F480576

General Info

Members Datasets Scaffolds Average Seq Length
781 296 693 200

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_014867|Ga0495617_014867_1092_1727
Length 211
Sequence MNAEQAPLPHDLCWGMPVAGLPADAPAWVVDVVQRRHPVVVRRALAPAGQLAVGVRGPGREQRYATFMGLADVRRSVRPEQLGQLQGSGDAREWPALQALAQLRPLLNGLGVAWGVSGSAGFELASGVRALHPGSDLDLIVRTPRYVSRQCAARWLQALEGAPCRVDVQLQTPRGGVALRDWAGTASQVLLKGPNAAELVVNPWPSQEIGP

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2511231022 Pseudomonas sp. GM79 Isolate Nodule
7 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
8 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
9 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
10 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
11 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
12 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
13 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
14 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
15 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
16 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
17 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
18 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
19 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
20 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
21 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
22 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
23 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
24 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
25 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
26 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
27 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
28 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
29 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
30 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
31 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
32 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
33 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
34 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
35 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
36 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
37 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
38 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
39 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
40 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
41 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
42 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
43 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
44 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
45 2773857670 Pseudomonas sp. 478 Isolate Unclassified
46 2784132072 Pseudomonas sp. 460 Isolate Unclassified
47 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
48 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
49 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
50 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
51 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
52 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
53 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
54 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
55 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
56 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
57 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
58 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
59 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
60 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
61 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
62 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
63 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
64 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
65 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
66 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
67 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
68 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
69 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
70 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
71 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
72 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
73 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
74 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
145 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
152 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
153 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
156 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
157 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
158 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
159 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
160 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
161 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
162 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
163 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
174 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
185 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
284 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
285 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
286 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
287 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
288 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
289 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
290 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
291 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
292 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
293 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
294 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
295 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
296 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.6
Metatranscriptomes 0.13
Isolates 11.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 1.41
Rhizoplane 3.84
Rhizosphere 80.92
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1012093 3300003578 Bacteria 5235
2 Ga0055536_1000869 3300003781 Bacteria 19618
3 Ga0055530_10000535 3300003791 Bacteria 32956
4 Ga0055530_10000966 3300003791 Bacteria 23308
5 Ga0055540_1000178 3300003792 Bacteria 62401
6 Ga0055540_1000250 3300003792 Bacteria 49162
7 Ga0055540_1000896 3300003792 Bacteria 19618
8 Ga0055531_10000243 3300003794 Bacteria 59515
9 Ga0065714_10002456 3300005288 Bacteria 24700
10 Ga0065714_10010148 3300005288 Bacteria 2544
11 Ga0065714_10017605 3300005288 Bacteria 2542
12 Ga0065714_10031866 3300005288 Bacteria 1089
13 Ga0065714_10128611 3300005288 Bacteria 1271
14 Ga0065712_10023066 3300005290 Bacteria 1490
15 Ga0070670_100000567 3300005331 Bacteria 29311
16 Ga0070670_100000599 3300005331 Bacteria 28476
17 Ga0070661_100002629 3300005344 Bacteria 12293
18 Ga0070661_100147689 3300005344 Bacteria 1776
19 Ga0070669_100000963 3300005353 Bacteria 21008
20 Ga0070669_100001975 3300005353 Bacteria 14816
21 Ga0070662_100003356 3300005457 Bacteria 9974
22 Ga0068853_100000448 3300005539 Bacteria 28021
23 Ga0070665_100097186 3300005548 Bacteria 2950
24 Ga0070664_100003719 3300005564 Bacteria 12293
25 Ga0070664_100243412 3300005564 Bacteria 1615
26 Ga0068854_100061343 3300005578 Bacteria 2723
27 Ga0068851_10000012 3300005834 Bacteria 175130
28 Ga0075364_10137530 3300006051 Bacteria 1642
29 Ga0075432_10000124 3300006058 Bacteria 17412
30 Ga0075432_10037322 3300006058 Bacteria 1691
31 Ga0079104_1000133 3300006946 Bacteria 105452
32 Ga0099826_10010680 3300006948 Bacteria 6887
33 Ga0105251_10001756 3300009011 Bacteria 18085
34 Ga0105251_10002313 3300009011 Bacteria 15110
35 Ga0105251_10029444 3300009011 Bacteria 2766
36 Ga0105251_10351742 3300009011 Bacteria 672
37 Ga0105244_10004878 3300009036 Bacteria 9092
38 Ga0105244_10072877 3300009036 Bacteria 1710
39 Ga0105244_10097553 3300009036 Bacteria 1440
40 Ga0105250_10000397 3300009092 Bacteria 32240
41 Ga0105243_10058112 3300009148 Bacteria 3082
42 Ga0105243_10376840 3300009148 Bacteria 1311
43 Ga0105242_10009426 3300009176 Bacteria 7483
44 Ga0105248_10022667 3300009177 Bacteria 6969
45 Ga0105237_10000764 3300009545 Bacteria 44145
46 Ga0105237_10528733 3300009545 Bacteria 1186
47 Ga0105246_10000710 3300011119 Bacteria 18786
48 Ga0105246_10180603 3300011119 Bacteria 1624
49 Ga0157373_10006253 3300013100 Bacteria 8897
50 Ga0157373_10016939 3300013100 Bacteria 5309
51 Ga0157373_10054018 3300013100 Bacteria 2855
52 Ga0157373_10128728 3300013100 Bacteria 1780
53 Ga0157371_10000131 3300013102 Bacteria 113432
54 Ga0157371_10001015 3300013102 Bacteria 30796
55 Ga0157371_10605004 3300013102 Bacteria 815
56 Ga0157370_10022304 3300013104 Bacteria 6302
57 Ga0157370_10076560 3300013104 Bacteria 3151
58 Ga0157370_10084070 3300013104 Bacteria 2992
59 Ga0157370_10146169 3300013104 Bacteria 2201
60 Ga0157369_10004122 3300013105 Bacteria 17217
61 Ga0157369_10005450 3300013105 Bacteria 14797
62 Ga0157369_10020373 3300013105 Bacteria 7413
63 Ga0163162_10190360 3300013306 Bacteria 2179
64 Ga0163162_10192499 3300013306 Bacteria 2167
65 Ga0163162_10330272 3300013306 Bacteria 1657
66 Ga0157375_10019112 3300013308 Bacteria 6224
67 Ga0157375_10047697 3300013308 Bacteria 4185
68 Ga0182008_10002588 3300014497 Bacteria 11236
69 Ga0182008_10044290 3300014497 Bacteria 2213
70 Ga0182008_10066852 3300014497 Bacteria 1769
71 Ga0182006_1000449 3300015261 Bacteria 32576
72 Ga0182006_1001573 3300015261 Bacteria 13616
73 Ga0182006_1008936 3300015261 Bacteria 4519
74 Ga0182006_1087935 3300015261 Bacteria 1122
75 Ga0182006_1092628 3300015261 Bacteria 1085
76 Ga0182007_10002013 3300015262 Bacteria 10468
77 Ga0182007_10007001 3300015262 Bacteria 4783
78 Ga0182007_10044832 3300015262 Bacteria 1466
79 Ga0182007_10103981 3300015262 Bacteria 942
80 Ga0182005_1003727 3300015265 Bacteria 5077
81 Ga0182005_1007670 3300015265 Bacteria 3223
82 Ga0163161_10004476 3300017792 Bacteria 9724
83 Ga0163161_10053420 3300017792 Bacteria 2930
84 Ga0163161_10071249 3300017792 Bacteria 2543
85 Ga0163161_10132576 3300017792 Bacteria 1881
86 Ga0209676_1000015 3300025292 Bacteria 784458
87 Ga0209676_1000030 3300025292 Bacteria 506421
88 Ga0209676_1002636 3300025292 Bacteria 12231
89 Ga0209050_1000024 3300025298 Bacteria 533389
90 Ga0209050_1000075 3300025298 Bacteria 286562
91 Ga0209050_1000923 3300025298 Bacteria 38715
92 Ga0209051_1000012 3300025303 Bacteria 595474
93 Ga0209051_1000023 3300025303 Bacteria 437371
94 Ga0209051_1000041 3300025303 Bacteria 311155
95 Ga0209257_1000069 3300025304 Bacteria 339826
96 Ga0209257_1024627 3300025304 Bacteria 2079
97 Ga0207656_10000006 3300025321 Bacteria 395044
98 Ga0207696_1000167 3300025711 Bacteria 103936
99 Ga0207655_1000346 3300025728 Bacteria 67352
100 Ga0207655_1011013 3300025728 Bacteria 5427
101 Ga0207655_1018564 3300025728 Bacteria 3681
102 Ga0207713_1000438 3300025735 Bacteria 43784
103 Ga0207713_1000463 3300025735 Bacteria 42547
104 Ga0207713_1006267 3300025735 Bacteria 7278
105 Ga0207713_1010717 3300025735 Bacteria 5049
106 Ga0207713_1047977 3300025735 Bacteria 1723
107 Ga0207713_1057945 3300025735 Bacteria 1495
108 Ga0207713_1105185 3300025735 Bacteria 967
109 Ga0207671_10000097 3300025914 Bacteria 135093
110 Ga0207671_10365033 3300025914 Bacteria 1146
111 Ga0207649_10000022 3300025920 Bacteria 188959
112 Ga0207681_10000132 3300025923 Bacteria 60959
113 Ga0207681_10001211 3300025923 Bacteria 16596
114 Ga0207650_10000140 3300025925 Bacteria 88140
115 Ga0207650_10000512 3300025925 Bacteria 32392
116 Ga0207706_10000175 3300025933 Bacteria 71118
117 Ga0207686_10000905 3300025934 Bacteria 17856
118 Ga0207709_10262810 3300025935 Bacteria 1266
119 Ga0207679_10002116 3300025945 Bacteria 12312
120 Ga0207679_10071668 3300025945 Bacteria 2615
121 Ga0207639_10000857 3300026041 Bacteria 20635
122 Ga0209281_1000019 3300027111 Bacteria 576164
123 Ga0209970_1029468 3300027614 Bacteria 950
124 Ga0209282_1155055 3300027666 Bacteria 1101
125 Ga0209974_10124366 3300027876 Bacteria 916
126 Ga0207428_10122700 3300027907 Bacteria 1992
127 Ga0207428_10221886 3300027907 Bacteria 1417
128 Ga0268266_10041340 3300028379 Bacteria 3934
129 Ga0268266_10131811 3300028379 Bacteria 2236
130 Ga0307517_10186034 3300028786 Bacteria 1329
131 Ga0316183_1019679 3300030742 Bacteria 1045
132 Ga0265316_10111430 3300031344 Bacteria 2072
133 Ga0265316_10271289 3300031344 Bacteria 1241
134 Ga0307408_100075843 3300031548 Bacteria 2499
135 Ga0307405_10013153 3300031731 Bacteria 4406
136 Ga0307412_10109248 3300031911 Bacteria 1971
137 Ga0307414_10300195 3300032004 Bacteria 1358
138 Ga0439438_007729 3300041405 Bacteria 3640
139 Ga0439438_022734 3300041405 Bacteria 1735
140 Ga0439447_000250 3300041407 Bacteria 18833
141 Ga0439447_003262 3300041407 Bacteria 5770
142 Ga0439447_017568 3300041407 Bacteria 1945
143 Ga0439447_020280 3300041407 Bacteria 1765
144 Ga0439447_033966 3300041407 Bacteria 1269
145 Ga0439461_0069579 3300041410 Bacteria 813
146 Ga0439466_0000469 3300041411 Bacteria 15341
147 Ga0439466_0006698 3300041411 Bacteria 4370
148 Ga0439466_0016086 3300041411 Bacteria 2708
149 Ga0439466_0021059 3300041411 Bacteria 2317
150 Ga0439466_0040653 3300041411 Bacteria 1554
151 Ga0439466_0042650 3300041411 Bacteria 1509
152 Ga0439466_0043410 3300041411 Bacteria 1493
153 Ga0439465_0041624 3300041413 Bacteria 1487
154 Ga0439445_0036446 3300042004 Bacteria 1294
155 Ga0439432_053863 3300042006 Bacteria 1250
156 Ga0439451_001428 3300042009 Bacteria 4726
157 Ga0439451_001536 3300042009 Bacteria 4568
158 Ga0439451_002185 3300042009 Bacteria 3934
159 Ga0439451_010239 3300042009 Bacteria 1891
160 Ga0439451_020771 3300042009 Bacteria 1323
161 Ga0439451_044430 3300042009 Bacteria 890
162 Ga0439452_001470 3300042010 Bacteria 9604
163 Ga0439452_005405 3300042010 Bacteria 4112
164 Ga0439452_020344 3300042010 Bacteria 1742
165 Ga0439452_028799 3300042010 Bacteria 1382
166 Ga0439456_003065 3300042013 Bacteria 3375
167 Ga0439456_016081 3300042013 Bacteria 1564
168 Ga0439456_017507 3300042013 Bacteria 1502
169 Ga0439456_029194 3300042013 Bacteria 1177
170 Ga0439463_001200 3300042016 Bacteria 6915
171 Ga0439463_002406 3300042016 Bacteria 4767
172 Ga0439463_003012 3300042016 Bacteria 4275
173 Ga0439463_014409 3300042016 Bacteria 1948
174 Ga0439463_017433 3300042016 Bacteria 1780
175 Ga0439463_039835 3300042016 Bacteria 1193
176 Ga0450911_000952 3300042115 Bacteria 7564
177 Ga0450911_001425 3300042115 Bacteria 5512
178 Ga0450911_018364 3300042115 Bacteria 918
179 Ga0450919_000729 3300042121 Bacteria 4162
180 Ga0450922_000334 3300042124 Bacteria 5002
181 Ga0450922_001203 3300042124 Bacteria 2558
182 Ga0450890_000682 3300042127 Bacteria 4938
183 Ga0450899_005965 3300042135 Bacteria 1314
184 Ga0450902_005329 3300042137 Bacteria 1937
185 Ga0450902_008320 3300042137 Bacteria 1618
186 Ga0450902_010819 3300042137 Bacteria 1444
187 Ga0450902_035877 3300042137 Bacteria 839
188 Ga0450903_001628 3300042138 Bacteria 4174
189 Ga0450903_019729 3300042138 Bacteria 1045
190 Ga0450903_023778 3300042138 Bacteria 941
191 Ga0450903_040671 3300042138 Bacteria 688
192 Ga0450904_007149 3300042139 Bacteria 1112
193 Ga0450905_007129 3300042142 Bacteria 1519
194 Ga0450905_010733 3300042142 Bacteria 1272
195 Ga0450905_011630 3300042142 Bacteria 1232
196 Ga0450905_033476 3300042142 Bacteria 799
197 Ga0450907_000115 3300042146 Bacteria 30452
198 Ga0450907_003286 3300042146 Bacteria 2908
199 Ga0450907_009737 3300042146 Bacteria 1594
200 Ga0450910_001492 3300042147 Bacteria 2959
201 Ga0439446_0001469 3300042156 Bacteria 5384
202 Ga0439446_0029259 3300042156 Bacteria 1589
203 Ga0450908_009138 3300042184 Bacteria 1846
204 Ga0450909_000120 3300042185 Bacteria 7892
205 Ga0450909_000376 3300042185 Bacteria 5682
206 Ga0439434_0000211 3300042435 Bacteria 16127
207 Ga0439464_0008630 3300042439 Bacteria 2670
208 Ga0439460_0001615 3300042461 Bacteria 5339
209 Ga0439460_0011056 3300042461 Bacteria 2322
210 Ga0439460_0100962 3300042461 Bacteria 927
211 Ga0450918_005784 3300042531 Bacteria 2211
212 Ga0450893_0011607 3300042532 Bacteria 1457
213 Ga0450901_000997 3300042533 Bacteria 3287
214 Ga0439440_0000155 3300042993 Bacteria 10144
215 Ga0439440_0002765 3300042993 Bacteria 3330
216 Ga0439440_0011852 3300042993 Bacteria 1845
217 Ga0466969_0011980 3300044656 Bacteria 4585
218 Ga0466965_0041544 3300044683 Bacteria 2266
219 Ga0466966_0010422 3300044684 Bacteria 6174
220 Ga0466961_0006453 3300044693 Bacteria 7447
221 Ga0466959_0009131 3300045049 Bacteria 7040
222 Ga0495617_012252 3300046452 Bacteria 2921
223 Ga0495617_013560 3300046452 Bacteria 2774
224 Ga0495617_014867 3300046452 Bacteria 2643
225 Ga0495617_025379 3300046452 Bacteria 1998
226 Ga0495627_000929 3300046453 Bacteria 20194
227 Ga0495627_001105 3300046453 Bacteria 17589
228 Ga0495627_007300 3300046453 Bacteria 4250
229 Ga0495627_015199 3300046453 Bacteria 2662
230 Ga0495627_053650 3300046453 Bacteria 1206
231 Ga0495627_096191 3300046453 Bacteria 848
232 Ga0495603_0005711 3300046455 Bacteria 7438
233 Ga0495603_0011221 3300046455 Bacteria 5427
234 Ga0495603_0017156 3300046455 Bacteria 4383
235 Ga0495603_0074745 3300046455 Bacteria 1989
236 Ga0495590_0007244 3300046457 Bacteria 4287
237 Ga0495590_0019148 3300046457 Bacteria 2442
238 Ga0495590_0022117 3300046457 Bacteria 2250
239 Ga0495590_0061085 3300046457 Bacteria 1319
240 Ga0495590_0131441 3300046457 Bacteria 900
241 Ga0495591_000345 3300046458 Bacteria 41167
242 Ga0495591_001832 3300046458 Bacteria 12552
243 Ga0495591_009235 3300046458 Bacteria 3939
244 Ga0495591_013880 3300046458 Bacteria 2923
245 Ga0495591_016375 3300046458 Bacteria 2583
246 Ga0495591_046154 3300046458 Bacteria 1211
247 Ga0495591_071417 3300046458 Bacteria 900
248 Ga0495629_0005106 3300046459 Bacteria 9814
249 Ga0495629_0126493 3300046459 Bacteria 1780
250 Ga0495638_0009372 3300046460 Bacteria 6882
251 Ga0495638_0020513 3300046460 Bacteria 4365
252 Ga0495638_0045029 3300046460 Bacteria 2777
253 Ga0495638_0045498 3300046460 Bacteria 2760
254 Ga0495638_0046270 3300046460 Bacteria 2734
255 Ga0495638_0168012 3300046460 Bacteria 1260
256 Ga0495638_0221307 3300046460 Bacteria 1058
257 Ga0495653_0005839 3300046463 Bacteria 10071
258 Ga0495653_0007620 3300046463 Bacteria 8851
259 Ga0495650_0004290 3300046471 Bacteria 9846
260 Ga0495650_0015251 3300046471 Bacteria 3950
261 Ga0495650_0017102 3300046471 Bacteria 3647
262 Ga0495650_0020862 3300046471 Bacteria 3183
263 Ga0495650_0021189 3300046471 Bacteria 3149
264 Ga0495650_0183210 3300046471 Bacteria 735
265 Ga0495580_0245376 3300046472 Bacteria 1227
266 Ga0495582_0029549 3300046473 Bacteria 3008
267 Ga0495605_0004804 3300046474 Bacteria 7902
268 Ga0495605_0053029 3300046474 Bacteria 1968
269 Ga0495605_0059395 3300046474 Bacteria 1836
270 Ga0495605_0073981 3300046474 Bacteria 1604
271 Ga0495605_0092346 3300046474 Bacteria 1401
272 Ga0495605_0140128 3300046474 Bacteria 1085
273 Ga0495605_0165006 3300046474 Bacteria 981
274 Ga0495639_0000205 3300046475 Bacteria 30780
275 Ga0495639_0042108 3300046475 Bacteria 2058
276 Ga0495639_0514774 3300046475 Bacteria 611
277 Ga0495662_0209526 3300046476 Bacteria 961
278 Ga0495664_0318285 3300046477 Bacteria 938
279 Ga0495584_0000909 3300046491 Bacteria 18890
280 Ga0495584_0002925 3300046491 Bacteria 9517
281 Ga0495584_0007086 3300046491 Bacteria 5857
282 Ga0495584_0010191 3300046491 Bacteria 4826
283 Ga0495584_0013876 3300046491 Bacteria 4104
284 Ga0495584_0075711 3300046491 Bacteria 1692
285 Ga0495584_0282416 3300046491 Bacteria 843
286 Ga0495585_0008553 3300046492 Bacteria 6198
287 Ga0495585_0014824 3300046492 Bacteria 4533
288 Ga0495585_0025294 3300046492 Bacteria 3402
289 Ga0495585_0054844 3300046492 Bacteria 2203
290 Ga0495585_0104288 3300046492 Bacteria 1513
291 Ga0495585_0115046 3300046492 Bacteria 1427
292 Ga0495585_0173195 3300046492 Bacteria 1113
293 Ga0495594_0023426 3300046499 Bacteria 3308
294 Ga0495594_0029214 3300046499 Bacteria 2979
295 Ga0495594_0036991 3300046499 Bacteria 2663
296 Ga0495594_0044270 3300046499 Bacteria 2441
297 Ga0495596_0000914 3300046500 Bacteria 17596
298 Ga0495596_0087413 3300046500 Bacteria 1210
299 Ga0495607_0022121 3300046501 Bacteria 3996
300 Ga0495607_0022154 3300046501 Bacteria 3994
301 Ga0495607_0026017 3300046501 Bacteria 3633
302 Ga0495607_0065448 3300046501 Bacteria 2049
303 Ga0495607_0067168 3300046501 Bacteria 2015
304 Ga0495607_0069107 3300046501 Bacteria 1978
305 Ga0495607_0157353 3300046501 Bacteria 1157
306 Ga0495607_0175508 3300046501 Bacteria 1078
307 Ga0495607_0330518 3300046501 Bacteria 708
308 Ga0495583_0001217 3300046506 Bacteria 27414
309 Ga0495583_0004450 3300046506 Bacteria 10025
310 Ga0495583_0013708 3300046506 Bacteria 4502
311 Ga0495583_0023911 3300046506 Bacteria 3080
312 Ga0495583_0143815 3300046506 Bacteria 991
313 Ga0495606_0002088 3300046507 Bacteria 24359
314 Ga0495606_0142079 3300046507 Bacteria 1416
315 Ga0495610_0008501 3300046512 Bacteria 6633
316 Ga0495610_0013917 3300046512 Bacteria 4753
317 Ga0495610_0019193 3300046512 Bacteria 3833
318 Ga0495610_0020311 3300046512 Bacteria 3690
319 Ga0495610_0058611 3300046512 Bacteria 1841
320 Ga0495610_0066559 3300046512 Bacteria 1696
321 Ga0495610_0085100 3300046512 Bacteria 1444
322 Ga0495610_0135254 3300046512 Bacteria 1066
323 Ga0495616_0008225 3300046513 Bacteria 6192
324 Ga0495616_0015792 3300046513 Bacteria 4190
325 Ga0495616_0021803 3300046513 Bacteria 3464
326 Ga0495616_0033468 3300046513 Bacteria 2677
327 Ga0495616_0047686 3300046513 Bacteria 2156
328 Ga0495616_0064414 3300046513 Bacteria 1788
329 Ga0495616_0085901 3300046513 Bacteria 1497
330 Ga0495616_0089429 3300046513 Bacteria 1461
331 Ga0495616_0100453 3300046513 Bacteria 1357
332 Ga0495620_0009177 3300046515 Bacteria 5274
333 Ga0495620_0049032 3300046515 Bacteria 1809
334 Ga0495628_0129413 3300046516 Bacteria 1932
335 Ga0495628_0341761 3300046516 Bacteria 1102
336 Ga0495630_0065162 3300046517 Bacteria 2737
337 Ga0495631_0000258 3300046518 Bacteria 36872
338 Ga0495631_0002833 3300046518 Bacteria 9631
339 Ga0495631_0038634 3300046518 Bacteria 2121
340 Ga0495631_0054938 3300046518 Bacteria 1735
341 Ga0495631_0078696 3300046518 Bacteria 1423
342 Ga0495631_0105310 3300046518 Bacteria 1213
343 Ga0495632_0001448 3300046519 Bacteria 19724
344 Ga0495632_0002364 3300046519 Bacteria 14433
345 Ga0495632_0006809 3300046519 Bacteria 7293
346 Ga0495632_0009773 3300046519 Bacteria 5749
347 Ga0495632_0017144 3300046519 Bacteria 4006
348 Ga0495632_0020092 3300046519 Bacteria 3625
349 Ga0495632_0043342 3300046519 Bacteria 2249
350 Ga0495632_0053835 3300046519 Bacteria 1974
351 Ga0495632_0089460 3300046519 Bacteria 1461
352 Ga0495632_0096716 3300046519 Bacteria 1394
353 Ga0495637_0000559 3300046520 Bacteria 26705
354 Ga0495637_0001664 3300046520 Bacteria 12851
355 Ga0495637_0011147 3300046520 Bacteria 4325
356 Ga0495637_0012036 3300046520 Bacteria 4148
357 Ga0495637_0019279 3300046520 Bacteria 3155
358 Ga0495637_0022165 3300046520 Bacteria 2900
359 Ga0495637_0062662 3300046520 Bacteria 1521
360 Ga0495637_0069808 3300046520 Bacteria 1420
361 Ga0495637_0103330 3300046520 Bacteria 1111
362 Ga0495637_0148291 3300046520 Bacteria 886
363 Ga0495637_0167710 3300046520 Bacteria 820
364 Ga0495643_0007341 3300046522 Bacteria 7123
365 Ga0495643_0019879 3300046522 Bacteria 3881
366 Ga0495643_0027087 3300046522 Bacteria 3225
367 Ga0495643_0074023 3300046522 Bacteria 1784
368 Ga0495644_0005129 3300046523 Bacteria 5128
369 Ga0495644_0005349 3300046523 Bacteria 5013
370 Ga0495644_0018123 3300046523 Bacteria 2688
371 Ga0495644_0033462 3300046523 Bacteria 1942
372 Ga0495644_0038634 3300046523 Bacteria 1800
373 Ga0495648_0037609 3300046524 Bacteria 3107
374 Ga0495648_0040789 3300046524 Bacteria 2938
375 Ga0495648_0046595 3300046524 Bacteria 2685
376 Ga0495648_0060095 3300046524 Bacteria 2263
377 Ga0495648_0083891 3300046524 Bacteria 1804
378 Ga0495648_0186636 3300046524 Bacteria 1049
379 Ga0495666_0009909 3300046526 Bacteria 4759
380 Ga0495666_0020857 3300046526 Bacteria 3244
381 Ga0495666_0055639 3300046526 Bacteria 1896
382 Ga0495666_0057492 3300046526 Bacteria 1862
383 Ga0495666_0061668 3300046526 Bacteria 1791
384 Ga0495666_0065811 3300046526 Bacteria 1728
385 Ga0495666_0198553 3300046526 Bacteria 922
386 Ga0495642_0004784 3300046528 Bacteria 5236
387 Ga0495642_0005118 3300046528 Bacteria 5048
388 Ga0495654_0000539 3300046530 Bacteria 30544
389 Ga0495654_0001026 3300046530 Bacteria 20452
390 Ga0495654_0001479 3300046530 Bacteria 16094
391 Ga0495654_0009020 3300046530 Bacteria 5476
392 Ga0495654_0012716 3300046530 Bacteria 4518
393 Ga0495654_0020999 3300046530 Bacteria 3400
394 Ga0495654_0023222 3300046530 Bacteria 3213
395 Ga0495654_0060447 3300046530 Bacteria 1821
396 Ga0495654_0074128 3300046530 Bacteria 1608
397 Ga0495654_0079376 3300046530 Bacteria 1541
398 Ga0495654_0097470 3300046530 Bacteria 1357
399 Ga0495654_0111247 3300046530 Bacteria 1249
400 Ga0495654_0112689 3300046530 Bacteria 1239
401 Ga0495654_0202992 3300046530 Bacteria 847
402 Ga0495654_0203276 3300046530 Bacteria 846
403 Ga0495654_0232709 3300046530 Bacteria 774
404 Ga0495654_0245610 3300046530 Bacteria 747
405 Ga0495586_0003995 3300046535 Bacteria 7906
406 Ga0495587_0011563 3300046536 Bacteria 5588
407 Ga0495587_0015053 3300046536 Bacteria 4834
408 Ga0495609_0005222 3300046538 Bacteria 6907
409 Ga0495609_0006733 3300046538 Bacteria 5827
410 Ga0495609_0037618 3300046538 Bacteria 2182
411 Ga0495597_0002458 3300046542 Bacteria 11722
412 Ga0495597_0009101 3300046542 Bacteria 4931
413 Ga0495597_0012866 3300046542 Bacteria 4026
414 Ga0495597_0032478 3300046542 Bacteria 2369
415 Ga0495597_0036386 3300046542 Bacteria 2217
416 Ga0495597_0053427 3300046542 Bacteria 1776
417 Ga0495597_0141134 3300046542 Bacteria 993
418 Ga0495597_0160537 3300046542 Bacteria 917
419 Ga0495597_0191240 3300046542 Bacteria 823
420 Ga0495622_0000947 3300046557 Bacteria 15557
421 Ga0495622_0005014 3300046557 Bacteria 6135
422 Ga0495622_0012286 3300046557 Bacteria 3960
423 Ga0495622_0039161 3300046557 Bacteria 2207
424 Ga0495622_0105400 3300046557 Bacteria 1291
425 Ga0495622_0254717 3300046557 Bacteria 771
426 Ga0495622_0361640 3300046557 Bacteria 627
427 Ga0495633_0012392 3300046558 Bacteria 4536
428 Ga0495656_0004689 3300046615 Bacteria 4696
429 Ga0495656_0044240 3300046615 Bacteria 1873
430 Ga0495656_0063274 3300046615 Bacteria 1621
431 Ga0495656_0324757 3300046615 Bacteria 793
432 Ga0495668_0009322 3300046616 Bacteria 6034
433 Ga0495668_0093442 3300046616 Bacteria 1647
434 Ga0495634_0021525 3300046642 Bacteria 4555
435 Ga0495634_0088790 3300046642 Bacteria 2010
436 Ga0495611_0013671 3300046648 Bacteria 3459
437 Ga0495611_0035788 3300046648 Bacteria 2201
438 Ga0495611_0123357 3300046648 Bacteria 1208
439 Ga0495611_0178270 3300046648 Bacteria 993
440 Ga0495625_0019629 3300046660 Bacteria 5235
441 Ga0495625_0020922 3300046660 Bacteria 5043
442 Ga0495625_0048024 3300046660 Bacteria 3075
443 Ga0495625_0050678 3300046660 Bacteria 2978
444 Ga0495625_0082139 3300046660 Bacteria 2241
445 Ga0495625_0150054 3300046660 Bacteria 1567
446 Ga0495625_0177071 3300046660 Bacteria 1420
447 Ga0495625_0209107 3300046660 Bacteria 1283
448 Ga0495625_0237629 3300046660 Bacteria 1187
449 Ga0495635_0004868 3300046663 Bacteria 9344
450 Ga0495635_0005483 3300046663 Bacteria 8824
451 Ga0495659_0000190 3300046664 Bacteria 26750
452 Ga0495659_0003974 3300046664 Bacteria 4682
453 Ga0495659_0098238 3300046664 Bacteria 1131
454 Ga0495659_0105102 3300046664 Bacteria 1097
455 Ga0495661_0000782 3300046665 Bacteria 30258
456 Ga0495661_0021196 3300046665 Bacteria 4238
457 Ga0495661_0048590 3300046665 Bacteria 2577
458 Ga0495661_0053653 3300046665 Bacteria 2423
459 Ga0495661_0056288 3300046665 Bacteria 2353
460 Ga0495661_0089314 3300046665 Bacteria 1757
461 Ga0495661_0098464 3300046665 Bacteria 1650
462 Ga0495661_0157607 3300046665 Bacteria 1221
463 Ga0495588_0045082 3300046674 Bacteria 2260
464 Ga0495588_0057918 3300046674 Bacteria 2002
465 Ga0495588_0063938 3300046674 Bacteria 1909
466 Ga0495588_0103026 3300046674 Bacteria 1500
467 Ga0495657_0094494 3300046675 Bacteria 1912
468 Ga0495623_0014914 3300046679 Bacteria 5025
469 Ga0495623_0018649 3300046679 Bacteria 4479
470 Ga0495646_0021849 3300046680 Bacteria 4041
471 Ga0495646_0094845 3300046680 Bacteria 1717
472 Ga0495646_0094846 3300046680 Bacteria 1717
473 Ga0495646_0144327 3300046680 Bacteria 1328
474 Ga0495669_0007494 3300046684 Bacteria 4577
475 Ga0495669_0015503 3300046684 Bacteria 3264
476 Ga0495669_0124155 3300046684 Bacteria 1212
477 Ga0495613_0025057 3300046689 Bacteria 4446
478 Ga0495670_0001101 3300046691 Bacteria 13125
479 Ga0495670_0004256 3300046691 Bacteria 7012
480 Ga0495670_0033976 3300046691 Bacteria 2538
481 Ga0495670_0060456 3300046691 Bacteria 1903
482 Ga0495670_0064588 3300046691 Bacteria 1844
483 Ga0495670_0108219 3300046691 Bacteria 1437
484 Ga0495670_0164964 3300046691 Bacteria 1165
485 Ga0495670_0171098 3300046691 Bacteria 1144
486 Ga0495670_0437296 3300046691 Bacteria 708
487 Ga0495671_0016615 3300046692 Bacteria 3926
488 Ga0495671_0019470 3300046692 Bacteria 3587
489 Ga0495671_0020922 3300046692 Bacteria 3442
490 Ga0495671_0039037 3300046692 Bacteria 2398
491 Ga0495671_0047480 3300046692 Bacteria 2145
492 Ga0495671_0061730 3300046692 Bacteria 1848
493 Ga0495649_0015044 3300046694 Bacteria 4416
494 Ga0495649_0016765 3300046694 Bacteria 4148
495 Ga0495649_0094748 3300046694 Bacteria 1589
496 Ga0495649_0260757 3300046694 Bacteria 888
497 Ga0495589_0003552 3300046794 Bacteria 8432
498 Ga0495589_0005592 3300046794 Bacteria 6627
499 Ga0495589_0012356 3300046794 Bacteria 4423
500 Ga0495589_0015894 3300046794 Bacteria 3870
501 Ga0495589_0024177 3300046794 Bacteria 3088
502 Ga0495600_0035628 3300046809 Bacteria 3233
503 Ga0495600_0084261 3300046809 Bacteria 2074
504 Ga0495660_0014893 3300046810 Bacteria 4497
505 Ga0495660_0015255 3300046810 Bacteria 4439
506 Ga0495660_0024850 3300046810 Bacteria 3408
507 Ga0495660_0047810 3300046810 Bacteria 2341
508 Ga0495660_0061462 3300046810 Bacteria 2015
509 Ga0495660_0066500 3300046810 Bacteria 1922
510 Ga0495660_0078840 3300046810 Bacteria 1730
511 Ga0495660_0098491 3300046810 Bacteria 1508
512 Ga0495660_0110099 3300046810 Bacteria 1406
513 Ga0495660_0113317 3300046810 Bacteria 1381
514 Ga0495660_0132252 3300046810 Bacteria 1250
515 Ga0495581_0011698 3300047315 Bacteria 5078
516 Ga0495581_0034610 3300047315 Bacteria 2922
517 Ga0495604_0009630 3300047317 Bacteria 7640
518 Ga0495604_0145765 3300047317 Bacteria 1687
519 Ga0495604_0301780 3300047317 Bacteria 1075
520 Ga0495636_0000729 3300047318 Bacteria 12060
521 Ga0495636_0009678 3300047318 Bacteria 3795
522 Ga0495636_0018109 3300047318 Bacteria 2824
523 Ga0495636_0141805 3300047318 Bacteria 1073
524 Ga0495636_0152570 3300047318 Bacteria 1037
525 Ga0495636_0371530 3300047318 Bacteria 677
526 Ga0495672_0000903 3300047320 Bacteria 31104
527 Ga0495672_0001057 3300047320 Bacteria 28116
528 Ga0495672_0002947 3300047320 Bacteria 14996
529 Ga0495672_0003267 3300047320 Bacteria 14040
530 Ga0495672_0015421 3300047320 Bacteria 5189
531 Ga0495672_0023240 3300047320 Bacteria 4016
532 Ga0495672_0059967 3300047320 Bacteria 2199
533 Ga0495672_0069394 3300047320 Bacteria 2001
534 Ga0495672_0107281 3300047320 Bacteria 1504
535 Ga0495672_0123758 3300047320 Bacteria 1370
536 Ga0495672_0137192 3300047320 Bacteria 1281
537 Ga0495672_0162514 3300047320 Bacteria 1146
538 Ga0495680_0002124 3300047322 Bacteria 20589
539 Ga0495680_0036693 3300047322 Bacteria 3932
540 Ga0495680_0057148 3300047322 Bacteria 3018
541 Ga0495683_0000410 3300047323 Bacteria 34329
542 Ga0495683_0011473 3300047323 Bacteria 4662
543 Ga0495683_0012445 3300047323 Bacteria 4463
544 Ga0495683_0014707 3300047323 Bacteria 4076
545 Ga0495683_0016934 3300047323 Bacteria 3779
546 Ga0495683_0026918 3300047323 Bacteria 2942
547 Ga0495683_0165912 3300047323 Bacteria 1018
548 Ga0495683_0248512 3300047323 Bacteria 781
549 Ga0495687_005605 3300047443 Bacteria 7938
550 Ga0495687_011366 3300047443 Bacteria 4795
551 Ga0495687_068505 3300047443 Bacteria 1432
552 Ga0495675_0013515 3300047444 Bacteria 5154
553 Ga0495675_0032919 3300047444 Bacteria 3307
554 Ga0495677_0005006 3300047445 Bacteria 5055
555 Ga0495679_004397 3300047446 Bacteria 6522
556 Ga0495679_005683 3300047446 Bacteria 5498
557 Ga0495679_007767 3300047446 Bacteria 4431
558 Ga0495679_014934 3300047446 Bacteria 2856
559 Ga0495673_0001304 3300047469 Bacteria 20313
560 Ga0495673_0001931 3300047469 Bacteria 15403
561 Ga0495673_0003218 3300047469 Bacteria 10895
562 Ga0495673_0006593 3300047469 Bacteria 6807
563 Ga0495673_0012966 3300047469 Bacteria 4393
564 Ga0495673_0013306 3300047469 Bacteria 4326
565 Ga0495673_0016563 3300047469 Bacteria 3766
566 Ga0495673_0022290 3300047469 Bacteria 3108
567 Ga0495673_0027934 3300047469 Bacteria 2677
568 Ga0495673_0031586 3300047469 Bacteria 2478
569 Ga0495673_0045194 3300047469 Bacteria 1959
570 Ga0495673_0050551 3300047469 Bacteria 1823
571 Ga0495673_0061157 3300047469 Bacteria 1613
572 Ga0495673_0100780 3300047469 Bacteria 1167
573 Ga0495681_0011290 3300047470 Bacteria 5329
574 Ga0495681_0023228 3300047470 Bacteria 3299
575 Ga0495681_0028929 3300047470 Bacteria 2842
576 Ga0495681_0037408 3300047470 Bacteria 2390
577 Ga0495681_0046340 3300047470 Bacteria 2073
578 Ga0495681_0055572 3300047470 Bacteria 1845
579 Ga0495681_0065625 3300047470 Bacteria 1659
580 Ga0495681_0125479 3300047470 Bacteria 1097
581 Ga0495684_0032357 3300047471 Bacteria 4015
582 Ga0495686_0027308 3300047472 Bacteria 3728
583 Ga0495686_0074295 3300047472 Bacteria 2086
584 Ga0495686_0276499 3300047472 Bacteria 935
585 Ga0495593_0014912 3300047673 Bacteria 4415
586 Ga0495593_0029113 3300047673 Bacteria 3030
587 Ga0495593_0097455 3300047673 Bacteria 1510
588 Ga0495593_0100483 3300047673 Bacteria 1483
589 Ga0495593_0144444 3300047673 Bacteria 1204
590 Ga0495602_0625276 3300048088 Bacteria 738
591 Ga0495626_0001994 3300048091 Bacteria 15067
592 Ga0495626_0005043 3300048091 Bacteria 7881
593 Ga0495626_0005509 3300048091 Bacteria 7374
594 Ga0495626_0016919 3300048091 Bacteria 3694
595 Ga0495626_0065077 3300048091 Bacteria 1650
596 Ga0495626_0080009 3300048091 Bacteria 1453
597 Ga0495626_0080299 3300048091 Bacteria 1450
598 Ga0495626_0108638 3300048091 Bacteria 1203
599 Ga0495626_0146875 3300048091 Bacteria 996
600 Ga0496102_0676814 3300048905 Bacteria 955
601 Ga0496103_0248773 3300048906 Bacteria 1144
602 Ga0496104_0507868 3300048907 Bacteria 1117
603 Ga0496105_0224017 3300048908 Bacteria 1530
604 Ga0496106_0171233 3300048909 Bacteria 1721
605 Ga0496106_0190518 3300048909 Bacteria 1630
606 Ga0496110_0110359 3300048913 Bacteria 2471
607 Ga0496110_0350274 3300048913 Bacteria 1345
608 Ga0496111_0383429 3300048914 Bacteria 1039
609 Ga0496114_1113072 3300048917 Bacteria 675
610 Ga0496115_0080225 3300048918 Bacteria 2657
611 Ga0496116_0002665 3300048919 Bacteria 18476
612 Ga0496116_0153671 3300048919 Bacteria 1274
613 Ga0496116_0186766 3300048919 Bacteria 1102
614 Ga0496116_0193915 3300048919 Bacteria 1072
615 Ga0496117_0001362 3300048920 Bacteria 35647
616 Ga0496117_0037297 3300048920 Bacteria 3622
617 Ga0496117_0064368 3300048920 Bacteria 2500
618 Ga0496117_0086070 3300048920 Bacteria 2043
619 Ga0496117_0097819 3300048920 Bacteria 1868
620 Ga0496118_0038459 3300048921 Bacteria 3834
621 Ga0496118_0073471 3300048921 Bacteria 2450
622 Ga0496118_0086637 3300048921 Bacteria 2175
623 Ga0496118_0125830 3300048921 Bacteria 1659
624 Ga0496118_0454172 3300048921 Bacteria 650
625 Ga0496119_0019596 3300048922 Bacteria 4971
626 Ga0496119_0041808 3300048922 Bacteria 2913
627 Ga0496120_0006160 3300048923 Bacteria 9290
628 Ga0496120_0009103 3300048923 Bacteria 7088
629 Ga0496121_0034375 3300048924 Bacteria 4563
630 Ga0496121_0052494 3300048924 Bacteria 3423
631 Ga0496121_0053873 3300048924 Bacteria 3367
632 Ga0496121_0081372 3300048924 Bacteria 2563
633 Ga0496121_0155161 3300048924 Bacteria 1680
634 Ga0496121_0205747 3300048924 Bacteria 1398
635 Ga0496121_0340505 3300048924 Bacteria 1002
636 Ga0496122_0024406 3300048925 Bacteria 5291
637 Ga0496122_0072678 3300048925 Bacteria 2444
638 Ga0496122_0114390 3300048925 Bacteria 1760
639 Ga0496122_0118815 3300048925 Bacteria 1711
640 Ga0496122_0230211 3300048925 Bacteria 1054
641 Ga0496123_0020715 3300048926 Bacteria 5136
642 Ga0496123_0038162 3300048926 Bacteria 3380
643 Ga0496123_0067920 3300048926 Bacteria 2248
644 Ga0496123_0146538 3300048926 Bacteria 1281
645 Ga0496123_0183827 3300048926 Bacteria 1088
646 Ga0496124_0006360 3300048927 Bacteria 12890
647 Ga0496124_0019249 3300048927 Bacteria 6362
648 Ga0496124_0039470 3300048927 Bacteria 4093
649 Ga0496124_0040447 3300048927 Bacteria 4031
650 Ga0496124_0061924 3300048927 Bacteria 3134
651 Ga0496124_0075219 3300048927 Bacteria 2790
652 Ga0496124_0176172 3300048927 Bacteria 1650
653 Ga0496124_0362538 3300048927 Bacteria 1020
654 Ga0496124_0364225 3300048927 Bacteria 1017
655 Ga0496125_0001556 3300048928 Bacteria 32734
656 Ga0496125_0032993 3300048928 Bacteria 4589
657 Ga0496125_0034115 3300048928 Bacteria 4490
658 Ga0496125_0038704 3300048928 Bacteria 4120
659 Ga0496125_0041788 3300048928 Bacteria 3914
660 Ga0496125_0065876 3300048928 Bacteria 2866
661 Ga0496125_0077594 3300048928 Bacteria 2559
662 Ga0496125_0103531 3300048928 Bacteria 2088
663 Ga0496125_0118851 3300048928 Bacteria 1891
664 Ga0496125_0130714 3300048928 Bacteria 1768
665 Ga0496125_0141548 3300048928 Bacteria 1671
666 Ga0496125_0288307 3300048928 Bacteria 1012
667 Ga0496126_0125797 3300048929 Bacteria 2218
668 Ga0496126_0165179 3300048929 Bacteria 1889
669 Ga0496126_0238467 3300048929 Bacteria 1520
670 Ga0496126_0261342 3300048929 Bacteria 1439
671 Ga0496126_0435633 3300048929 Bacteria 1057
672 Ga0495678_006832 3300049459 Bacteria 6002
673 Ga0495678_007299 3300049459 Bacteria 5747
674 Ga0495678_016449 3300049459 Bacteria 3382
675 Ga0495678_017589 3300049459 Bacteria 3233
676 Ga0495678_019502 3300049459 Bacteria 3024
677 Ga0495678_039041 3300049459 Bacteria 1916
678 Ga0495678_065062 3300049459 Bacteria 1355
679 Ga0495678_065783 3300049459 Bacteria 1344
680 Ga0495678_103275 3300049459 Bacteria 984
681 Ga0495678_128952 3300049459 Bacteria 840
682 Ga0495682_0000102 3300049460 Bacteria 75726
683 Ga0495682_0007490 3300049460 Bacteria 4337
684 Ga0495682_0009683 3300049460 Bacteria 3753
685 Ga0495682_0014355 3300049460 Bacteria 3005
686 Ga0495682_0033679 3300049460 Bacteria 1890
687 Ga0495682_0034817 3300049460 Bacteria 1856
688 Ga0495682_0047407 3300049460 Bacteria 1567
689 Ga0495682_0065643 3300049460 Bacteria 1308
690 Ga0495682_0067124 3300049460 Bacteria 1292
691 Ga0495682_0088411 3300049460 Bacteria 1113
692 Ga0495682_0100958 3300049460 Bacteria 1035
693 Ga0500634_0077630 3300053161 Bacteria 1720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0454172 Ga0496118_0454172_98_589 163
2 3300046477 Ga0495664_0318285 Ga0495664_0318285_17_529 170
3 3300046512 Ga0495610_0135254 Ga0495610_0135254_26_550 174
4 3300046557 Ga0495622_0361640 Ga0495622_0361640_59_589 176
5 3300046523 Ga0495644_0038634 Ga0495644_0038634_956_1537 178
6 3300042142 Ga0450905_033476 Ga0450905_033476_225_767 180
7 3300042146 Ga0450907_003286 Ga0450907_003286_2350_2892 180
8 3300046475 Ga0495639_0514774 Ga0495639_0514774_27_569 180
9 3300046691 Ga0495670_0437296 Ga0495670_0437296_155_697 180
10 3300048917 Ga0496114_1113072 Ga0496114_1113072_96_638 180
11 3300048927 Ga0496124_0040447 Ga0496124_0040447_2752_3348 182
12 3300042135 Ga0450899_005965 Ga0450899_005965_148_744 183
13 3300046458 Ga0495591_009235 Ga0495591_009235_778_1383 183
14 3300046491 Ga0495584_0000909 Ga0495584_0000909_11755_12360 183
15 3300046512 Ga0495610_0008501 Ga0495610_0008501_3675_4280 183
16 3300046520 Ga0495637_0019279 Ga0495637_0019279_1541_2146 183
17 3300046615 Ga0495656_0063274 Ga0495656_0063274_149_754 183
18 3300046648 Ga0495611_0178270 Ga0495611_0178270_83_688 183
19 3300046665 Ga0495661_0089314 Ga0495661_0089314_442_1047 183
20 3300046691 Ga0495670_0064588 Ga0495670_0064588_459_1064 183
21 3300046692 Ga0495671_0061730 Ga0495671_0061730_1011_1616 183
22 3300047470 Ga0495681_0028929 Ga0495681_0028929_1434_2039 183
23 3300047472 Ga0495686_0276499 Ga0495686_0276499_126_731 183
24 3300009011 Ga0105251_10029444 Ga0105251_100294443 184
25 3300013306 Ga0163162_10192499 Ga0163162_101924992 184
26 3300013306 Ga0163162_10330272 Ga0163162_103302722 184
27 3300017792 Ga0163161_10071249 Ga0163161_100712492 184
28 3300025735 Ga0207713_1000463 Ga0207713_100046342 184
29 3300028379 Ga0268266_10041340 Ga0268266_100413405 184
30 3300031731 Ga0307405_10013153 Ga0307405_100131535 184
31 3300031911 Ga0307412_10109248 Ga0307412_101092482 184
32 3300048919 Ga0496116_0186766 Ga0496116_0186766_399_995 184
33 3300048920 Ga0496117_0037297 Ga0496117_0037297_410_1006 184
34 3300048921 Ga0496118_0038459 Ga0496118_0038459_613_1209 184
35 3300048921 Ga0496118_0073471 Ga0496118_0073471_514_1110 184
36 3300048924 Ga0496121_0081372 Ga0496121_0081372_934_1530 184
37 3300048924 Ga0496121_0340505 Ga0496121_0340505_329_925 184
38 3300048925 Ga0496122_0114390 Ga0496122_0114390_935_1531 184
39 3300048926 Ga0496123_0183827 Ga0496123_0183827_265_861 184
40 3300048927 Ga0496124_0039470 Ga0496124_0039470_778_1374 184
41 3300048928 Ga0496125_0118851 Ga0496125_0118851_770_1366 184
42 3300048928 Ga0496125_0141548 Ga0496125_0141548_507_1103 184
43 3300042010 Ga0439452_020344 Ga0439452_020344_563_1123 186
44 3300044656 Ga0466969_0011980 Ga0466969_0011980_1519_2169 187
45 3300044683 Ga0466965_0041544 Ga0466965_0041544_53_703 187
46 3300044684 Ga0466966_0010422 Ga0466966_0010422_2704_3354 187
47 3300044693 Ga0466961_0006453 Ga0466961_0006453_3085_3735 187
48 3300045049 Ga0466959_0009131 Ga0466959_0009131_1218_1868 187
49 3300046452 Ga0495617_013560 Ga0495617_013560_985_1605 187
50 3300046458 Ga0495591_046154 Ga0495591_046154_172_792 187
51 3300046471 Ga0495650_0004290 Ga0495650_0004290_3951_4571 187
52 3300046474 Ga0495605_0053029 Ga0495605_0053029_214_834 187
53 3300046501 Ga0495607_0069107 Ga0495607_0069107_376_996 187
54 3300046512 Ga0495610_0058611 Ga0495610_0058611_161_781 187
55 3300046513 Ga0495616_0021803 Ga0495616_0021803_1798_2418 187
56 3300046515 Ga0495620_0049032 Ga0495620_0049032_1052_1672 187
57 3300046518 Ga0495631_0000258 Ga0495631_0000258_17603_18223 187
58 3300046520 Ga0495637_0022165 Ga0495637_0022165_1191_1811 187
59 3300046526 Ga0495666_0009909 Ga0495666_0009909_1090_1710 187
60 3300046530 Ga0495654_0012716 Ga0495654_0012716_1052_1672 187
61 3300046558 Ga0495633_0012392 Ga0495633_0012392_2886_3506 187
62 3300046660 Ga0495625_0019629 Ga0495625_0019629_1056_1676 187
63 3300046665 Ga0495661_0021196 Ga0495661_0021196_801_1421 187
64 3300046691 Ga0495670_0164964 Ga0495670_0164964_158_778 187
65 3300047323 Ga0495683_0000410 Ga0495683_0000410_18612_19232 187
66 3300047469 Ga0495673_0001304 Ga0495673_0001304_17625_18245 187
67 3300047470 Ga0495681_0065625 Ga0495681_0065625_204_824 187
68 3300048919 Ga0496116_0193915 Ga0496116_0193915_108_728 187
69 3300048920 Ga0496117_0097819 Ga0496117_0097819_456_1076 187
70 3300048924 Ga0496121_0205747 Ga0496121_0205747_119_739 187
71 3300048927 Ga0496124_0075219 Ga0496124_0075219_1446_2066 187
72 3300048928 Ga0496125_0065876 Ga0496125_0065876_992_1612 187
73 3300046642 Ga0495634_0021525 Ga0495634_0021525_2931_3551 188
74 3300046680 Ga0495646_0094845 Ga0495646_0094845_302_922 188
75 3300047317 Ga0495604_0145765 Ga0495604_0145765_211_831 188
76 3300047444 Ga0495675_0032919 Ga0495675_0032919_476_1096 188
77 3300047673 Ga0495593_0100483 Ga0495593_0100483_276_896 188
78 3300046492 Ga0495585_0025294 Ga0495585_0025294_2759_3379 189
79 3300046500 Ga0495596_0087413 Ga0495596_0087413_339_959 189
80 3300046524 Ga0495648_0040789 Ga0495648_0040789_2014_2634 189
81 3300046810 Ga0495660_0066500 Ga0495660_0066500_325_945 189
82 3300047320 Ga0495672_0137192 Ga0495672_0137192_351_971 189
83 3300049460 Ga0495682_0088411 Ga0495682_0088411_132_752 189
84 iso_pu_bacteria 3007866637 3007866869 189
85 3300046463 Ga0495653_0005839 Ga0495653_0005839_2020_2640 190
86 3300046516 Ga0495628_0129413 Ga0495628_0129413_476_1096 190
87 3300046526 Ga0495666_0198553 Ga0495666_0198553_280_900 190
88 3300046536 Ga0495587_0015053 Ga0495587_0015053_1576_2196 190
89 3300046663 Ga0495635_0004868 Ga0495635_0004868_1130_1750 190
90 3300046679 Ga0495623_0018649 Ga0495623_0018649_2915_3535 190
91 3300046680 Ga0495646_0094846 Ga0495646_0094846_302_922 190
92 3300047673 Ga0495593_0144444 Ga0495593_0144444_201_821 190
93 3300048929 Ga0496126_0165179 Ga0496126_0165179_821_1441 190
94 iso_pu_bacteria 2599185167 2599400660 190
95 iso_pu_bacteria 2599185179 2599449986 190
96 iso_pu_bacteria 2599185190 2599512060 190
97 iso_pu_bacteria 2599185191 2599517041 190
98 iso_pu_bacteria 2599185290 2599892578 190
99 iso_pu_bacteria 2834028612 2834030831 190
100 iso_pu_bacteria 2931390751 2931396295 190
101 iso_pu_bacteria 8056161164 8056163510 190
102 iso_pu_bacteria 2945928738 2945931031 191
103 iso_pu_bacteria 8055817908 8055823782 191
104 3300009036 Ga0105244_10097553 Ga0105244_100975532 193
105 3300013104 Ga0157370_10022304 Ga0157370_100223045 193
106 3300041405 Ga0439438_007729 Ga0439438_007729_2967_3548 193
107 3300041407 Ga0439447_020280 Ga0439447_020280_885_1466 193
108 3300041411 Ga0439466_0040653 Ga0439466_0040653_717_1298 193
109 3300041411 Ga0439466_0043410 Ga0439466_0043410_194_775 193
110 3300042009 Ga0439451_002185 Ga0439451_002185_482_1066 193
111 3300042137 Ga0450902_005329 Ga0450902_005329_253_834 193
112 3300042137 Ga0450902_010819 Ga0450902_010819_191_772 193
113 3300042137 Ga0450902_035877 Ga0450902_035877_12_593 193
114 3300042138 Ga0450903_023778 Ga0450903_023778_190_771 193
115 3300042142 Ga0450905_007129 Ga0450905_007129_184_765 193
116 3300042142 Ga0450905_010733 Ga0450905_010733_333_914 193
117 3300042142 Ga0450905_011630 Ga0450905_011630_82_663 193
118 3300046455 Ga0495603_0011221 Ga0495603_0011221_2268_2849 193
119 3300046457 Ga0495590_0019148 Ga0495590_0019148_1145_1726 193
120 3300046458 Ga0495591_000345 Ga0495591_000345_28512_29093 193
121 3300046460 Ga0495638_0009372 Ga0495638_0009372_4065_4646 193
122 3300046471 Ga0495650_0017102 Ga0495650_0017102_611_1192 193
123 3300046474 Ga0495605_0059395 Ga0495605_0059395_232_813 193
124 3300046474 Ga0495605_0073981 Ga0495605_0073981_802_1383 193
125 3300046475 Ga0495639_0000205 Ga0495639_0000205_12769_13350 193
126 3300046491 Ga0495584_0013876 Ga0495584_0013876_2888_3469 193
127 3300046499 Ga0495594_0029214 Ga0495594_0029214_1158_1739 193
128 3300046499 Ga0495594_0036991 Ga0495594_0036991_941_1522 193
129 3300046500 Ga0495596_0000914 Ga0495596_0000914_2456_3037 193
130 3300046506 Ga0495583_0013708 Ga0495583_0013708_1067_1648 193
131 3300046519 Ga0495632_0017144 Ga0495632_0017144_970_1551 193
132 3300046520 Ga0495637_0000559 Ga0495637_0000559_18143_18724 193
133 3300046520 Ga0495637_0167710 Ga0495637_0167710_192_773 193
134 3300046523 Ga0495644_0018123 Ga0495644_0018123_1909_2490 193
135 3300046524 Ga0495648_0037609 Ga0495648_0037609_2456_3037 193
136 3300046526 Ga0495666_0055639 Ga0495666_0055639_62_643 193
137 3300046528 Ga0495642_0004784 Ga0495642_0004784_3449_4030 193
138 3300046530 Ga0495654_0001026 Ga0495654_0001026_7623_8204 193
139 3300046530 Ga0495654_0020999 Ga0495654_0020999_2456_3037 193
140 3300046542 Ga0495597_0160537 Ga0495597_0160537_242_823 193
141 3300046557 Ga0495622_0000947 Ga0495622_0000947_2195_2776 193
142 3300046557 Ga0495622_0012286 Ga0495622_0012286_3060_3641 193
143 3300046616 Ga0495668_0009322 Ga0495668_0009322_2862_3443 193
144 3300046660 Ga0495625_0020922 Ga0495625_0020922_1645_2226 193
145 3300046660 Ga0495625_0050678 Ga0495625_0050678_1178_1759 193
146 3300046664 Ga0495659_0000190 Ga0495659_0000190_12761_13342 193
147 3300046664 Ga0495659_0003974 Ga0495659_0003974_878_1459 193
148 3300046674 Ga0495588_0063938 Ga0495588_0063938_227_808 193
149 3300046691 Ga0495670_0033976 Ga0495670_0033976_1015_1596 193
150 3300046691 Ga0495670_0171098 Ga0495670_0171098_543_1124 193
151 3300046692 Ga0495671_0016615 Ga0495671_0016615_3196_3777 193
152 3300046692 Ga0495671_0047480 Ga0495671_0047480_134_715 193
153 3300046694 Ga0495649_0015044 Ga0495649_0015044_2789_3370 193
154 3300046794 Ga0495589_0012356 Ga0495589_0012356_2790_3371 193
155 3300046810 Ga0495660_0047810 Ga0495660_0047810_1020_1601 193
156 3300046810 Ga0495660_0113317 Ga0495660_0113317_386_967 193
157 3300047320 Ga0495672_0003267 Ga0495672_0003267_2380_2961 193
158 3300047323 Ga0495683_0026918 Ga0495683_0026918_421_1002 193
159 3300047323 Ga0495683_0165912 Ga0495683_0165912_98_679 193
160 3300047443 Ga0495687_005605 Ga0495687_005605_3222_3803 193
161 3300047443 Ga0495687_068505 Ga0495687_068505_361_942 193
162 3300047446 Ga0495679_007767 Ga0495679_007767_2755_3336 193
163 3300047469 Ga0495673_0050551 Ga0495673_0050551_869_1450 193
164 3300047470 Ga0495681_0011290 Ga0495681_0011290_790_1371 193
165 3300047472 Ga0495686_0027308 Ga0495686_0027308_2221_2802 193
166 3300047673 Ga0495593_0014912 Ga0495593_0014912_2005_2586 193
167 3300048091 Ga0495626_0146875 Ga0495626_0146875_315_896 193
168 3300048905 Ga0496102_0676814 Ga0496102_0676814_198_779 193
169 3300048908 Ga0496105_0224017 Ga0496105_0224017_785_1366 193
170 3300048909 Ga0496106_0190518 Ga0496106_0190518_870_1451 193
171 3300048919 Ga0496116_0002665 Ga0496116_0002665_5099_5680 193
172 3300048921 Ga0496118_0125830 Ga0496118_0125830_66_647 193
173 3300048924 Ga0496121_0034375 Ga0496121_0034375_553_1134 193
174 3300048925 Ga0496122_0024406 Ga0496122_0024406_3658_4239 193
175 3300048926 Ga0496123_0146538 Ga0496123_0146538_347_928 193
176 3300048927 Ga0496124_0061924 Ga0496124_0061924_1043_1624 193
177 3300049459 Ga0495678_103275 Ga0495678_103275_101_682 193
178 iso_pu_bacteria 2599185189 2599505638 193
179 iso_pu_bacteria 2842826826 2842831447 193
180 iso_pu_bacteria 2842837860 2842842958 193
181 iso_pu_bacteria 2852612431 2852616234 193
182 iso_pu_bacteria 2852667396 2852671202 193
183 iso_pu_bacteria 2860867994 2860872910 193
184 iso_pu_bacteria 2908446538 2908452456 193
185 iso_pu_bacteria 2929189879 2929195028 193
186 iso_pu_bacteria 2945961074 2945966727 193
187 iso_pu_bacteria 2946027586 2946027787 193
188 iso_pu_bacteria 8054285046 8054287418 193
189 iso_pu_bacteria 8054347763 8054349694 193
190 iso_pu_bacteria 8054503363 8054508813 193
191 iso_pu_bacteria 8056131705 8056137195 193
192 iso_pu_bacteria 8056148874 8056151616 193
193 3300005288 Ga0065714_10010148 Ga0065714_100101484 194
194 3300005344 Ga0070661_100147689 Ga0070661_1001476892 194
195 3300005353 Ga0070669_100000963 Ga0070669_10000096312 194
196 3300005457 Ga0070662_100003356 Ga0070662_1000033562 194
197 3300005539 Ga0068853_100000448 Ga0068853_10000044822 194
198 3300005548 Ga0070665_100097186 Ga0070665_1000971863 194
199 3300005564 Ga0070664_100243412 Ga0070664_1002434122 194
200 3300005578 Ga0068854_100061343 Ga0068854_1000613434 194
201 3300005834 Ga0068851_10000012 Ga0068851_10000012136 194
202 3300009011 Ga0105251_10002313 Ga0105251_100023135 194
203 3300009177 Ga0105248_10022667 Ga0105248_100226673 194
204 3300009545 Ga0105237_10528733 Ga0105237_105287332 194
205 3300013100 Ga0157373_10006253 Ga0157373_100062535 194
206 3300013102 Ga0157371_10605004 Ga0157371_106050041 194
207 3300013105 Ga0157369_10005450 Ga0157369_1000545014 194
208 3300013105 Ga0157369_10020373 Ga0157369_100203732 194
209 3300014497 Ga0182008_10002588 Ga0182008_100025884 194
210 3300014497 Ga0182008_10066852 Ga0182008_100668521 194
211 3300015262 Ga0182007_10002013 Ga0182007_100020135 194
212 3300025321 Ga0207656_10000006 Ga0207656_10000006183 194
213 3300025735 Ga0207713_1000438 Ga0207713_100043826 194
214 3300025914 Ga0207671_10365033 Ga0207671_103650332 194
215 3300025923 Ga0207681_10000132 Ga0207681_1000013218 194
216 3300025933 Ga0207706_10000175 Ga0207706_100001758 194
217 3300025945 Ga0207679_10071668 Ga0207679_100716682 194
218 3300026041 Ga0207639_10000857 Ga0207639_1000085713 194
219 3300028379 Ga0268266_10131811 Ga0268266_101318112 194
220 3300042016 Ga0439463_039835 Ga0439463_039835_318_905 194
221 3300042115 Ga0450911_018364 Ga0450911_018364_35_622 194
222 3300046530 Ga0495654_0111247 Ga0495654_0111247_543_1130 194
223 3300048920 Ga0496117_0064368 Ga0496117_0064368_771_1358 194
224 3300048920 Ga0496117_0086070 Ga0496117_0086070_1078_1665 194
225 3300048921 Ga0496118_0086637 Ga0496118_0086637_1092_1679 194
226 3300048922 Ga0496119_0041808 Ga0496119_0041808_1637_2224 194
227 3300048923 Ga0496120_0009103 Ga0496120_0009103_2531_3118 194
228 3300048924 Ga0496121_0155161 Ga0496121_0155161_660_1247 194
229 3300048925 Ga0496122_0118815 Ga0496122_0118815_528_1115 194
230 3300048926 Ga0496123_0067920 Ga0496123_0067920_998_1585 194
231 3300048927 Ga0496124_0176172 Ga0496124_0176172_613_1200 194
232 3300048928 Ga0496125_0041788 Ga0496125_0041788_1529_2116 194
233 3300048928 Ga0496125_0103531 Ga0496125_0103531_971_1558 194
234 iso_pu_bacteria 2597489889 2597872366 194
235 iso_pu_bacteria 2599185288 2599878921 194
236 iso_pu_bacteria 2599185303 2599950875 194
237 iso_pu_bacteria 2619619299 2621296961 194
238 iso_pu_bacteria 2643221571 2643872143 194
239 iso_pu_bacteria 2738541265 2738671782 194
240 iso_pu_bacteria 2738541282 2738750176 194
241 iso_pu_bacteria 2738541294 2738807138 194
242 iso_pu_bacteria 2738541303 2738859216 194
243 iso_pu_bacteria 2738541309 2738894498 194
244 iso_pu_bacteria 2808606385 2808976028 194
245 iso_pu_bacteria 2808606388 2808993135 194
246 iso_pu_bacteria 2816332298 2817493925 194
247 iso_pu_bacteria 2947233263 2947234300 194
248 3300005288 Ga0065714_10002456 Ga0065714_1000245617 197
249 3300005331 Ga0070670_100000567 Ga0070670_10000056711 197
250 3300005331 Ga0070670_100000599 Ga0070670_10000059912 197
251 3300005344 Ga0070661_100002629 Ga0070661_1000026294 197
252 3300005564 Ga0070664_100003719 Ga0070664_1000037194 197
253 3300006051 Ga0075364_10137530 Ga0075364_101375302 197
254 3300009011 Ga0105251_10001756 Ga0105251_100017565 197
255 3300009011 Ga0105251_10351742 Ga0105251_103517421 197
256 3300009036 Ga0105244_10004878 Ga0105244_1000487812 197
257 3300009092 Ga0105250_10000397 Ga0105250_1000039718 197
258 3300009148 Ga0105243_10376840 Ga0105243_103768402 197
259 3300009176 Ga0105242_10009426 Ga0105242_100094264 197
260 3300009545 Ga0105237_10000764 Ga0105237_1000076420 197
261 3300011119 Ga0105246_10000710 Ga0105246_100007107 197
262 3300013100 Ga0157373_10016939 Ga0157373_100169392 197
263 3300013100 Ga0157373_10128728 Ga0157373_101287282 197
264 3300013104 Ga0157370_10076560 Ga0157370_100765602 197
265 3300013105 Ga0157369_10004122 Ga0157369_1000412214 197
266 3300013306 Ga0163162_10190360 Ga0163162_101903603 197
267 3300013308 Ga0157375_10019112 Ga0157375_100191126 197
268 3300013308 Ga0157375_10047697 Ga0157375_100476974 197
269 3300015261 Ga0182006_1000449 Ga0182006_100044915 197
270 3300015261 Ga0182006_1092628 Ga0182006_10926282 197
271 3300015262 Ga0182007_10103981 Ga0182007_101039812 197
272 3300017792 Ga0163161_10053420 Ga0163161_100534202 197
273 3300025711 Ga0207696_1000167 Ga0207696_100016719 197
274 3300025728 Ga0207655_1000346 Ga0207655_100034668 197
275 3300025735 Ga0207713_1006267 Ga0207713_10062676 197
276 3300025914 Ga0207671_10000097 Ga0207671_1000009755 197
277 3300025920 Ga0207649_10000022 Ga0207649_1000002213 197
278 3300025925 Ga0207650_10000140 Ga0207650_1000014046 197
279 3300025925 Ga0207650_10000512 Ga0207650_1000051215 197
280 3300025934 Ga0207686_10000905 Ga0207686_100009056 197
281 3300025935 Ga0207709_10262810 Ga0207709_102628102 197
282 3300025945 Ga0207679_10002116 Ga0207679_100021164 197
283 3300031344 Ga0265316_10111430 Ga0265316_101114303 197
284 3300031344 Ga0265316_10271289 Ga0265316_102712892 197
285 3300046453 Ga0495627_000929 Ga0495627_000929_10248_10844 197
286 3300046453 Ga0495627_053650 Ga0495627_053650_520_1116 197
287 3300046453 Ga0495627_096191 Ga0495627_096191_176_772 197
288 3300046458 Ga0495591_001832 Ga0495591_001832_10239_10835 197
289 3300046458 Ga0495591_071417 Ga0495591_071417_167_763 197
290 3300046501 Ga0495607_0067168 Ga0495607_0067168_125_721 197
291 3300046506 Ga0495583_0004450 Ga0495583_0004450_8499_9095 197
292 3300046507 Ga0495606_0002088 Ga0495606_0002088_10686_11282 197
293 3300046507 Ga0495606_0142079 Ga0495606_0142079_390_986 197
294 3300046512 Ga0495610_0013917 Ga0495610_0013917_3225_3821 197
295 3300046512 Ga0495610_0019193 Ga0495610_0019193_2680_3276 197
296 3300046512 Ga0495610_0020311 Ga0495610_0020311_2013_2609 197
297 3300046512 Ga0495610_0085100 Ga0495610_0085100_515_1111 197
298 3300046513 Ga0495616_0089429 Ga0495616_0089429_269_865 197
299 3300046515 Ga0495620_0009177 Ga0495620_0009177_1686_2282 197
300 3300046518 Ga0495631_0105310 Ga0495631_0105310_215_811 197
301 3300046519 Ga0495632_0020092 Ga0495632_0020092_1136_1732 197
302 3300046520 Ga0495637_0069808 Ga0495637_0069808_773_1369 197
303 3300046524 Ga0495648_0186636 Ga0495648_0186636_436_1032 197
304 3300046530 Ga0495654_0000539 Ga0495654_0000539_16733_17329 197
305 3300046530 Ga0495654_0009020 Ga0495654_0009020_3978_4574 197
306 3300046530 Ga0495654_0074128 Ga0495654_0074128_189_785 197
307 3300046530 Ga0495654_0202992 Ga0495654_0202992_14_610 197
308 3300046530 Ga0495654_0245610 Ga0495654_0245610_122_718 197
309 3300046665 Ga0495661_0000782 Ga0495661_0000782_14130_14726 197
310 3300046665 Ga0495661_0098464 Ga0495661_0098464_941_1537 197
311 3300046694 Ga0495649_0260757 Ga0495649_0260757_187_783 197
312 3300046794 Ga0495589_0015894 Ga0495589_0015894_1389_1985 197
313 3300046810 Ga0495660_0061462 Ga0495660_0061462_606_1202 197
314 3300047446 Ga0495679_004397 Ga0495679_004397_1501_2097 197
315 3300047446 Ga0495679_005683 Ga0495679_005683_931_1527 197
316 3300047469 Ga0495673_0100780 Ga0495673_0100780_367_963 197
317 3300047470 Ga0495681_0023228 Ga0495681_0023228_2035_2631 197
318 3300047470 Ga0495681_0055572 Ga0495681_0055572_329_925 197
319 3300047470 Ga0495681_0125479 Ga0495681_0125479_147_743 197
320 3300048919 Ga0496116_0153671 Ga0496116_0153671_428_1024 197
321 3300048920 Ga0496117_0001362 Ga0496117_0001362_20860_21456 197
322 3300048922 Ga0496119_0019596 Ga0496119_0019596_1674_2270 197
323 3300048923 Ga0496120_0006160 Ga0496120_0006160_3941_4537 197
324 3300048925 Ga0496122_0072678 Ga0496122_0072678_1134_1730 197
325 3300048925 Ga0496122_0230211 Ga0496122_0230211_190_786 197
326 3300048926 Ga0496123_0020715 Ga0496123_0020715_238_834 197
327 3300048926 Ga0496123_0038162 Ga0496123_0038162_939_1535 197
328 3300048927 Ga0496124_0006360 Ga0496124_0006360_1934_2530 197
329 3300048927 Ga0496124_0362538 Ga0496124_0362538_159_755 197
330 3300048927 Ga0496124_0364225 Ga0496124_0364225_336_932 197
331 3300048928 Ga0496125_0001556 Ga0496125_0001556_18057_18653 197
332 3300048928 Ga0496125_0034115 Ga0496125_0034115_748_1344 197
333 3300048928 Ga0496125_0038704 Ga0496125_0038704_739_1335 197
334 3300048928 Ga0496125_0077594 Ga0496125_0077594_771_1367 197
335 3300048928 Ga0496125_0130714 Ga0496125_0130714_1058_1654 197
336 3300048928 Ga0496125_0288307 Ga0496125_0288307_191_787 197
337 3300048929 Ga0496126_0125797 Ga0496126_0125797_346_942 197
338 3300048929 Ga0496126_0238467 Ga0496126_0238467_209_805 197
339 3300048929 Ga0496126_0261342 Ga0496126_0261342_202_798 197
340 3300053161 Ga0500634_0077630 Ga0500634_0077630_912_1508 197
341 iso_pu_bacteria 2511231008 2511277532 197
342 iso_pu_bacteria 2667528176 2671128706 197
343 iso_pu_bacteria 2808606377 2808928564 199
344 iso_pu_bacteria 2808606381 2808950253 199
345 3300028786 Ga0307517_10186034 Ga0307517_101860342 201
346 3300046455 Ga0495603_0017156 Ga0495603_0017156_856_1461 201
347 iso_pu_bacteria 2511231016 2511324952 201
348 iso_pu_bacteria 2728369097 2729147021 201
349 iso_pu_bacteria 2860339153 2860341597 201
350 iso_pu_bacteria 2919697872 2919700694 201
351 iso_pu_bacteria 2923586266 2923588907 201
352 iso_pu_bacteria 2931369376 2931372766 201
353 iso_pu_bacteria 2931396565 2931397949 201
354 iso_pu_bacteria 640427133 640490057 201
355 iso_pu_bacteria 651053060 651178139 201
356 3300032004 Ga0307414_10300195 Ga0307414_103001952 202
357 3300041411 Ga0439466_0021059 Ga0439466_0021059_1193_1804 202
358 3300042009 Ga0439451_010239 Ga0439451_010239_886_1497 202
359 3300042013 Ga0439456_016081 Ga0439456_016081_857_1468 202
360 3300042016 Ga0439463_003012 Ga0439463_003012_2624_3235 202
361 3300042138 Ga0450903_019729 Ga0450903_019729_83_694 202
362 3300042146 Ga0450907_009737 Ga0450907_009737_903_1514 202
363 iso_pu_bacteria 2511231006 2511268941 202
364 iso_pu_bacteria 2511231007 2511274705 202
365 iso_pu_bacteria 2511231021 2511358596 202
366 iso_pu_bacteria 2511231022 2511366361 202
367 iso_pu_bacteria 2512047018 2512323903 202
368 iso_pu_bacteria 2582580891 2583795067 202
369 iso_pu_bacteria 2597489887 2597860767 202
370 iso_pu_bacteria 2599185185 2599485999 202
371 iso_pu_bacteria 2599185212 2599616197 202
372 iso_pu_bacteria 2599185257 2599804781 202
373 iso_pu_bacteria 2599185311 2599993898 202
374 iso_pu_bacteria 2599185316 2600024411 202
375 iso_pu_bacteria 2599185319 2600042246 202
376 iso_pu_bacteria 2599185323 2600066460 202
377 iso_pu_bacteria 2599185325 2600076660 202
378 iso_pu_bacteria 2600254931 2600366455 202
379 iso_pu_bacteria 2623620446 2624494813 202
380 iso_pu_bacteria 2643221565 2643842849 202
381 iso_pu_bacteria 2643221633 2644184608 202
382 iso_pu_bacteria 2651869719 2652547158 202
383 iso_pu_bacteria 2671180172 2671771788 202
384 iso_pu_bacteria 2675903515 2678266026 202
385 iso_pu_bacteria 2740892503 2743740308 202
386 iso_pu_bacteria 2744054620 2745007258 202
387 iso_pu_bacteria 2773857670 2774118503 202
388 iso_pu_bacteria 2784132072 2784313176 202
389 iso_pu_bacteria 2923153595 2923159401 202
390 iso_pu_bacteria 2984286254 2984286727 202
391 iso_pu_bacteria 2988728565 2988731370 202
392 iso_pu_bacteria 3007511990 3007517064 202
393 iso_pu_bacteria 8015687852 8015693499 202
394 iso_pu_bacteria 8019775933 8019777801 202
395 iso_pu_bacteria 8055770955 8055776745 202
396 iso_pu_bacteria 8056155041 8056160732 202
397 3300013104 Ga0157370_10084070 Ga0157370_100840703 203
398 3300015265 Ga0182005_1003727 Ga0182005_10037276 203
399 3300046530 Ga0495654_0232709 Ga0495654_0232709_100_726 203
400 iso_pu_bacteria 8056172158 8056177527 203
401 3300027614 Ga0209970_1029468 Ga0209970_10294682 204
402 3300027876 Ga0209974_10124366 Ga0209974_101243661 204
403 3300041407 Ga0439447_003262 Ga0439447_003262_3934_4563 204
404 3300041411 Ga0439466_0006698 Ga0439466_0006698_791_1420 204
405 3300042009 Ga0439451_044430 Ga0439451_044430_55_672 204
406 3300042010 Ga0439452_005405 Ga0439452_005405_1278_1907 204
407 3300042124 Ga0450922_000334 Ga0450922_000334_1636_2265 204
408 3300046691 Ga0495670_0108219 Ga0495670_0108219_139_768 204
409 3300003578 Ga0006562J51391_1012093 Ga0006562J51391_10120936 205
410 3300003781 Ga0055536_1000869 Ga0055536_100086915 205
411 3300003791 Ga0055530_10000535 Ga0055530_100005355 205
412 3300003791 Ga0055530_10000966 Ga0055530_1000096619 205
413 3300003792 Ga0055540_1000178 Ga0055540_100017827 205
414 3300003792 Ga0055540_1000250 Ga0055540_100025019 205
415 3300003792 Ga0055540_1000896 Ga0055540_100089615 205
416 3300003794 Ga0055531_10000243 Ga0055531_1000024344 205
417 3300005288 Ga0065714_10017605 Ga0065714_100176052 205
418 3300005288 Ga0065714_10031866 Ga0065714_100318662 205
419 3300005288 Ga0065714_10128611 Ga0065714_101286112 205
420 3300005290 Ga0065712_10023066 Ga0065712_100230662 205
421 3300005353 Ga0070669_100001975 Ga0070669_1000019758 205
422 3300006058 Ga0075432_10000124 Ga0075432_1000012414 205
423 3300006058 Ga0075432_10037322 Ga0075432_100373222 205
424 3300006946 Ga0079104_1000133 Ga0079104_100013351 205
425 3300006948 Ga0099826_10010680 Ga0099826_100106804 205
426 3300009036 Ga0105244_10072877 Ga0105244_100728772 205
427 3300009148 Ga0105243_10058112 Ga0105243_100581123 205
428 3300011119 Ga0105246_10180603 Ga0105246_101806032 205
429 3300013100 Ga0157373_10054018 Ga0157373_100540182 205
430 3300013102 Ga0157371_10000131 Ga0157371_1000013127 205
431 3300013102 Ga0157371_10001015 Ga0157371_1000101517 205
432 3300013104 Ga0157370_10146169 Ga0157370_101461692 205
433 3300014497 Ga0182008_10044290 Ga0182008_100442903 205
434 3300015261 Ga0182006_1001573 Ga0182006_100157313 205
435 3300015261 Ga0182006_1008936 Ga0182006_10089362 205
436 3300015261 Ga0182006_1087935 Ga0182006_10879352 205
437 3300015262 Ga0182007_10007001 Ga0182007_100070013 205
438 3300015262 Ga0182007_10044832 Ga0182007_100448322 205
439 3300015265 Ga0182005_1007670 Ga0182005_10076704 205
440 3300017792 Ga0163161_10004476 Ga0163161_100044769 205
441 3300017792 Ga0163161_10132576 Ga0163161_101325762 205
442 3300025292 Ga0209676_1000015 Ga0209676_1000015527 205
443 3300025292 Ga0209676_1000030 Ga0209676_1000030152 205
444 3300025292 Ga0209676_1002636 Ga0209676_10026369 205
445 3300025298 Ga0209050_1000024 Ga0209050_1000024297 205
446 3300025298 Ga0209050_1000075 Ga0209050_1000075166 205
447 3300025298 Ga0209050_1000923 Ga0209050_100092333 205
448 3300025303 Ga0209051_1000012 Ga0209051_1000012152 205
449 3300025303 Ga0209051_1000023 Ga0209051_1000023213 205
450 3300025303 Ga0209051_1000041 Ga0209051_1000041199 205
451 3300025304 Ga0209257_1000069 Ga0209257_1000069110 205
452 3300025304 Ga0209257_1024627 Ga0209257_10246272 205
453 3300025728 Ga0207655_1011013 Ga0207655_10110135 205
454 3300025728 Ga0207655_1018564 Ga0207655_10185645 205
455 3300025735 Ga0207713_1010717 Ga0207713_10107176 205
456 3300025735 Ga0207713_1047977 Ga0207713_10479773 205
457 3300025735 Ga0207713_1057945 Ga0207713_10579451 205
458 3300025735 Ga0207713_1105185 Ga0207713_11051852 205
459 3300025923 Ga0207681_10001211 Ga0207681_100012118 205
460 3300027111 Ga0209281_1000019 Ga0209281_1000019341 205
461 3300027666 Ga0209282_1155055 Ga0209282_11550552 205
462 3300027907 Ga0207428_10122700 Ga0207428_101227002 205
463 3300027907 Ga0207428_10221886 Ga0207428_102218862 205
464 3300030742 Ga0316183_1019679 Ga0316183_10196792 205
465 3300031548 Ga0307408_100075843 Ga0307408_1000758432 205
466 3300041405 Ga0439438_022734 Ga0439438_022734_586_1206 205
467 3300041407 Ga0439447_000250 Ga0439447_000250_1553_2173 205
468 3300041407 Ga0439447_017568 Ga0439447_017568_1229_1849 205
469 3300041407 Ga0439447_033966 Ga0439447_033966_364_984 205
470 3300041410 Ga0439461_0069579 Ga0439461_0069579_114_734 205
471 3300041411 Ga0439466_0000469 Ga0439466_0000469_9705_10325 205
472 3300041411 Ga0439466_0016086 Ga0439466_0016086_1406_2026 205
473 3300041411 Ga0439466_0042650 Ga0439466_0042650_793_1413 205
474 3300041413 Ga0439465_0041624 Ga0439465_0041624_155_775 205
475 3300042004 Ga0439445_0036446 Ga0439445_0036446_428_1048 205
476 3300042006 Ga0439432_053863 Ga0439432_053863_530_1150 205
477 3300042009 Ga0439451_001428 Ga0439451_001428_2585_3205 205
478 3300042009 Ga0439451_001536 Ga0439451_001536_1505_2125 205
479 3300042009 Ga0439451_020771 Ga0439451_020771_433_1065 205
480 3300042010 Ga0439452_001470 Ga0439452_001470_3687_4307 205
481 3300042010 Ga0439452_028799 Ga0439452_028799_662_1282 205
482 3300042013 Ga0439456_003065 Ga0439456_003065_1002_1622 205
483 3300042013 Ga0439456_017507 Ga0439456_017507_767_1399 205
484 3300042013 Ga0439456_029194 Ga0439456_029194_46_666 205
485 3300042016 Ga0439463_001200 Ga0439463_001200_3487_4119 205
486 3300042016 Ga0439463_002406 Ga0439463_002406_917_1537 205
487 3300042016 Ga0439463_014409 Ga0439463_014409_735_1358 205
488 3300042016 Ga0439463_017433 Ga0439463_017433_179_802 205
489 3300042115 Ga0450911_000952 Ga0450911_000952_5849_6469 205
490 3300042115 Ga0450911_001425 Ga0450911_001425_2446_3066 205
491 3300042121 Ga0450919_000729 Ga0450919_000729_1134_1754 205
492 3300042124 Ga0450922_001203 Ga0450922_001203_1265_1885 205
493 3300042127 Ga0450890_000682 Ga0450890_000682_1652_2272 205
494 3300042137 Ga0450902_008320 Ga0450902_008320_261_881 205
495 3300042138 Ga0450903_001628 Ga0450903_001628_2339_2959 205
496 3300042138 Ga0450903_040671 Ga0450903_040671_12_632 205
497 3300042139 Ga0450904_007149 Ga0450904_007149_252_872 205
498 3300042146 Ga0450907_000115 Ga0450907_000115_13846_14466 205
499 3300042147 Ga0450910_001492 Ga0450910_001492_782_1402 205
500 3300042156 Ga0439446_0001469 Ga0439446_0001469_2855_3475 205
501 3300042156 Ga0439446_0029259 Ga0439446_0029259_903_1523 205
502 3300042184 Ga0450908_009138 Ga0450908_009138_919_1539 205
503 3300042185 Ga0450909_000120 Ga0450909_000120_1960_2580 205
504 3300042185 Ga0450909_000376 Ga0450909_000376_4087_4707 205
505 3300042435 Ga0439434_0000211 Ga0439434_0000211_12683_13303 205
506 3300042439 Ga0439464_0008630 Ga0439464_0008630_1004_1624 205
507 3300042461 Ga0439460_0001615 Ga0439460_0001615_3803_4423 205
508 3300042461 Ga0439460_0011056 Ga0439460_0011056_789_1412 205
509 3300042461 Ga0439460_0100962 Ga0439460_0100962_103_723 205
510 3300042531 Ga0450918_005784 Ga0450918_005784_857_1477 205
511 3300042532 Ga0450893_0011607 Ga0450893_0011607_208_828 205
512 3300042533 Ga0450901_000997 Ga0450901_000997_1634_2254 205
513 3300042993 Ga0439440_0000155 Ga0439440_0000155_2854_3471 205
514 3300042993 Ga0439440_0002765 Ga0439440_0002765_876_1496 205
515 3300042993 Ga0439440_0011852 Ga0439440_0011852_186_818 205
516 3300046452 Ga0495617_012252 Ga0495617_012252_1287_1907 205
517 3300046452 Ga0495617_014867 Ga0495617_014867_1092_1727 205
518 3300046452 Ga0495617_025379 Ga0495617_025379_464_1084 205
519 3300046453 Ga0495627_001105 Ga0495627_001105_13009_13644 205
520 3300046453 Ga0495627_007300 Ga0495627_007300_659_1279 205
521 3300046453 Ga0495627_015199 Ga0495627_015199_704_1324 205
522 3300046455 Ga0495603_0005711 Ga0495603_0005711_2673_3293 205
523 3300046455 Ga0495603_0074745 Ga0495603_0074745_1009_1629 205
524 3300046457 Ga0495590_0007244 Ga0495590_0007244_2973_3593 205
525 3300046457 Ga0495590_0022117 Ga0495590_0022117_1162_1782 205
526 3300046457 Ga0495590_0061085 Ga0495590_0061085_170_790 205
527 3300046457 Ga0495590_0131441 Ga0495590_0131441_103_723 205
528 3300046458 Ga0495591_013880 Ga0495591_013880_357_977 205
529 3300046458 Ga0495591_016375 Ga0495591_016375_1677_2297 205
530 3300046459 Ga0495629_0005106 Ga0495629_0005106_6203_6823 205
531 3300046459 Ga0495629_0126493 Ga0495629_0126493_696_1316 205
532 3300046460 Ga0495638_0020513 Ga0495638_0020513_1023_1643 205
533 3300046460 Ga0495638_0045029 Ga0495638_0045029_1340_1960 205
534 3300046460 Ga0495638_0045498 Ga0495638_0045498_1033_1653 205
535 3300046460 Ga0495638_0046270 Ga0495638_0046270_948_1568 205
536 3300046460 Ga0495638_0168012 Ga0495638_0168012_171_791 205
537 3300046460 Ga0495638_0221307 Ga0495638_0221307_343_963 205
538 3300046463 Ga0495653_0007620 Ga0495653_0007620_4490_5110 205
539 3300046471 Ga0495650_0015251 Ga0495650_0015251_184_819 205
540 3300046471 Ga0495650_0020862 Ga0495650_0020862_1399_2019 205
541 3300046471 Ga0495650_0021189 Ga0495650_0021189_1010_1630 205
542 3300046471 Ga0495650_0183210 Ga0495650_0183210_68_688 205
543 3300046472 Ga0495580_0245376 Ga0495580_0245376_494_1114 205
544 3300046473 Ga0495582_0029549 Ga0495582_0029549_1228_1848 205
545 3300046474 Ga0495605_0004804 Ga0495605_0004804_847_1467 205
546 3300046474 Ga0495605_0092346 Ga0495605_0092346_176_796 205
547 3300046474 Ga0495605_0140128 Ga0495605_0140128_35_655 205
548 3300046474 Ga0495605_0165006 Ga0495605_0165006_38_658 205
549 3300046475 Ga0495639_0042108 Ga0495639_0042108_110_730 205
550 3300046476 Ga0495662_0209526 Ga0495662_0209526_227_847 205
551 3300046491 Ga0495584_0002925 Ga0495584_0002925_2673_3293 205
552 3300046491 Ga0495584_0007086 Ga0495584_0007086_2372_2992 205
553 3300046491 Ga0495584_0010191 Ga0495584_0010191_1196_1816 205
554 3300046491 Ga0495584_0075711 Ga0495584_0075711_930_1550 205
555 3300046491 Ga0495584_0282416 Ga0495584_0282416_122_742 205
556 3300046492 Ga0495585_0008553 Ga0495585_0008553_3517_4137 205
557 3300046492 Ga0495585_0014824 Ga0495585_0014824_2823_3443 205
558 3300046492 Ga0495585_0054844 Ga0495585_0054844_1503_2123 205
559 3300046492 Ga0495585_0104288 Ga0495585_0104288_394_1014 205
560 3300046492 Ga0495585_0115046 Ga0495585_0115046_295_915 205
561 3300046492 Ga0495585_0173195 Ga0495585_0173195_341_961 205
562 3300046499 Ga0495594_0023426 Ga0495594_0023426_1278_1898 205
563 3300046499 Ga0495594_0044270 Ga0495594_0044270_1170_1790 205
564 3300046501 Ga0495607_0022121 Ga0495607_0022121_2541_3161 205
565 3300046501 Ga0495607_0022154 Ga0495607_0022154_2708_3328 205
566 3300046501 Ga0495607_0026017 Ga0495607_0026017_319_939 205
567 3300046501 Ga0495607_0065448 Ga0495607_0065448_884_1504 205
568 3300046501 Ga0495607_0157353 Ga0495607_0157353_333_953 205
569 3300046501 Ga0495607_0175508 Ga0495607_0175508_319_939 205
570 3300046501 Ga0495607_0330518 Ga0495607_0330518_41_661 205
571 3300046506 Ga0495583_0001217 Ga0495583_0001217_15777_16397 205
572 3300046506 Ga0495583_0023911 Ga0495583_0023911_1010_1630 205
573 3300046506 Ga0495583_0143815 Ga0495583_0143815_130_750 205
574 3300046512 Ga0495610_0066559 Ga0495610_0066559_323_943 205
575 3300046513 Ga0495616_0008225 Ga0495616_0008225_3071_3691 205
576 3300046513 Ga0495616_0015792 Ga0495616_0015792_1184_1804 205
577 3300046513 Ga0495616_0033468 Ga0495616_0033468_858_1478 205
578 3300046513 Ga0495616_0047686 Ga0495616_0047686_826_1446 205
579 3300046513 Ga0495616_0064414 Ga0495616_0064414_1038_1658 205
580 3300046513 Ga0495616_0085901 Ga0495616_0085901_59_679 205
581 3300046513 Ga0495616_0100453 Ga0495616_0100453_445_1065 205
582 3300046516 Ga0495628_0341761 Ga0495628_0341761_449_1069 205
583 3300046517 Ga0495630_0065162 Ga0495630_0065162_1087_1707 205
584 3300046518 Ga0495631_0002833 Ga0495631_0002833_5028_5663 205
585 3300046518 Ga0495631_0038634 Ga0495631_0038634_1175_1795 205
586 3300046518 Ga0495631_0054938 Ga0495631_0054938_1083_1703 205
587 3300046518 Ga0495631_0078696 Ga0495631_0078696_460_1080 205
588 3300046519 Ga0495632_0001448 Ga0495632_0001448_3358_3978 205
589 3300046519 Ga0495632_0002364 Ga0495632_0002364_12592_13212 205
590 3300046519 Ga0495632_0006809 Ga0495632_0006809_1004_1639 205
591 3300046519 Ga0495632_0009773 Ga0495632_0009773_4941_5576 205
592 3300046519 Ga0495632_0043342 Ga0495632_0043342_660_1280 205
593 3300046519 Ga0495632_0053835 Ga0495632_0053835_334_954 205
594 3300046519 Ga0495632_0089460 Ga0495632_0089460_104_724 205
595 3300046519 Ga0495632_0096716 Ga0495632_0096716_42_662 205
596 3300046520 Ga0495637_0001664 Ga0495637_0001664_7439_8059 205
597 3300046520 Ga0495637_0011147 Ga0495637_0011147_3134_3754 205
598 3300046520 Ga0495637_0012036 Ga0495637_0012036_2493_3113 205
599 3300046520 Ga0495637_0062662 Ga0495637_0062662_602_1222 205
600 3300046520 Ga0495637_0103330 Ga0495637_0103330_180_800 205
601 3300046520 Ga0495637_0148291 Ga0495637_0148291_54_674 205
602 3300046522 Ga0495643_0007341 Ga0495643_0007341_255_875 205
603 3300046522 Ga0495643_0019879 Ga0495643_0019879_2236_2856 205
604 3300046522 Ga0495643_0027087 Ga0495643_0027087_684_1304 205
605 3300046522 Ga0495643_0074023 Ga0495643_0074023_727_1347 205
606 3300046523 Ga0495644_0005129 Ga0495644_0005129_1063_1683 205
607 3300046523 Ga0495644_0005349 Ga0495644_0005349_3373_3993 205
608 3300046523 Ga0495644_0033462 Ga0495644_0033462_877_1497 205
609 3300046524 Ga0495648_0046595 Ga0495648_0046595_721_1341 205
610 3300046524 Ga0495648_0060095 Ga0495648_0060095_839_1459 205
611 3300046524 Ga0495648_0083891 Ga0495648_0083891_1048_1668 205
612 3300046526 Ga0495666_0020857 Ga0495666_0020857_1358_1978 205
613 3300046526 Ga0495666_0057492 Ga0495666_0057492_363_983 205
614 3300046526 Ga0495666_0061668 Ga0495666_0061668_294_914 205
615 3300046526 Ga0495666_0065811 Ga0495666_0065811_327_944 205
616 3300046528 Ga0495642_0005118 Ga0495642_0005118_1895_2515 205
617 3300046530 Ga0495654_0001479 Ga0495654_0001479_11380_12015 205
618 3300046530 Ga0495654_0023222 Ga0495654_0023222_1016_1636 205
619 3300046530 Ga0495654_0060447 Ga0495654_0060447_951_1571 205
620 3300046530 Ga0495654_0079376 Ga0495654_0079376_315_935 205
621 3300046530 Ga0495654_0097470 Ga0495654_0097470_549_1169 205
622 3300046530 Ga0495654_0112689 Ga0495654_0112689_286_906 205
623 3300046530 Ga0495654_0203276 Ga0495654_0203276_60_680 205
624 3300046535 Ga0495586_0003995 Ga0495586_0003995_3911_4531 205
625 3300046536 Ga0495587_0011563 Ga0495587_0011563_1978_2598 205
626 3300046538 Ga0495609_0005222 Ga0495609_0005222_4523_5143 205
627 3300046538 Ga0495609_0006733 Ga0495609_0006733_512_1132 205
628 3300046538 Ga0495609_0037618 Ga0495609_0037618_1051_1671 205
629 3300046542 Ga0495597_0002458 Ga0495597_0002458_8284_8904 205
630 3300046542 Ga0495597_0009101 Ga0495597_0009101_3342_3962 205
631 3300046542 Ga0495597_0012866 Ga0495597_0012866_2028_2648 205
632 3300046542 Ga0495597_0032478 Ga0495597_0032478_821_1441 205
633 3300046542 Ga0495597_0036386 Ga0495597_0036386_1289_1909 205
634 3300046542 Ga0495597_0053427 Ga0495597_0053427_368_988 205
635 3300046542 Ga0495597_0141134 Ga0495597_0141134_72_692 205
636 3300046542 Ga0495597_0191240 Ga0495597_0191240_131_751 205
637 3300046557 Ga0495622_0005014 Ga0495622_0005014_3363_3983 205
638 3300046557 Ga0495622_0039161 Ga0495622_0039161_756_1376 205
639 3300046557 Ga0495622_0105400 Ga0495622_0105400_347_967 205
640 3300046557 Ga0495622_0254717 Ga0495622_0254717_46_666 205
641 3300046615 Ga0495656_0004689 Ga0495656_0004689_1043_1663 205
642 3300046615 Ga0495656_0044240 Ga0495656_0044240_1182_1802 205
643 3300046615 Ga0495656_0324757 Ga0495656_0324757_97_717 205
644 3300046616 Ga0495668_0093442 Ga0495668_0093442_345_965 205
645 3300046642 Ga0495634_0088790 Ga0495634_0088790_247_867 205
646 3300046648 Ga0495611_0013671 Ga0495611_0013671_1095_1715 205
647 3300046648 Ga0495611_0035788 Ga0495611_0035788_1273_1893 205
648 3300046648 Ga0495611_0123357 Ga0495611_0123357_563_1183 205
649 3300046660 Ga0495625_0048024 Ga0495625_0048024_1444_2064 205
650 3300046660 Ga0495625_0082139 Ga0495625_0082139_775_1395 205
651 3300046660 Ga0495625_0150054 Ga0495625_0150054_153_773 205
652 3300046660 Ga0495625_0177071 Ga0495625_0177071_473_1093 205
653 3300046660 Ga0495625_0209107 Ga0495625_0209107_589_1209 205
654 3300046660 Ga0495625_0237629 Ga0495625_0237629_60_680 205
655 3300046663 Ga0495635_0005483 Ga0495635_0005483_5627_6247 205
656 3300046664 Ga0495659_0098238 Ga0495659_0098238_213_833 205
657 3300046664 Ga0495659_0105102 Ga0495659_0105102_216_836 205
658 3300046665 Ga0495661_0048590 Ga0495661_0048590_974_1594 205
659 3300046665 Ga0495661_0053653 Ga0495661_0053653_846_1466 205
660 3300046665 Ga0495661_0056288 Ga0495661_0056288_1346_1966 205
661 3300046665 Ga0495661_0157607 Ga0495661_0157607_497_1117 205
662 3300046674 Ga0495588_0045082 Ga0495588_0045082_710_1330 205
663 3300046674 Ga0495588_0057918 Ga0495588_0057918_1094_1714 205
664 3300046674 Ga0495588_0103026 Ga0495588_0103026_864_1481 205
665 3300046675 Ga0495657_0094494 Ga0495657_0094494_536_1156 205
666 3300046679 Ga0495623_0014914 Ga0495623_0014914_3024_3644 205
667 3300046680 Ga0495646_0021849 Ga0495646_0021849_1501_2121 205
668 3300046680 Ga0495646_0144327 Ga0495646_0144327_613_1233 205
669 3300046684 Ga0495669_0007494 Ga0495669_0007494_1589_2209 205
670 3300046684 Ga0495669_0015503 Ga0495669_0015503_152_772 205
671 3300046684 Ga0495669_0124155 Ga0495669_0124155_50_670 205
672 3300046689 Ga0495613_0025057 Ga0495613_0025057_2782_3402 205
673 3300046691 Ga0495670_0001101 Ga0495670_0001101_11215_11835 205
674 3300046691 Ga0495670_0004256 Ga0495670_0004256_3668_4288 205
675 3300046691 Ga0495670_0060456 Ga0495670_0060456_83_703 205
676 3300046692 Ga0495671_0019470 Ga0495671_0019470_2067_2684 205
677 3300046692 Ga0495671_0020922 Ga0495671_0020922_137_757 205
678 3300046692 Ga0495671_0039037 Ga0495671_0039037_1260_1895 205
679 3300046694 Ga0495649_0016765 Ga0495649_0016765_995_1615 205
680 3300046694 Ga0495649_0094748 Ga0495649_0094748_460_1080 205
681 3300046794 Ga0495589_0003552 Ga0495589_0003552_5663_6283 205
682 3300046794 Ga0495589_0005592 Ga0495589_0005592_635_1255 205
683 3300046794 Ga0495589_0024177 Ga0495589_0024177_1947_2567 205
684 3300046809 Ga0495600_0035628 Ga0495600_0035628_2252_2872 205
685 3300046809 Ga0495600_0084261 Ga0495600_0084261_1200_1820 205
686 3300046810 Ga0495660_0014893 Ga0495660_0014893_1014_1634 205
687 3300046810 Ga0495660_0015255 Ga0495660_0015255_994_1614 205
688 3300046810 Ga0495660_0024850 Ga0495660_0024850_823_1443 205
689 3300046810 Ga0495660_0078840 Ga0495660_0078840_290_910 205
690 3300046810 Ga0495660_0098491 Ga0495660_0098491_35_655 205
691 3300046810 Ga0495660_0110099 Ga0495660_0110099_670_1290 205
692 3300046810 Ga0495660_0132252 Ga0495660_0132252_74_694 205
693 3300047315 Ga0495581_0011698 Ga0495581_0011698_3181_3801 205
694 3300047315 Ga0495581_0034610 Ga0495581_0034610_1287_1907 205
695 3300047317 Ga0495604_0009630 Ga0495604_0009630_3349_3969 205
696 3300047317 Ga0495604_0301780 Ga0495604_0301780_244_864 205
697 3300047318 Ga0495636_0000729 Ga0495636_0000729_8786_9406 205
698 3300047318 Ga0495636_0009678 Ga0495636_0009678_1222_1842 205
699 3300047318 Ga0495636_0018109 Ga0495636_0018109_1373_1993 205
700 3300047318 Ga0495636_0141805 Ga0495636_0141805_237_857 205
701 3300047318 Ga0495636_0152570 Ga0495636_0152570_391_1011 205
702 3300047318 Ga0495636_0371530 Ga0495636_0371530_27_647 205
703 3300047320 Ga0495672_0000903 Ga0495672_0000903_18650_19270 205
704 3300047320 Ga0495672_0001057 Ga0495672_0001057_18326_18946 205
705 3300047320 Ga0495672_0002947 Ga0495672_0002947_7436_8071 205
706 3300047320 Ga0495672_0015421 Ga0495672_0015421_3509_4129 205
707 3300047320 Ga0495672_0023240 Ga0495672_0023240_691_1311 205
708 3300047320 Ga0495672_0059967 Ga0495672_0059967_1164_1784 205
709 3300047320 Ga0495672_0069394 Ga0495672_0069394_783_1403 205
710 3300047320 Ga0495672_0107281 Ga0495672_0107281_38_658 205
711 3300047320 Ga0495672_0123758 Ga0495672_0123758_691_1311 205
712 3300047320 Ga0495672_0162514 Ga0495672_0162514_489_1109 205
713 3300047322 Ga0495680_0002124 Ga0495680_0002124_15324_15944 205
714 3300047322 Ga0495680_0036693 Ga0495680_0036693_945_1565 205
715 3300047322 Ga0495680_0057148 Ga0495680_0057148_714_1334 205
716 3300047323 Ga0495683_0011473 Ga0495683_0011473_1052_1672 205
717 3300047323 Ga0495683_0012445 Ga0495683_0012445_2820_3440 205
718 3300047323 Ga0495683_0014707 Ga0495683_0014707_2766_3386 205
719 3300047323 Ga0495683_0016934 Ga0495683_0016934_345_965 205
720 3300047323 Ga0495683_0248512 Ga0495683_0248512_42_662 205
721 3300047443 Ga0495687_011366 Ga0495687_011366_3129_3749 205
722 3300047444 Ga0495675_0013515 Ga0495675_0013515_3626_4246 205
723 3300047445 Ga0495677_0005006 Ga0495677_0005006_3152_3772 205
724 3300047446 Ga0495679_014934 Ga0495679_014934_977_1597 205
725 3300047469 Ga0495673_0001931 Ga0495673_0001931_11133_11753 205
726 3300047469 Ga0495673_0003218 Ga0495673_0003218_9484_10104 205
727 3300047469 Ga0495673_0006593 Ga0495673_0006593_1381_2001 205
728 3300047469 Ga0495673_0012966 Ga0495673_0012966_1086_1706 205
729 3300047469 Ga0495673_0013306 Ga0495673_0013306_847_1467 205
730 3300047469 Ga0495673_0016563 Ga0495673_0016563_2103_2723 205
731 3300047469 Ga0495673_0022290 Ga0495673_0022290_1465_2085 205
732 3300047469 Ga0495673_0027934 Ga0495673_0027934_1917_2537 205
733 3300047469 Ga0495673_0031586 Ga0495673_0031586_710_1327 205
734 3300047469 Ga0495673_0045194 Ga0495673_0045194_895_1515 205
735 3300047469 Ga0495673_0061157 Ga0495673_0061157_502_1122 205
736 3300047470 Ga0495681_0037408 Ga0495681_0037408_926_1546 205
737 3300047470 Ga0495681_0046340 Ga0495681_0046340_1002_1622 205
738 3300047471 Ga0495684_0032357 Ga0495684_0032357_1192_1812 205
739 3300047472 Ga0495686_0074295 Ga0495686_0074295_789_1409 205
740 3300047673 Ga0495593_0029113 Ga0495593_0029113_1194_1814 205
741 3300047673 Ga0495593_0097455 Ga0495593_0097455_263_883 205
742 3300048088 Ga0495602_0625276 Ga0495602_0625276_104_724 205
743 3300048091 Ga0495626_0001994 Ga0495626_0001994_13401_14021 205
744 3300048091 Ga0495626_0005043 Ga0495626_0005043_4055_4675 205
745 3300048091 Ga0495626_0005509 Ga0495626_0005509_758_1378 205
746 3300048091 Ga0495626_0016919 Ga0495626_0016919_2599_3219 205
747 3300048091 Ga0495626_0065077 Ga0495626_0065077_621_1241 205
748 3300048091 Ga0495626_0080009 Ga0495626_0080009_613_1233 205
749 3300048091 Ga0495626_0080299 Ga0495626_0080299_627_1247 205
750 3300048091 Ga0495626_0108638 Ga0495626_0108638_416_1036 205
751 3300048906 Ga0496103_0248773 Ga0496103_0248773_420_1040 205
752 3300048907 Ga0496104_0507868 Ga0496104_0507868_137_757 205
753 3300048909 Ga0496106_0171233 Ga0496106_0171233_385_1005 205
754 3300048913 Ga0496110_0110359 Ga0496110_0110359_814_1434 205
755 3300048913 Ga0496110_0350274 Ga0496110_0350274_515_1135 205
756 3300048914 Ga0496111_0383429 Ga0496111_0383429_44_664 205
757 3300048918 Ga0496115_0080225 Ga0496115_0080225_925_1545 205
758 3300048924 Ga0496121_0052494 Ga0496121_0052494_544_1164 205
759 3300048924 Ga0496121_0053873 Ga0496121_0053873_633_1253 205
760 3300048927 Ga0496124_0019249 Ga0496124_0019249_4358_4978 205
761 3300048928 Ga0496125_0032993 Ga0496125_0032993_2918_3538 205
762 3300048929 Ga0496126_0435633 Ga0496126_0435633_124_744 205
763 3300049459 Ga0495678_006832 Ga0495678_006832_3143_3763 205
764 3300049459 Ga0495678_007299 Ga0495678_007299_1454_2074 205
765 3300049459 Ga0495678_016449 Ga0495678_016449_970_1590 205
766 3300049459 Ga0495678_017589 Ga0495678_017589_572_1192 205
767 3300049459 Ga0495678_019502 Ga0495678_019502_538_1158 205
768 3300049459 Ga0495678_039041 Ga0495678_039041_339_959 205
769 3300049459 Ga0495678_065062 Ga0495678_065062_299_934 205
770 3300049459 Ga0495678_065783 Ga0495678_065783_512_1132 205
771 3300049459 Ga0495678_128952 Ga0495678_128952_137_757 205
772 3300049460 Ga0495682_0000102 Ga0495682_0000102_62318_62938 205
773 3300049460 Ga0495682_0007490 Ga0495682_0007490_2832_3452 205
774 3300049460 Ga0495682_0009683 Ga0495682_0009683_427_1047 205
775 3300049460 Ga0495682_0014355 Ga0495682_0014355_1959_2579 205
776 3300049460 Ga0495682_0033679 Ga0495682_0033679_869_1489 205
777 3300049460 Ga0495682_0034817 Ga0495682_0034817_109_729 205
778 3300049460 Ga0495682_0047407 Ga0495682_0047407_707_1327 205
779 3300049460 Ga0495682_0065643 Ga0495682_0065643_652_1272 205
780 3300049460 Ga0495682_0067124 Ga0495682_0067124_38_658 205
781 3300049460 Ga0495682_0100958 Ga0495682_0100958_142_762 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20866

MdcG_N

Phosphoribosyl-dephospho-CoA transferase MdcG N-terminal domain

8

79

0.96

PF10620

MdcG

Phosphoribosyl-dephospho-CoA transferase MdcG C-terminal domain

84

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c4s-assembly2.cif.gz_B crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42 0.7475 33 75
2xhc-assembly1.cif.gz_A crystal structure of thermotoga maritima n-utilization substance g (nusg) 0.6922 35 71
8fkr-assembly1.cif.gz_LE human nucleolar pre-60s ribosomal subunit (state b1) 0.683 33 72
2mi6-assembly1.cif.gz_A solution structure of the carboxy terminal domain of nusg from mycobacterium tuberculosis 0.6783 4 71
3pnw-assembly1.cif.gz_C crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab 0.666 3 70
ID Description Score Start End Superfamily
af_Q2QW74_182_351_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7298 130 166 3.40.50.300
3c4sA00 Mainly Beta;Roll;SH3 type barrels.; 0.7179 33 76 2.30.30.140
af_Q57877_1_92_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7156 92 164 3.30.460.10
af_A4I326_265_462_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7134 33 71 2.30.30.30
af_P64517_7_48_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7088 33 69 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A495M464-F1-model_v4 deleted 1.002 5 205
AF-A0A5B0CC82-F1-model_v4 Malonate decarboxylase holo-ACP synthase 0.9996 4 199 GO:0016779
AF-A0A495M464-F1-model_v4 deleted 0.9967 5 205
AF-A0A7Y8D5E9-F1-model_v4 Phosphoribosyl-dephospho-CoA transferase 0.9945 129 199 GO:0016740
AF-A0A2G0YXA7-F1-model_v4 Phosphoribosyl-dephospho-CoA transferase 0.992 4 199 GO:0016779

Feature Viewer

pLDDT pTM Quality
94.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map