_002297 3300039062 Bacteria 13613
698 Ga0400487_05475 3300039110 Bacteria 24491
699 Ga0400487_24255 3300039110 Bacteria 1337
700 Ga0436365_1721370 3300039437 Bacteria 1584
701 Ga0451853_2225107 3300041512 Bacteria 1861
702 Ga0451577_0545578 3300042876 Bacteria 1053
703 Ga0466964_0744278 3300044706 Unclassified 550
704 Ga0451576_1353373 3300045051 Bacteria 742
705 Ga0495629_0185834 3300046459 Bacteria 1439
706 Ga0495651_0156443 3300046462 Bacteria 1638
707 Ga0495580_0070489 3300046472 Bacteria 2442
708 Ga0495580_0072026 3300046472 Bacteria 2414
709 Ga0495580_0138485 3300046472 Bacteria 1687
710 Ga0495580_0274542 3300046472 Bacteria 1151
711 Ga0495582_0002672 3300046473 Bacteria 9950
712 Ga0495639_0024562 3300046475 Bacteria 2653
713 Ga0495662_0055671 3300046476 Bacteria 1910
714 Ga0495640_0153233 3300046533 Bacteria 1480
715 Ga0495587_0426630 3300046536 Bacteria 736
716 Ga0495645_0066686 3300046543 Bacteria 2600
717 Ga0495634_0192980 3300046642 Bacteria 1269
718 Ga0495635_0034656 3300046663 Bacteria 3501
719 Ga0495647_0001749 3300046681 Bacteria 6731
720 Ga0495658_0054530 3300046683 Bacteria 2275
721 Ga0495658_0478417 3300046683 Bacteria 796
722 Ga0495669_0416744 3300046684 Bacteria 651
723 Ga0495613_0005569 3300046689 Bacteria 9454
724 Ga0495600_0020250 3300046809 Bacteria 4255
725 Ga0495581_0001180 3300047315 Bacteria 14330
726 Ga0495680_0339212 3300047322 Bacteria 1048
727 Ga0495684_0007836 3300047471 Bacteria 8265
728 Ga0495593_0057578 3300047673 Bacteria 2040
729 Ga0495614_0007107 3300048089 Bacteria 4993
730 Ga0496102_0029757 3300048905 Bacteria 4887
731 Ga0496102_0123717 3300048905 Bacteria 2417
732 Ga0496102_0416108 3300048905 Bacteria 1263
733 Ga0496103_0038093 3300048906 Bacteria 2948
734 Ga0496103_0045503 3300048906 Bacteria 2708
735 Ga0496104_0002295 3300048907 Bacteria 16497
736 Ga0496106_0035998 3300048909 Bacteria 3703
737 Ga0496106_0119821 3300048909 Bacteria 2056
738 Ga0496107_0038444 3300048910 Bacteria 3432
739 Ga0496107_0654793 3300048910 Bacteria 774
740 Ga0496108_0034605 3300048911 Bacteria 4198
741 Ga0496108_0147829 3300048911 Bacteria 2027
742 Ga0496109_0309874 3300048912 Bacteria 1489
743 Ga0496109_0435753 3300048912 Bacteria 1238
744 Ga0496109_0634411 3300048912 Bacteria 1005
745 Ga0496109_1293690 3300048912 Bacteria 665
746 Ga0496110_0300589 3300048913 Unclassified 1462
747 Ga0496111_0166450 3300048914 Bacteria 1637
748 Ga0496111_0245241 3300048914 Bacteria 1330
749 Ga0496112_0006765 3300048915 Bacteria 10101
750 Ga0496112_0880543 3300048915 Bacteria 818
751 Ga0496113_0594757 3300048916 Bacteria 886
752 Ga0496113_0784939 3300048916 Bacteria 757
753 Ga0496114_0300566 3300048917 Bacteria 1417
754 Ga0496115_0046184 3300048918 Bacteria 3480
755 Ga0501034_0093780 3300049571 Bacteria 2999
756 Ga0501047_0550450 3300049581 Bacteria 978
757 Ga0501047_0636229 3300049581 Bacteria 887
758 Ga0501067_0214334 3300049583 Bacteria 1072
759 Ga0501070_0015286 3300049586 Bacteria 6458
760 Ga0501070_0035038 3300049586 Bacteria 4195
761 Ga0501073_0005535 3300049589 Bacteria 9453
762 Ga0501080_0007043 3300049742 Bacteria 10153
763 Ga0501083_0036111 3300049744 Bacteria 3372
764 Ga0501035_0160671 3300049822 Bacteria 1945
765 Ga0501035_0238929 3300049822 Unclassified 1546
766 Ga0501044_0496686 3300049823 Bacteria 1122
767 Ga0501044_0941955 3300049823 Bacteria 737
768 nmdc:mga05p37_940172_c1 3300050507 Bacteria 927
769 nmdc:mga0n895_111856_c1 3300050512 Bacteria 2748
770 nmdc:mga0n895_1610808_c1 3300050512 Bacteria 613
771 nmdc:mga0n895_318850_c1 3300050512 Bacteria 1575
772 nmdc:mga0n895_497446_c1 3300050512 Bacteria 1228
773 nmdc:mga0rr50_105327_c1 3300050513 Bacteria 2224
774 nmdc:mga08x19_270610_c1 3300050514 Bacteria 1176
775 nmdc:mga08x19_388908_c1 3300050514 Bacteria 977
776 nmdc:mga08x19_39040_c1 3300050514 Bacteria 3017
777 nmdc:mga08x19_449665_c1 3300050514 Bacteria 907
778 nmdc:mga08x19_874930_c1 3300050514 Bacteria 638
779 nmdc:mga0a205_235004_c1 3300050515 Bacteria 1715
780 nmdc:mga0a205_5608_c1 3300050515 Bacteria 7832
781 Ga0495601_0645919 3300053077 Unclassified 677
782 Ga0495595_0144809 3300053084 Bacteria 1167
783 Ga0495619_0027584 3300053085 Bacteria 3658
784 Ga0501084_0028865 3300054114 Bacteria 4639
785 Ga0500661_007242 3300055283 Bacteria 2058
786 Ga0105245_10348837
787 Ga0065712_10406382
788 Ga0065715_10109547
789 Ga0065715_10275836
790 Ga0070658_10020938
791 Ga0070658_10070878
792 Ga0070658_10090942
793 Ga0070658_10224345
794 Ga0070658_10382411
795 Ga0070658_11162168
796 Ga0070683_100053924
797 Ga0070683_100109491
798 Ga0070683_100149033
799 Ga0070683_100172022
800 Ga0070690_100025726
801 Ga0070670_100002981
802 Ga0070670_100490181
803 Ga0070670_101099450
804 Ga0068869_100000434
805 Ga0068869_100011812
806 Ga0068869_100055439
807 Ga0070666_10025122
808 Ga0070666_10037202
809 Ga0070666_10223762
810 Ga0070666_10268782
811 Ga0070680_100135645
812 Ga0070680_100539109
813 Ga0070680_100664546
814 Ga0070682_100021337
815 Ga0068868_100035315
816 Ga0068868_100119554
817 Ga0068868_100229707
818 Ga0068868_100693362
819 Ga0068868_100804707
820 Ga0068868_100914717
821 Ga0070660_100019660
822 Ga0070660_100083319
823 Ga0070689_100019451
824 Ga0070689_100464292
825 Ga0070689_100493837
826 Ga0070691_10116036
827 Ga0070691_10241811
828 Ga0070691_10264647
829 Ga0070687_100081234
830 Ga0070661_100000621
831 Ga0070661_100003328
832 Ga0070661_100005384
833 Ga0070661_100047349
834 Ga0070668_100009736
835 Ga0070668_100015844
836 Ga0070668_100092699
837 Ga0070668_100127181
838 Ga0070668_100135722
839 Ga0070668_100235563
840 Ga0070668_100320952
841 Ga0070669_100009730
842 Ga0070669_100022747
843 Ga0070669_100031629
844 Ga0070669_100055916
845 Ga0070675_100033377
846 Ga0070675_100129714
847 Ga0070675_100134370
848 Ga0070675_100193339
849 Ga0070675_100563941
850 Ga0070675_100761660
851 Ga0070671_100003277
852 Ga0070671_100165999
853 Ga0070671_100344539
854 Ga0070671_100555655
855 Ga0070671_100801393
856 Ga0070671_100886976
857 Ga0070674_100012730
858 Ga0070674_100126614
859 Ga0070674_100146809
860 Ga0070674_100180717
861 Ga0070674_100226143
862 Ga0070674_100268380
863 Ga0070674_100829193
864 Ga0070674_101323058
865 Ga0070673_100043729
866 Ga0070673_100082455
867 Ga0070673_100106350
868 Ga0070673_100256435
869 Ga0070673_100798672
870 Ga0070673_100899941
871 Ga0070688_100182184
872 Ga0070688_100245658
873 Ga0070688_100336605
874 Ga0070659_100035259
875 Ga0070659_100045005
876 Ga0070659_100073054
877 Ga0070659_100152017
878 Ga0070659_100225843
879 Ga0070667_100000406
880 Ga0070667_100003566
881 Ga0070667_100171776
882 Ga0070667_100285960
883 Ga0070667_100662877
884 Ga0070709_10015578
885 Ga0070709_10032175
886 Ga0070714_100012621
887 Ga0070714_100105207
888 Ga0070713_100021411
889 Ga0070713_100854414
890 Ga0070710_10014981
891 Ga0070710_10216090
892 Ga0070701_10191001
893 Ga0070701_10323620
894 Ga0070701_10369340
895 Ga0070711_100088024
896 Ga0070705_100025241
897 Ga0070705_100283898
898 Ga0070700_100203054
899 Ga0070700_100450505
900 Ga0070694_100014268
901 Ga0070708_100029734
902 Ga0070708_100207067
903 Ga0070663_100040566
904 Ga0070663_100110402
905 Ga0070663_100683462
906 Ga0070678_100002838
907 Ga0070678_100083750
908 Ga0070678_100099518
909 Ga0070678_100142669
910 Ga0070678_100359143
911 Ga0070678_100948796
912 Ga0070662_100023017
913 Ga0070662_100051274
914 Ga0070662_100234657
915 Ga0070681_10041295
916 Ga0070681_10113517
917 Ga0070681_10240294
918 Ga0070681_10247299
919 Ga0068867_100004907
920 Ga0068867_100070901
921 Ga0068867_100075257
922 Ga0068867_100210082
923 Ga0068867_100756359
924 Ga0068867_101138174
925 Ga0070685_10572563
926 Ga0070706_100057617
927 Ga0070706_100164047
928 Ga0070707_100018512
929 Ga0070707_100043109
930 Ga0070698_100118890
931 Ga0070698_100128579
932 Ga0070698_100973623
933 Ga0070699_100006764
934 Ga0070699_100009568
935 Ga0070699_100023288
936 Ga0070699_100296566
937 Ga0070679_100020157
938 Ga0070679_100023077
939 Ga0070679_100028166
940 Ga0070679_100065633
941 Ga0070679_100447726
942 Ga0070679_100691159
943 Ga0070684_100020484
944 Ga0070684_100101347
945 Ga0070697_100037527
946 Ga0070697_100053375
947 Ga0070697_100774139
948 Ga0068853_100006786
949 Ga0068853_100037196
950 Ga0068853_100062236
951 Ga0068853_100211199
952 Ga0070672_100002742
953 Ga0070672_100004597
954 Ga0070672_100036691
955 Ga0070672_100060649
956 Ga0070672_100144000
957 Ga0070672_100373545
958 Ga0070672_100471129
959 Ga0070695_100005169
960 Ga0070695_100290747
961 Ga0070696_100005811
962 Ga0070693_100042783
963 Ga0070693_100243091
964 Ga0070693_100353410
965 Ga0070693_100436059
966 Ga0070665_100004484
967 Ga0070665_100013587
968 Ga0070665_100028645
969 Ga0070704_100018865
970 Ga0070704_100059550
971 Ga0068855_100007662
972 Ga0068855_100013893
973 Ga0068855_100033610
974 Ga0068855_100044646
975 Ga0068855_100150391
976 Ga0068855_100229378
977 Ga0068855_100252653
978 Ga0070664_100003211
979 Ga0070664_100028009
980 Ga0070664_100068871
981 Ga0070664_100081004
982 Ga0070664_100397095
983 Ga0070664_100439350
984 Ga0070664_100763561
985 Ga0068857_100001177
986 Ga0068857_100005200
987 Ga0068857_100074629
988 Ga0068857_100722060
989 Ga0068854_100014809
990 Ga0068854_100022094
991 Ga0068854_100111916
992 Ga0068854_100622547
993 Ga0068854_100914618
994 Ga0068856_100007456
995 Ga0068856_100127705
996 Ga0068856_100310306
997 Ga0070702_100112059
998 Ga0068852_100000520
999 Ga0068852_100013259
1000 Ga0068852_100019491
1001 Ga0068852_100023886
1002 Ga0068852_100057471
1003 Ga0068852_101037264
1004 Ga0068852_101754433
1005 Ga0068859_100000527
1006 Ga0068859_100091574
1007 Ga0068859_100430576
1008 Ga0068859_100807043
1009 Ga0068864_100002334
1010 Ga0068864_100003671
1011 Ga0068864_100070697
1012 Ga0068864_100320942
1013 Ga0068866_10021854
1014 Ga0068861_100002417
1015 Ga0068861_100056159
1016 Ga0068861_100330188
1017 Ga0068861_100351123
1018 Ga0068851_10000990
1019 Ga0068851_10015088
1020 Ga0068851_10029146
1021 Ga0068851_10109675
1022 Ga0068870_10012867
1023 Ga0068870_10625721
1024 Ga0068863_100001069
1025 Ga0068863_100004647
1026 Ga0068863_100040525
1027 Ga0068863_100073692
1028 Ga0068863_100188868
1029 Ga0068863_100201897
1030 Ga0068863_100225438
1031 Ga0068863_100352371
1032 Ga0068863_101098756
1033 Ga0068863_101584006
1034 Ga0068858_100003144
1035 Ga0068858_100013017
1036 Ga0068858_100019760
1037 Ga0068858_100036390
1038 Ga0068860_100000976
1039 Ga0068860_100011703
1040 Ga0068860_100044122
1041 Ga0068860_100521229
1042 Ga0068860_100539397
1043 Ga0068860_100617306
1044 Ga0068860_100751370
1045 Ga0068862_100004694
1046 Ga0068862_100023742
1047 Ga0068862_100031164
1048 Ga0068862_100076153
1049 Ga0068862_101026548
1050 Ga0070717_10110614
1051 Ga0070716_100022522
1052 Ga0070716_100054858
1053 Ga0070716_100470630
1054 Ga0070712_100035277
1055 Ga0070712_100077240
1056 Ga0097621_100028801
1057 Ga0097621_100044860
1058 Ga0097621_100353148
1059 Ga0097621_100471106
1060 Ga0097621_100875284
1061 Ga0068871_100004879
1062 Ga0068871_100033006
1063 Ga0068871_100313814
1064 Ga0068871_100579009
1065 Ga0068871_100911470
1066 Ga0068871_100946063
1067 Ga0075433_10012647
1068 Ga0075433_10671168
1069 Ga0075434_100029350
1070 Ga0075434_100235414
1071 Ga0068865_100058694
1072 Ga0068865_100113832
1073 Ga0068865_100420226
1074 Ga0068865_100610091
1075 Ga0075436_100046139
1076 Ga0075436_100132039
1077 Ga0075436_100754054
1078 Ga0075436_100870479
1079 Ga0097620_100000527
1080 Ga0097620_100091580
1081 Ga0097620_100430569
1082 Ga0097620_100806869
1083 Ga0097620_100994752
1084 Ga0075435_100004089
1085 Ga0105240_10002235
1086 Ga0105240_10025340
1087 Ga0105240_10037583
1088 Ga0105240_10041168
1089 Ga0105240_10048099
1090 Ga0105240_10081295
1091 Ga0105240_10124122
1092 Ga0105240_10176344
1093 Ga0105240_11910449
1094 Ga0105245_10024377
1095 Ga0105245_10269080
1096 Ga0105245_10892759
1097 Ga0105247_10511961
1098 Ga0114129_11071734
1099 Ga0105243_10145103
1100 Ga0105243_10618601
1101 Ga0105241_10234081
1102 Ga0105242_10047328
1103 Ga0105242_10179876
1104 Ga0105248_10053255
1105 Ga0105248_10149778
1106 Ga0105248_10282968
1107 Ga0105248_10285226
1108 Ga0105248_10667750
1109 Ga0105248_10830164
1110 Ga0105237_10096187
1111 Ga0105237_10102484
1112 Ga0105237_10118122
1113 Ga0105237_10541915
1114 Ga0105237_10625296
1115 Ga0105238_10002149
1116 Ga0105238_10061075
1117 Ga0105238_10090052
1118 Ga0105238_10356754
1119 Ga0105249_10041463
1120 Ga0105249_11459345
1121 Ga0105239_10172738
1122 Ga0105246_10072385
1123 Ga0157373_10030841
1124 Ga0157373_10097954
1125 Ga0157373_10230888
1126 Ga0157373_10504489
1127 Ga0157371_10000446
1128 Ga0157371_10327178
1129 Ga0157371_10547789
1130 Ga0157370_10003163
1131 Ga0157370_10007756
1132 Ga0157370_10017646
1133 Ga0157370_10018910
1134 Ga0157370_10040315
1135 Ga0157370_10052450
1136 Ga0157370_10857287
1137 Ga0157369_10007686
1138 Ga0157369_10069403
1139 Ga0157369_10116409
1140 Ga0157369_10148429
1141 Ga0157369_10649533
1142 Ga0157369_10775279
1143 Ga0157374_10092129
1144 Ga0157374_10225479
1145 Ga0157378_10007398
1146 Ga0157378_10025287
1147 Ga0157378_10096286
1148 Ga0157378_10164656
1149 Ga0157378_10741988
1150 Ga0157378_10949979
1151 Ga0163162_10038163
1152 Ga0163162_10077511
1153 Ga0163162_10119444
1154 Ga0163162_10645153
1155 Ga0157372_10000523
1156 Ga0157372_10007100
1157 Ga0157372_10018755
1158 Ga0157372_10036033
1159 Ga0157372_10145850
1160 Ga0157372_10146512
1161 Ga0157372_10169141
1162 Ga0157372_10200368
1163 Ga0157372_10320061
1164 Ga0157372_10525504
1165 Ga0157372_10527911
1166 Ga0157372_11142707
1167 Ga0157372_11184833
1168 Ga0157375_10000680
1169 Ga0157375_10079965
1170 Ga0157375_10208081
1171 Ga0157375_10247458
1172 Ga0163163_10003067
1173 Ga0163163_10031909
1174 Ga0163163_10179234
1175 Ga0163163_10201345
1176 Ga0163163_10917461
1177 Ga0157380_10031183
1178 Ga0157380_10110539
1179 Ga0157380_10363515
1180 Ga0157380_10564602
1181 Ga0157380_10943015
1182 Ga0157380_11209103
1183 Ga0182008_10129667
1184 Ga0182008_10175444
1185 Ga0157379_10000642
1186 Ga0157379_10028110
1187 Ga0157379_10144354
1188 Ga0157379_10267055
1189 Ga0157379_10461793
1190 Ga0157376_10125957
1191 Ga0157376_10490038
1192 Ga0157376_10863061
1193 Ga0157376_11059540
1194 Ga0163161_10035171
1195 Ga0163161_10134175
1196 Ga0163161_10143581
1197 Ga0163161_10756145
1198 Ga0207656_10004900
1199 Ga0207656_10021068
1200 Ga0207656_10059040
1201 Ga0207682_10076870
1202 Ga0207692_10080950
1203 Ga0207692_10111942
1204 Ga0207688_10229999
1205 Ga0207680_10156625
1206 Ga0207680_10278494
1207 Ga0207680_10284935
1208 Ga0207680_10347887
1209 Ga0207680_10368432
1210 Ga0207680_10564789
1211 Ga0207699_10012608
1212 Ga0207699_10097816
1213 Ga0207699_10239839
1214 Ga0207645_10007338
1215 Ga0207645_10246959
1216 Ga0207643_10546586
1217 Ga0207705_10013769
1218 Ga0207705_10106227
1219 Ga0207705_10317630
1220 Ga0207705_10663016
1221 Ga0207684_10067891
1222 Ga0207684_10150370
1223 Ga0207684_10165360
1224 Ga0207684_10971654
1225 Ga0207654_10093000
1226 Ga0207707_10005481
1227 Ga0207707_10026650
1228 Ga0207707_10112215
1229 Ga0207707_10189803
1230 Ga0207707_10210600
1231 Ga0207707_10624688
1232 Ga0207695_10045039
1233 Ga0207695_10151943
1234 Ga0207695_10226213
1235 Ga0207695_10382593
1236 Ga0207695_10610936
1237 Ga0207671_10144636
1238 Ga0207671_10161688
1239 Ga0207671_11210634
1240 Ga0207693_10010112
1241 Ga0207693_10061765
1242 Ga0207693_10601761
1243 Ga0207663_10073535
1244 Ga0207660_10103512
1245 Ga0207660_10409542
1246 Ga0207660_10474843
1247 Ga0207662_10309976
1248 Ga0207657_10002525
1249 Ga0207657_10059947
1250 Ga0207657_10101040
1251 Ga0207657_10112265
1252 Ga0207657_10520108
1253 Ga0207649_10001721
1254 Ga0207649_10016257
1255 Ga0207649_10048099
1256 Ga0207649_10087186
1257 Ga0207649_10212698
1258 Ga0207649_10652748
1259 Ga0207652_10051495
1260 Ga0207652_10068796
1261 Ga0207652_10376235
1262 Ga0207652_10531645
1263 Ga0207652_10544389
1264 Ga0207652_10560562
1265 Ga0207646_10046160
1266 Ga0207646_10071962
1267 Ga0207646_10450870
1268 Ga0207681_10007056
1269 Ga0207681_10014545
1270 Ga0207681_10033621
1271 Ga0207694_10010599
1272 Ga0207694_10311206
1273 Ga0207650_10002151
1274 Ga0207650_10013458
1275 Ga0207650_10114892
1276 Ga0207659_10109516
1277 Ga0207659_10229250
1278 Ga0207687_10111652
1279 Ga0207700_10053793
1280 Ga0207700_10084596
1281 Ga0207664_10001100
1282 Ga0207664_10012064
1283 Ga0207664_10014597
1284 Ga0207664_10560469
1285 Ga0207644_10013227
1286 Ga0207644_10067870
1287 Ga0207644_10186233
1288 Ga0207644_10938931
1289 Ga0207644_10993345
1290 Ga0207690_10012955
1291 Ga0207690_10101109
1292 Ga0207690_10165448
1293 Ga0207690_10204872
1294 Ga0207690_10298847
1295 Ga0207690_10315484
1296 Ga0207690_10350909
1297 Ga0207706_10029884
1298 Ga0207706_10056537
1299 Ga0207706_10061827
1300 Ga0207686_10186698
1301 Ga0207709_10316558
1302 Ga0207709_10371270
1303 Ga0207670_10146820
1304 Ga0207670_10348901
1305 Ga0207669_10028475
1306 Ga0207669_10079672
1307 Ga0207669_10092531
1308 Ga0207669_10260950
1309 Ga0207669_10693562
1310 Ga0207704_10025334
1311 Ga0207704_10029020
1312 Ga0207704_10304283
1313 Ga0207704_10405430
1314 Ga0207665_10019417
1315 Ga0207691_10000958
1316 Ga0207691_10004360
1317 Ga0207691_10060919
1318 Ga0207691_10099855
1319 Ga0207691_10209861
1320 Ga0207691_10565455
1321 Ga0207711_10008335
1322 Ga0207711_10143382
1323 Ga0207711_10175105
1324 Ga0207689_10000421
1325 Ga0207689_10008322
1326 Ga0207689_10012711
1327 Ga0207689_10175515
1328 Ga0207661_10038609
1329 Ga0207661_10634711
1330 Ga0207661_11209534
1331 Ga0207679_10005652
1332 Ga0207679_10034979
1333 Ga0207679_10087837
1334 Ga0207679_10093546
1335 Ga0207679_10096481
1336 Ga0207679_10688424
1337 Ga0207667_10009110
1338 Ga0207667_10015818
1339 Ga0207667_10043973
1340 Ga0207667_10082346
1341 Ga0207667_10254369
1342 Ga0207667_10404571
1343 Ga0207667_10409093
1344 Ga0207667_10475790
1345 Ga0207667_10838196
1346 Ga0207651_10203180
1347 Ga0207651_10329119
1348 Ga0207651_10772745
1349 Ga0207712_10211032
1350 Ga0207668_10005211
1351 Ga0207668_10018692
1352 Ga0207668_10026888
1353 Ga0207668_10037549
1354 Ga0207668_10077087
1355 Ga0207668_10658342
1356 Ga0207640_10024047
1357 Ga0207640_10059529
1358 Ga0207640_10104314
1359 Ga0207640_10158548
1360 Ga0207658_10001847
1361 Ga0207658_10053434
1362 Ga0207658_10102479
1363 Ga0207658_10250327
1364 Ga0207658_10251502
1365 Ga0207658_10308845
1366 Ga0207658_10311722
1367 Ga0207658_10435540
1368 Ga0207658_10435696
1369 Ga0207677_10027808
1370 Ga0207677_10027875
1371 Ga0207677_10033868
1372 Ga0207677_10703140
1373 Ga0207677_10756066
1374 Ga0207677_10764226
1375 Ga0207703_10000854
1376 Ga0207703_10015810
1377 Ga0207703_10034964
1378 Ga0207703_10062700
1379 Ga0207703_10718472
1380 Ga0207639_10026145
1381 Ga0207639_10064511
1382 Ga0207639_10092066
1383 Ga0207639_10202981
1384 Ga0207639_10213604
1385 Ga0207678_10063362
1386 Ga0207678_10475302
1387 Ga0207708_10066281
1388 Ga0207708_10503412
1389 Ga0207708_10818366
1390 Ga0207702_10082263
1391 Ga0207702_10392122
1392 Ga0207702_11126741
1393 Ga0207641_10007366
1394 Ga0207641_10017490
1395 Ga0207641_10032524
1396 Ga0207641_10075421
1397 Ga0207641_10648359
1398 Ga0207641_10928518
1399 Ga0207641_11121200
1400 Ga0207648_10004322
1401 Ga0207648_10006864
1402 Ga0207648_10043305
1403 Ga0207648_10057065
1404 Ga0207648_10059275
1405 Ga0207648_10478511
1406 Ga0207648_10542125
1407 Ga0207676_10000633
1408 Ga0207676_10016406
1409 Ga0207676_10984187
1410 Ga0207676_11063705
1411 Ga0207674_10000912
1412 Ga0207674_10008221
1413 Ga0207674_10012315
1414 Ga0207674_10074855
1415 Ga0207674_10241306
1416 Ga0207674_10347316
1417 Ga0207675_100000658
1418 Ga0207675_100036546
1419 Ga0207675_100055366
1420 Ga0207675_100084413
1421 Ga0207675_100388554
1422 Ga0207683_10014462
1423 Ga0207683_10027569
1424 Ga0207683_10082583
1425 Ga0207683_10145486
1426 Ga0207683_10169294
1427 Ga0207683_10189547
1428 Ga0207683_10680013
1429 Ga0207698_10001520
1430 Ga0207698_10133937
1431 Ga0207698_10197763
1432 Ga0207698_10329185
1433 Ga0210000_1020299
1434 Ga0209971_1039670
1435 Ga0209974_10010972
1436 Ga0209974_10022904
1437 Ga0268266_10005997
1438 Ga0268266_10338608
1439 Ga0268265_10007093
1440 Ga0268265_10010460
1441 Ga0268265_11177118
1442 Ga0268265_11278807
1443 Ga0268264_10000967
1444 Ga0268264_10016520
1445 Ga0268264_10137061
1446 Ga0268264_10376043
1447 Ga0268264_10417290
1448 Ga0307408_100054663
1449 Ga0307408_100873382
1450 Ga0307413_10016348
1451 Ga0307410_10010404
1452 Ga0307406_10005433
1453 Ga0307412_10055773
1454 Ga0307409_100974101
1455 Ga0307416_100540983
1456 Ga0307414_10021760
1457 Ga0307411_10023149
1458 Ga0373926_0049359
1459 Ga0373923_0305937
1460 Ga0373936_0243680
1461 Ga0373945_0140727
1462 Ga0373943_0008870
1463 Ga0373946_0026666
1464 Ga0373955_0440477
1465 Ga0373924_0184428
1466 Ga0373931_0095849
1467 Ga0373931_0263084
1468 Ga0373935_0018180
1469 Ga0373935_0241556
1470 Ga0373927_0022553
1471 Ga0373927_0073141
1472 Ga0373933_0090391
1473 Ga0373947_0226585
1474 Ga0373937_0008259
1475 Ga0373937_0699115
1476 Ga0373925_0010870
1477 Ga0373925_0026320
1478 Ga0373925_0043611
1479 Ga0395900_1248256
1480 Ga0400490_29567
1481 Ga0400488_52598
1482 Ga0400483_002297
1483 Ga0400487_05475
1484 Ga0400487_24255
1485 Ga0436365_1721370
1486 Ga0451853_2225107
1487 Ga0451577_0545578
1488 Ga0466964_0744278
1489 Ga0451576_1353373
1490 Ga0495629_0185834
1491 Ga0495651_0156443
1492 Ga0495580_0070489
1493 Ga0495580_0072026
1494 Ga0495580_0138485
1495 Ga0495580_0274542
1496 Ga0495582_0002672
1497 Ga0495639_0024562
1498 Ga0495662_0055671
1499 Ga0495640_0153233
1500 Ga0495587_0426630
1501 Ga0495645_0066686
1502 Ga0495634_0192980
1503 Ga0495635_0034656
1504 Ga0495647_0001749
1505 Ga0495658_0054530
1506 Ga0495658_0478417
1507 Ga0495669_0416744
1508 Ga0495613_0005569
1509 Ga0495600_0020250
1510 Ga0495581_0001180
1511 Ga0495680_0339212
1512 Ga0495684_0007836
1513 Ga0495593_0057578
1514 Ga0495614_0007107
1515 Ga0496102_0029757
1516 Ga0496102_0123717
1517 Ga0496102_0416108
1518 Ga0496103_0038093
1519 Ga0496103_0045503
1520 Ga0496104_0002295
1521 Ga0496106_0035998
1522 Ga0496106_0119821
1523 Ga0496107_0038444
1524 Ga0496107_0654793
1525 Ga0496108_0034605
1526 Ga0496108_0147829
1527 Ga0496109_0309874
1528 Ga0496109_0435753
1529 Ga0496109_0634411
1530 Ga0496109_1293690
1531 Ga0496110_0300589
1532 Ga0496111_0166450
1533 Ga0496111_0245241
1534 Ga0496112_0006765
1535 Ga0496112_0880543
1536 Ga0496113_0594757
1537 Ga0496113_0784939
1538 Ga0496114_0300566
1539 Ga0496115_0046184
1540 Ga0501034_0093780
1541 Ga0501047_0550450
1542 Ga0501047_0636229
1543 Ga0501067_0214334
1544 Ga0501070_0015286
1545 Ga0501070_0035038
1546 Ga0501073_0005535
1547 Ga0501080_0007043
1548 Ga0501083_0036111
1549 Ga0501035_0160671
1550 Ga0501035_0238929
1551 Ga0501044_0496686
1552 Ga0501044_0941955
1553 nmdc:mga05p37_940172_c1
1554 nmdc:mga0n895_111856_c1
1555 nmdc:mga0n895_1610808_c1
1556 nmdc:mga0n895_318850_c1
1557 nmdc:mga0n895_497446_c1
1558 nmdc:mga0rr50_105327_c1
1559 nmdc:mga08x19_270610_c1
1560 nmdc:mga08x19_388908_c1
1561 nmdc:mga08x19_39040_c1
1562 nmdc:mga08x19_449665_c1
1563 nmdc:mga08x19_874930_c1
1564 nmdc:mga0a205_235004_c1
1565 nmdc:mga0a205_5608_c1
1566 Ga0495601_0645919
1567 Ga0495595_0144809
1568 Ga0495619_0027584
1569 Ga0501084_0028865
1570 Ga0500661_007242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09721

Exosortase_EpsH

Transmembrane exosortase (Exosortase_EpsH)

20

196

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zwa-assembly1.cif.gz_A crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via schiff base in protomer a and the product (plp) in protomer b 0.4447 51 110
7uzh-assembly1.cif.gz_m rat kidney v-atpase with sidk, state 2 0.422 30 152
7u8p-assembly1.cif.gz_l structure of porcine kidney v-atpase with sidk, rotary state 1 0.4082 30 153
3j9v-assembly1.cif.gz_a yeast v-atpase state 3 0.3794 30 154
7uzh-assembly1.cif.gz_m rat kidney v-atpase with sidk, state 2 0.368 30 152
ID Description Score Start End Superfamily
af_Q18021_11_292_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5077 33 154 1.20.1070.10
af_A0A2R9YJG7_410_638_1.20.120.810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Vinculin, Vh2 four-helix bundle 0.499 74 155 1.20.120.810
4uxzD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4968 70 155 1.10.287.3610
4brrD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4953 70 155 1.10.287.3610
3ze3D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4924 70 155 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A1Z5HB10-F1-model_v4 Exosortase H 0.9862 1 122 GO:0005886
GO:0006508
GO:0008233
AF-A0A1Z5HB10-F1-model_v4 Exosortase H 0.9783 1 122 GO:0005886
GO:0006508
GO:0008233
AF-A0A7V2T1S5-F1-model_v4 Exosortase H (EC 3.4.22.-) 0.9773 7 155 GO:0005886
GO:0006508
GO:0008233
AF-A0A1W9S401-F1-model_v4 Exosortase H 0.9765 2 155 GO:0005886
GO:0006508
GO:0008233
AF-A0A257U425-F1-model_v4 Exosortase H 0.9746 3 154 GO:0005886
GO:0006508
GO:0008233

Map