F480560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 781 | 284 | 1562 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10051982|Ga0111539_100519822 |
| Length | 342 |
| Sequence | MRPGGEAVDVQAAYRHCEQITWTQARNFSYGIRLLPPAKRQALAAVYAFARRIDDIGDGDLPKPAKLAALADARASVTALGAQRNLPGQNAKPAATDGDLVLVALTDAAGRFDIPLPAFGELIDGCEADVRGTTYRTFDDLLHYCRCVAGSIGRLSLGVFGTADVATAAPLADALGVALQLTNILRDIREDYLSGRIYLPAEDFERFGCSLENGALQKVPEGNGSLPSGHLARAPGDGGNEDKLAALVEFEAQRACTWYARGLTLIPLLDRRSAASAGAMAGIYFRLLQRIAASPRAVLERRMSLSAREKAMVAARSLAVALRPRGAGSLHNGAPVMKGADR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 86 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 | Metagenome | Unclassified |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 130 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 131 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 133 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 137 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 173 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 271 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 272 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 273 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 274 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 275 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 276 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 277 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 278 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 279 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 280 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 281 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 282 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 283 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 284 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.8 |
| Metatranscriptomes | 1.41 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.02 |
| Nodule | 0 |
| Rhizoplane | 4.99 |
| Rhizosphere | 90.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10051982 | 3300009094 | Bacteria | 4879 |
| 2 | JGI25404J52841_10007759 | 3300003659 | Bacteria | 2275 |
| 3 | Ga0070658_10014140 | 3300005327 | Bacteria | 6407 |
| 4 | Ga0070683_100396751 | 3300005329 | Bacteria | 1316 |
| 5 | Ga0070680_100014068 | 3300005336 | Bacteria | 6248 |
| 6 | Ga0068868_100025811 | 3300005338 | Bacteria | 4473 |
| 7 | Ga0068868_100176793 | 3300005338 | Bacteria | 1769 |
| 8 | Ga0070668_100062297 | 3300005347 | Bacteria | 2889 |
| 9 | Ga0070671_100020417 | 3300005355 | Bacteria | 5403 |
| 10 | Ga0070671_100135284 | 3300005355 | Bacteria | 2078 |
| 11 | Ga0070667_100033039 | 3300005367 | Bacteria | 4320 |
| 12 | Ga0070709_10000846 | 3300005434 | Bacteria | 17122 |
| 13 | Ga0070709_10001146 | 3300005434 | Bacteria | 14602 |
| 14 | Ga0070709_10071050 | 3300005434 | Bacteria | 2246 |
| 15 | Ga0070714_100000680 | 3300005435 | Bacteria | 23985 |
| 16 | Ga0070714_100000967 | 3300005435 | Bacteria | 20523 |
| 17 | Ga0070714_100002468 | 3300005435 | Bacteria | 13646 |
| 18 | Ga0070714_100006510 | 3300005435 | Bacteria | 9029 |
| 19 | Ga0070714_100063139 | 3300005435 | Bacteria | 3184 |
| 20 | Ga0070714_100065781 | 3300005435 | Bacteria | 3123 |
| 21 | Ga0070714_100068213 | 3300005435 | Bacteria | 3068 |
| 22 | Ga0070714_100352023 | 3300005435 | Bacteria | 1383 |
| 23 | Ga0070713_100002759 | 3300005436 | Bacteria | 11483 |
| 24 | Ga0070713_100003558 | 3300005436 | Bacteria | 10292 |
| 25 | Ga0070713_100007719 | 3300005436 | Bacteria | 7572 |
| 26 | Ga0070713_100059108 | 3300005436 | Bacteria | 3200 |
| 27 | Ga0070713_100074843 | 3300005436 | Bacteria | 2870 |
| 28 | Ga0070713_100117854 | 3300005436 | Bacteria | 2324 |
| 29 | Ga0070713_100309369 | 3300005436 | Bacteria | 1457 |
| 30 | Ga0070713_100325893 | 3300005436 | Bacteria | 1420 |
| 31 | Ga0070710_10000786 | 3300005437 | Bacteria | 15197 |
| 32 | Ga0070710_10006951 | 3300005437 | Bacteria | 5458 |
| 33 | Ga0070710_10010322 | 3300005437 | Bacteria | 4586 |
| 34 | Ga0070710_10036905 | 3300005437 | Bacteria | 2674 |
| 35 | Ga0070710_10139912 | 3300005437 | Bacteria | 1483 |
| 36 | Ga0070711_100002833 | 3300005439 | Bacteria | 9961 |
| 37 | Ga0070711_100068317 | 3300005439 | Bacteria | 2497 |
| 38 | Ga0070711_100399364 | 3300005439 | Bacteria | 1115 |
| 39 | Ga0070700_100008976 | 3300005441 | Bacteria | 5473 |
| 40 | Ga0070694_100073680 | 3300005444 | Bacteria | 2359 |
| 41 | Ga0070708_100000801 | 3300005445 | Bacteria | 23743 |
| 42 | Ga0070708_100017959 | 3300005445 | Bacteria | 5914 |
| 43 | Ga0070708_100037712 | 3300005445 | Bacteria | 4219 |
| 44 | Ga0070708_100083232 | 3300005445 | Bacteria | 2900 |
| 45 | Ga0070678_100474945 | 3300005456 | Bacteria | 1099 |
| 46 | Ga0070681_10487812 | 3300005458 | Bacteria | 1145 |
| 47 | Ga0070685_10010124 | 3300005466 | Bacteria | 4893 |
| 48 | Ga0070706_100000779 | 3300005467 | Bacteria | 35638 |
| 49 | Ga0070706_100003302 | 3300005467 | Bacteria | 15955 |
| 50 | Ga0070706_100003775 | 3300005467 | Bacteria | 14784 |
| 51 | Ga0070706_100005289 | 3300005467 | Bacteria | 12305 |
| 52 | Ga0070706_100035482 | 3300005467 | Bacteria | 4606 |
| 53 | Ga0070706_100036347 | 3300005467 | Bacteria | 4549 |
| 54 | Ga0070706_100048054 | 3300005467 | Bacteria | 3939 |
| 55 | Ga0070706_100061535 | 3300005467 | Bacteria | 3467 |
| 56 | Ga0070706_100433314 | 3300005467 | Bacteria | 1224 |
| 57 | Ga0070707_100000067 | 3300005468 | Bacteria | 93995 |
| 58 | Ga0070707_100004574 | 3300005468 | Bacteria | 12953 |
| 59 | Ga0070707_100019164 | 3300005468 | Bacteria | 6445 |
| 60 | Ga0070707_100021934 | 3300005468 | Bacteria | 6039 |
| 61 | Ga0070707_100040639 | 3300005468 | Bacteria | 4450 |
| 62 | Ga0070707_100153190 | 3300005468 | Bacteria | 2245 |
| 63 | Ga0070707_100179386 | 3300005468 | Bacteria | 2064 |
| 64 | Ga0070698_100001287 | 3300005471 | Bacteria | 27980 |
| 65 | Ga0070698_100002969 | 3300005471 | Bacteria | 18662 |
| 66 | Ga0070698_100007877 | 3300005471 | Bacteria | 11534 |
| 67 | Ga0070698_100007905 | 3300005471 | Bacteria | 11511 |
| 68 | Ga0070698_100020002 | 3300005471 | Bacteria | 7018 |
| 69 | Ga0070698_100028892 | 3300005471 | Bacteria | 5756 |
| 70 | Ga0070698_100035229 | 3300005471 | Bacteria | 5177 |
| 71 | Ga0070698_100057159 | 3300005471 | Bacteria | 3949 |
| 72 | Ga0070698_100057703 | 3300005471 | Bacteria | 3928 |
| 73 | Ga0070698_100068774 | 3300005471 | Bacteria | 3558 |
| 74 | Ga0070698_100653052 | 3300005471 | Bacteria | 993 |
| 75 | Ga0070699_100013538 | 3300005518 | Bacteria | 7023 |
| 76 | Ga0070699_100481654 | 3300005518 | Bacteria | 1126 |
| 77 | Ga0070679_100081144 | 3300005530 | Bacteria | 3232 |
| 78 | Ga0070679_100122222 | 3300005530 | Bacteria | 2588 |
| 79 | Ga0070679_100152982 | 3300005530 | Bacteria | 2283 |
| 80 | Ga0070684_100093447 | 3300005535 | Bacteria | 2677 |
| 81 | Ga0070697_100269566 | 3300005536 | Bacteria | 1459 |
| 82 | Ga0068853_100007584 | 3300005539 | Bacteria | 8690 |
| 83 | Ga0068853_100167975 | 3300005539 | Bacteria | 1984 |
| 84 | Ga0070695_100223817 | 3300005545 | Bacteria | 1357 |
| 85 | Ga0070693_100015994 | 3300005547 | Bacteria | 3875 |
| 86 | Ga0070693_100033072 | 3300005547 | Bacteria | 2851 |
| 87 | Ga0070665_100053599 | 3300005548 | Bacteria | 4044 |
| 88 | Ga0068855_100012767 | 3300005563 | Bacteria | 10130 |
| 89 | Ga0068855_100045657 | 3300005563 | Bacteria | 5181 |
| 90 | Ga0068855_100054301 | 3300005563 | Bacteria | 4709 |
| 91 | Ga0068855_100206370 | 3300005563 | Bacteria | 2210 |
| 92 | Ga0068855_100399599 | 3300005563 | Bacteria | 1506 |
| 93 | Ga0070664_100106766 | 3300005564 | Bacteria | 2440 |
| 94 | Ga0068856_100016798 | 3300005614 | Bacteria | 7091 |
| 95 | Ga0068856_100022991 | 3300005614 | Bacteria | 6061 |
| 96 | Ga0068856_100025102 | 3300005614 | Bacteria | 5808 |
| 97 | Ga0068856_100126309 | 3300005614 | Bacteria | 2561 |
| 98 | Ga0068856_100292083 | 3300005614 | Bacteria | 1647 |
| 99 | Ga0068852_100008353 | 3300005616 | Bacteria | 7627 |
| 100 | Ga0068852_100185320 | 3300005616 | Bacteria | 1960 |
| 101 | Ga0068852_100228226 | 3300005616 | Bacteria | 1774 |
| 102 | Ga0068859_100111186 | 3300005617 | Bacteria | 2802 |
| 103 | Ga0068863_100108061 | 3300005841 | Bacteria | 2648 |
| 104 | Ga0068863_100144067 | 3300005841 | Bacteria | 2278 |
| 105 | Ga0068858_100123178 | 3300005842 | Bacteria | 2426 |
| 106 | Ga0068858_100130133 | 3300005842 | Bacteria | 2359 |
| 107 | Ga0068860_100357996 | 3300005843 | Bacteria | 1437 |
| 108 | Ga0081455_10141817 | 3300005937 | Bacteria | 1865 |
| 109 | Ga0081538_10009795 | 3300005981 | Bacteria | 7932 |
| 110 | Ga0081540_1000151 | 3300005983 | Bacteria | 71183 |
| 111 | Ga0081540_1004184 | 3300005983 | Bacteria | 11101 |
| 112 | Ga0070717_10002789 | 3300006028 | Bacteria | 12368 |
| 113 | Ga0070717_10003201 | 3300006028 | Bacteria | 11693 |
| 114 | Ga0070717_10028805 | 3300006028 | Bacteria | 4450 |
| 115 | Ga0070717_10033037 | 3300006028 | Bacteria | 4172 |
| 116 | Ga0070717_10035331 | 3300006028 | Bacteria | 4045 |
| 117 | Ga0070717_10067096 | 3300006028 | Bacteria | 2984 |
| 118 | Ga0070717_10115359 | 3300006028 | Bacteria | 2295 |
| 119 | Ga0070717_10194446 | 3300006028 | Bacteria | 1774 |
| 120 | Ga0070717_10314549 | 3300006028 | Bacteria | 1394 |
| 121 | Ga0070717_10459331 | 3300006028 | Bacteria | 1148 |
| 122 | Ga0070717_10556206 | 3300006028 | Bacteria | 1039 |
| 123 | Ga0075365_10000573 | 3300006038 | Bacteria | 14269 |
| 124 | Ga0075365_10007506 | 3300006038 | Bacteria | 6115 |
| 125 | Ga0075365_10008296 | 3300006038 | Bacteria | 5886 |
| 126 | Ga0075364_10001415 | 3300006051 | Bacteria | 13009 |
| 127 | Ga0075432_10010142 | 3300006058 | Bacteria | 3196 |
| 128 | Ga0070716_100001145 | 3300006173 | Bacteria | 11690 |
| 129 | Ga0070716_100001372 | 3300006173 | Bacteria | 10813 |
| 130 | Ga0070716_100001418 | 3300006173 | Bacteria | 10644 |
| 131 | Ga0070716_100008860 | 3300006173 | Bacteria | 4999 |
| 132 | Ga0070712_100001789 | 3300006175 | Bacteria | 13136 |
| 133 | Ga0070712_100068021 | 3300006175 | Bacteria | 2536 |
| 134 | Ga0075431_100001328 | 3300006847 | Bacteria | 22611 |
| 135 | Ga0075433_10016095 | 3300006852 | Bacteria | 6152 |
| 136 | Ga0075433_10041192 | 3300006852 | Bacteria | 4001 |
| 137 | Ga0075434_100004072 | 3300006871 | Bacteria | 13099 |
| 138 | Ga0075434_100081059 | 3300006871 | Bacteria | 3242 |
| 139 | Ga0075436_100005017 | 3300006914 | Bacteria | 9097 |
| 140 | Ga0075436_100013955 | 3300006914 | Bacteria | 5498 |
| 141 | Ga0097620_100111187 | 3300006931 | Bacteria | 2802 |
| 142 | Ga0075435_100074305 | 3300007076 | Bacteria | 2780 |
| 143 | Ga0105251_10013349 | 3300009011 | Bacteria | 4599 |
| 144 | Ga0105240_10010339 | 3300009093 | Bacteria | 13129 |
| 145 | Ga0105240_10015062 | 3300009093 | Bacteria | 10526 |
| 146 | Ga0105240_10021422 | 3300009093 | Bacteria | 8594 |
| 147 | Ga0105240_10408674 | 3300009093 | Bacteria | 1527 |
| 148 | Ga0105245_10054248 | 3300009098 | Bacteria | 3600 |
| 149 | Ga0105247_10306771 | 3300009101 | Bacteria | 1103 |
| 150 | Ga0114129_10006397 | 3300009147 | Bacteria | 16699 |
| 151 | Ga0114129_10610108 | 3300009147 | Bacteria | 1413 |
| 152 | Ga0105243_10169736 | 3300009148 | Bacteria | 1888 |
| 153 | Ga0105241_10015679 | 3300009174 | Bacteria | 5553 |
| 154 | Ga0105248_10019553 | 3300009177 | Bacteria | 7497 |
| 155 | Ga0105237_10017726 | 3300009545 | Bacteria | 7382 |
| 156 | Ga0105237_10045676 | 3300009545 | Bacteria | 4407 |
| 157 | Ga0105237_10097058 | 3300009545 | Bacteria | 2937 |
| 158 | Ga0105238_10006171 | 3300009551 | Bacteria | 11899 |
| 159 | Ga0105239_10060098 | 3300010375 | Bacteria | 4171 |
| 160 | Ga0105239_10126944 | 3300010375 | Bacteria | 2836 |
| 161 | Ga0157373_10063429 | 3300013100 | Bacteria | 2616 |
| 162 | Ga0157370_10038212 | 3300013104 | Bacteria | 4644 |
| 163 | Ga0157369_10329125 | 3300013105 | Bacteria | 1587 |
| 164 | Ga0157374_10098488 | 3300013296 | Bacteria | 2800 |
| 165 | Ga0157378_10521833 | 3300013297 | Bacteria | 1189 |
| 166 | Ga0163162_10175704 | 3300013306 | Bacteria | 2267 |
| 167 | Ga0163162_10709475 | 3300013306 | Bacteria | 1127 |
| 168 | Ga0157372_10175587 | 3300013307 | Bacteria | 2479 |
| 169 | Ga0157372_10205004 | 3300013307 | Bacteria | 2285 |
| 170 | Ga0157372_10646259 | 3300013307 | Bacteria | 1232 |
| 171 | Ga0163163_10046257 | 3300014325 | Bacteria | 4275 |
| 172 | Ga0157380_10115671 | 3300014326 | Bacteria | 2262 |
| 173 | Ga0157377_10087858 | 3300014745 | Bacteria | 1830 |
| 174 | Ga0157377_10118865 | 3300014745 | Bacteria | 1599 |
| 175 | Ga0157379_10004765 | 3300014968 | Bacteria | 11655 |
| 176 | Ga0157376_10147212 | 3300014969 | Bacteria | 2120 |
| 177 | Ga0197907_10719170 | 3300020069 | Bacteria | 3242 |
| 178 | Ga0206351_10585209 | 3300020077 | Bacteria | 1901 |
| 179 | Ga0206350_11655236 | 3300020080 | Bacteria | 2678 |
| 180 | Ga0206354_10266512 | 3300020081 | Bacteria | 4020 |
| 181 | Ga0206353_10260620 | 3300020082 | Bacteria | 9113 |
| 182 | Ga0206353_11011084 | 3300020082 | Bacteria | 1956 |
| 183 | Ga0206353_11174394 | 3300020082 | Bacteria | 2166 |
| 184 | Ga0206353_11852117 | 3300020082 | Bacteria | 2651 |
| 185 | Ga0213875_10000727 | 3300021388 | Bacteria | 25103 |
| 186 | Ga0213875_10002626 | 3300021388 | Bacteria | 10654 |
| 187 | Ga0213875_10002831 | 3300021388 | Bacteria | 10172 |
| 188 | Ga0224712_10008460 | 3300022467 | Bacteria | 3052 |
| 189 | Ga0224712_10029241 | 3300022467 | Bacteria | 1977 |
| 190 | Ga0224712_10152197 | 3300022467 | Bacteria | 1026 |
| 191 | Ga0224572_1001159 | 3300024225 | Bacteria | 3750 |
| 192 | Ga0207653_10014578 | 3300025885 | Bacteria | 2466 |
| 193 | Ga0207692_10009667 | 3300025898 | Bacteria | 4037 |
| 194 | Ga0207692_10019711 | 3300025898 | Bacteria | 3053 |
| 195 | Ga0207692_10019993 | 3300025898 | Bacteria | 3037 |
| 196 | Ga0207692_10029847 | 3300025898 | Bacteria | 2595 |
| 197 | Ga0207688_10027892 | 3300025901 | Bacteria | 3106 |
| 198 | Ga0207680_10145987 | 3300025903 | Bacteria | 1573 |
| 199 | Ga0207647_10012340 | 3300025904 | Bacteria | 5949 |
| 200 | Ga0207685_10002516 | 3300025905 | Bacteria | 4222 |
| 201 | Ga0207685_10016246 | 3300025905 | Bacteria | 2379 |
| 202 | Ga0207699_10000904 | 3300025906 | Bacteria | 14188 |
| 203 | Ga0207699_10001571 | 3300025906 | Bacteria | 10834 |
| 204 | Ga0207699_10005463 | 3300025906 | Bacteria | 6085 |
| 205 | Ga0207699_10006375 | 3300025906 | Bacteria | 5707 |
| 206 | Ga0207699_10073709 | 3300025906 | Bacteria | 2095 |
| 207 | Ga0207699_10283318 | 3300025906 | Bacteria | 1152 |
| 208 | Ga0207705_10113196 | 3300025909 | Bacteria | 2007 |
| 209 | Ga0207684_10000495 | 3300025910 | Bacteria | 49988 |
| 210 | Ga0207684_10000583 | 3300025910 | Bacteria | 44299 |
| 211 | Ga0207684_10002613 | 3300025910 | Bacteria | 18016 |
| 212 | Ga0207684_10004967 | 3300025910 | Bacteria | 12402 |
| 213 | Ga0207684_10030266 | 3300025910 | Bacteria | 4609 |
| 214 | Ga0207684_10041676 | 3300025910 | Bacteria | 3891 |
| 215 | Ga0207684_10197617 | 3300025910 | Bacteria | 1734 |
| 216 | Ga0207654_10039890 | 3300025911 | Bacteria | 2643 |
| 217 | Ga0207695_10002357 | 3300025913 | Bacteria | 28088 |
| 218 | Ga0207695_10277209 | 3300025913 | Bacteria | 1571 |
| 219 | Ga0207671_10001397 | 3300025914 | Bacteria | 28073 |
| 220 | Ga0207671_10074475 | 3300025914 | Bacteria | 2537 |
| 221 | Ga0207693_10013039 | 3300025915 | Bacteria | 6707 |
| 222 | Ga0207693_10049143 | 3300025915 | Bacteria | 3312 |
| 223 | Ga0207693_10150269 | 3300025915 | Bacteria | 1832 |
| 224 | Ga0207663_10022656 | 3300025916 | Bacteria | 3594 |
| 225 | Ga0207663_10054137 | 3300025916 | Bacteria | 2511 |
| 226 | Ga0207663_10094820 | 3300025916 | Bacteria | 1989 |
| 227 | Ga0207662_10062535 | 3300025918 | Bacteria | 2237 |
| 228 | Ga0207646_10000218 | 3300025922 | Bacteria | 78329 |
| 229 | Ga0207646_10005205 | 3300025922 | Bacteria | 13745 |
| 230 | Ga0207646_10013662 | 3300025922 | Bacteria | 7754 |
| 231 | Ga0207646_10053323 | 3300025922 | Bacteria | 3617 |
| 232 | Ga0207646_10061311 | 3300025922 | Bacteria | 3357 |
| 233 | Ga0207646_10279995 | 3300025922 | Bacteria | 1507 |
| 234 | Ga0207694_10004697 | 3300025924 | Bacteria | 10630 |
| 235 | Ga0207694_10395645 | 3300025924 | Bacteria | 1148 |
| 236 | Ga0207687_10144750 | 3300025927 | Bacteria | 1807 |
| 237 | Ga0207687_10230112 | 3300025927 | Bacteria | 1464 |
| 238 | Ga0207700_10002040 | 3300025928 | Bacteria | 11551 |
| 239 | Ga0207700_10003217 | 3300025928 | Bacteria | 9429 |
| 240 | Ga0207700_10016328 | 3300025928 | Bacteria | 4930 |
| 241 | Ga0207700_10024036 | 3300025928 | Bacteria | 4213 |
| 242 | Ga0207700_10026370 | 3300025928 | Bacteria | 4050 |
| 243 | Ga0207700_10029235 | 3300025928 | Bacteria | 3886 |
| 244 | Ga0207700_10062006 | 3300025928 | Bacteria | 2838 |
| 245 | Ga0207700_10075072 | 3300025928 | Bacteria | 2618 |
| 246 | Ga0207700_10075986 | 3300025928 | Bacteria | 2605 |
| 247 | Ga0207700_10144849 | 3300025928 | Bacteria | 1957 |
| 248 | Ga0207700_10162277 | 3300025928 | Bacteria | 1857 |
| 249 | Ga0207700_10244932 | 3300025928 | Bacteria | 1529 |
| 250 | Ga0207664_10000917 | 3300025929 | Bacteria | 19842 |
| 251 | Ga0207664_10001098 | 3300025929 | Bacteria | 18046 |
| 252 | Ga0207664_10002635 | 3300025929 | Bacteria | 11886 |
| 253 | Ga0207664_10014360 | 3300025929 | Bacteria | 5716 |
| 254 | Ga0207664_10025437 | 3300025929 | Bacteria | 4460 |
| 255 | Ga0207664_10029061 | 3300025929 | Bacteria | 4208 |
| 256 | Ga0207664_10040906 | 3300025929 | Bacteria | 3608 |
| 257 | Ga0207664_10193654 | 3300025929 | Bacteria | 1751 |
| 258 | Ga0207664_10235424 | 3300025929 | Bacteria | 1593 |
| 259 | Ga0207690_10092706 | 3300025932 | Bacteria | 2139 |
| 260 | Ga0207706_10029288 | 3300025933 | Bacteria | 4916 |
| 261 | Ga0207665_10000929 | 3300025939 | Bacteria | 19812 |
| 262 | Ga0207665_10003086 | 3300025939 | Bacteria | 11172 |
| 263 | Ga0207665_10011381 | 3300025939 | Bacteria | 5842 |
| 264 | Ga0207665_10024581 | 3300025939 | Bacteria | 3972 |
| 265 | Ga0207665_10093557 | 3300025939 | Bacteria | 2087 |
| 266 | Ga0207665_10149773 | 3300025939 | Bacteria | 1670 |
| 267 | Ga0207711_10220352 | 3300025941 | Bacteria | 1735 |
| 268 | Ga0207661_10302644 | 3300025944 | Bacteria | 1434 |
| 269 | Ga0207661_10400168 | 3300025944 | Bacteria | 1245 |
| 270 | Ga0207667_10045382 | 3300025949 | Bacteria | 4655 |
| 271 | Ga0207667_10045791 | 3300025949 | Bacteria | 4632 |
| 272 | Ga0207667_10133675 | 3300025949 | Bacteria | 2555 |
| 273 | Ga0207667_10171299 | 3300025949 | Bacteria | 2231 |
| 274 | Ga0207651_10012268 | 3300025960 | Bacteria | 4841 |
| 275 | Ga0207658_10009700 | 3300025986 | Bacteria | 6536 |
| 276 | Ga0207677_10053667 | 3300026023 | Bacteria | 2745 |
| 277 | Ga0207639_10117689 | 3300026041 | Bacteria | 2178 |
| 278 | Ga0207639_10346057 | 3300026041 | Bacteria | 1326 |
| 279 | Ga0207639_10400805 | 3300026041 | Bacteria | 1236 |
| 280 | Ga0207708_10004677 | 3300026075 | Bacteria | 10069 |
| 281 | Ga0207702_10018132 | 3300026078 | Bacteria | 5823 |
| 282 | Ga0207702_10020203 | 3300026078 | Bacteria | 5517 |
| 283 | Ga0207702_10090947 | 3300026078 | Bacteria | 2671 |
| 284 | Ga0207641_10108595 | 3300026088 | Bacteria | 2456 |
| 285 | Ga0207641_10298719 | 3300026088 | Bacteria | 1520 |
| 286 | Ga0207648_10032598 | 3300026089 | Bacteria | 4598 |
| 287 | Ga0207674_10008612 | 3300026116 | Bacteria | 11759 |
| 288 | Ga0207674_10021672 | 3300026116 | Bacteria | 6918 |
| 289 | Ga0207683_10004533 | 3300026121 | Bacteria | 11975 |
| 290 | Ga0207683_10396898 | 3300026121 | Bacteria | 1269 |
| 291 | Ga0207698_10010512 | 3300026142 | Bacteria | 5954 |
| 292 | Ga0207428_10106536 | 3300027907 | Bacteria | 2161 |
| 293 | Ga0207428_10194181 | 3300027907 | Bacteria | 1529 |
| 294 | Ga0224573_1002340 | 3300028019 | Bacteria | 1438 |
| 295 | Ga0268266_10128323 | 3300028379 | Bacteria | 2266 |
| 296 | Ga0268266_10245363 | 3300028379 | Bacteria | 1654 |
| 297 | Ga0265336_10012382 | 3300028666 | Bacteria | 2872 |
| 298 | Ga0265338_10000596 | 3300028800 | Bacteria | 63688 |
| 299 | Ga0265338_10013006 | 3300028800 | Bacteria | 9439 |
| 300 | Ga0265338_10021849 | 3300028800 | Bacteria | 6650 |
| 301 | Ga0307511_10005760 | 3300030521 | Bacteria | 12536 |
| 302 | Ga0316214_1008859 | 3300033545 | Bacteria | 1357 |
| 303 | Ga0316212_1000295 | 3300033547 | Bacteria | 5934 |
| 304 | Ga0373930_0004804 | 3300034816 | Bacteria | 2218 |
| 305 | Ga0373959_0001601 | 3300034820 | Bacteria | 3606 |
| 306 | Ga0373938_0001754 | 3300034957 | Bacteria | 3460 |
| 307 | Ga0373926_0000360 | 3300035083 | Bacteria | 11581 |
| 308 | Ga0373926_0009093 | 3300035083 | Bacteria | 3315 |
| 309 | Ga0373928_0007408 | 3300035084 | Bacteria | 2117 |
| 310 | Ga0373929_0027698 | 3300035085 | Bacteria | 1192 |
| 311 | Ga0373934_0000053 | 3300035086 | Bacteria | 39071 |
| 312 | Ga0373934_0003111 | 3300035086 | Bacteria | 6052 |
| 313 | Ga0373934_0004117 | 3300035086 | Bacteria | 5362 |
| 314 | Ga0373934_0006190 | 3300035086 | Bacteria | 4434 |
| 315 | Ga0373940_0007390 | 3300035088 | Bacteria | 2479 |
| 316 | Ga0373940_0015568 | 3300035088 | Bacteria | 1873 |
| 317 | Ga0373949_0021630 | 3300035090 | Bacteria | 1478 |
| 318 | Ga0373923_0005578 | 3300035111 | Bacteria | 4281 |
| 319 | Ga0373923_0024932 | 3300035111 | Bacteria | 2365 |
| 320 | Ga0373923_0052137 | 3300035111 | Bacteria | 1718 |
| 321 | Ga0373932_0007803 | 3300035112 | Bacteria | 2554 |
| 322 | Ga0373936_0001318 | 3300035113 | Bacteria | 8991 |
| 323 | Ga0373936_0003379 | 3300035113 | Bacteria | 5980 |
| 324 | Ga0373936_0037333 | 3300035113 | Bacteria | 1939 |
| 325 | Ga0373945_0049795 | 3300035116 | Bacteria | 1538 |
| 326 | Ga0373945_0052798 | 3300035116 | Bacteria | 1498 |
| 327 | Ga0373953_0000470 | 3300035117 | Bacteria | 11115 |
| 328 | Ga0373953_0000922 | 3300035117 | Bacteria | 8234 |
| 329 | Ga0373953_0057436 | 3300035117 | Bacteria | 1584 |
| 330 | Ga0373954_0001494 | 3300035118 | Bacteria | 9506 |
| 331 | Ga0373954_0004958 | 3300035118 | Bacteria | 5746 |
| 332 | Ga0373954_0016080 | 3300035118 | Bacteria | 3347 |
| 333 | Ga0373954_0025010 | 3300035118 | Bacteria | 2726 |
| 334 | Ga0373954_0056743 | 3300035118 | Bacteria | 1844 |
| 335 | Ga0373956_0000325 | 3300035119 | Bacteria | 19198 |
| 336 | Ga0373956_0002679 | 3300035119 | Bacteria | 7205 |
| 337 | Ga0373956_0008484 | 3300035119 | Bacteria | 4161 |
| 338 | Ga0373956_0017199 | 3300035119 | Bacteria | 3046 |
| 339 | Ga0373956_0044279 | 3300035119 | Bacteria | 1983 |
| 340 | Ga0373956_0071291 | 3300035119 | Bacteria | 1585 |
| 341 | Ga0373957_0000015 | 3300035120 | Bacteria | 43575 |
| 342 | Ga0373957_0006637 | 3300035120 | Bacteria | 3658 |
| 343 | Ga0373957_0012535 | 3300035120 | Bacteria | 2857 |
| 344 | Ga0373957_0034793 | 3300035120 | Bacteria | 1868 |
| 345 | Ga0373957_0065944 | 3300035120 | Bacteria | 1409 |
| 346 | Ga0373943_0017785 | 3300035170 | Bacteria | 3256 |
| 347 | Ga0373943_0123384 | 3300035170 | Bacteria | 1379 |
| 348 | Ga0373946_0056033 | 3300035171 | Bacteria | 1663 |
| 349 | Ga0373946_0060405 | 3300035171 | Bacteria | 1611 |
| 350 | Ga0373955_0000027 | 3300035172 | Bacteria | 58251 |
| 351 | Ga0373955_0030168 | 3300035172 | Bacteria | 2827 |
| 352 | Ga0373955_0037534 | 3300035172 | Bacteria | 2576 |
| 353 | Ga0373942_0004774 | 3300035207 | Bacteria | 3145 |
| 354 | Ga0373942_0025455 | 3300035207 | Bacteria | 1525 |
| 355 | Ga0373924_0000084 | 3300035410 | Bacteria | 25342 |
| 356 | Ga0373924_0001744 | 3300035410 | Bacteria | 7177 |
| 357 | Ga0373924_0023060 | 3300035410 | Bacteria | 2437 |
| 358 | Ga0373924_0029926 | 3300035410 | Bacteria | 2179 |
| 359 | Ga0373924_0031872 | 3300035410 | Bacteria | 2121 |
| 360 | Ga0373931_0013691 | 3300035691 | Bacteria | 3954 |
| 361 | Ga0373931_0020631 | 3300035691 | Bacteria | 3298 |
| 362 | Ga0373935_0004908 | 3300035692 | Bacteria | 7858 |
| 363 | Ga0373935_0014258 | 3300035692 | Bacteria | 4797 |
| 364 | Ga0373935_0038520 | 3300035692 | Bacteria | 2993 |
| 365 | Ga0373935_0107610 | 3300035692 | Bacteria | 1846 |
| 366 | Ga0373927_0018009 | 3300035695 | Bacteria | 4645 |
| 367 | Ga0373927_0098327 | 3300035695 | Bacteria | 1903 |
| 368 | Ga0373933_0000025 | 3300035724 | Bacteria | 90735 |
| 369 | Ga0373933_0001053 | 3300035724 | Bacteria | 16697 |
| 370 | Ga0373933_0014139 | 3300035724 | Bacteria | 4432 |
| 371 | Ga0373933_0029824 | 3300035724 | Bacteria | 3156 |
| 372 | Ga0373933_0107677 | 3300035724 | Bacteria | 1735 |
| 373 | Ga0373947_0000004 | 3300035725 | Bacteria | 248228 |
| 374 | Ga0373947_0003675 | 3300035725 | Bacteria | 9046 |
| 375 | Ga0373947_0041997 | 3300035725 | Bacteria | 2729 |
| 376 | Ga0373947_0070828 | 3300035725 | Bacteria | 2137 |
| 377 | Ga0373947_0118990 | 3300035725 | Bacteria | 1676 |
| 378 | Ga0373937_0000034 | 3300036401 | Bacteria | 116552 |
| 379 | Ga0373937_0017863 | 3300036401 | Bacteria | 6328 |
| 380 | Ga0373937_0031788 | 3300036401 | Bacteria | 4784 |
| 381 | Ga0373937_0078785 | 3300036401 | Bacteria | 3045 |
| 382 | Ga0373937_0119114 | 3300036401 | Bacteria | 2459 |
| 383 | Ga0373937_0211451 | 3300036401 | Bacteria | 1825 |
| 384 | Ga0373925_0000633 | 3300037068 | Bacteria | 33249 |
| 385 | Ga0373925_0005928 | 3300037068 | Bacteria | 9056 |
| 386 | Ga0373925_0012048 | 3300037068 | Bacteria | 6261 |
| 387 | Ga0373925_0078600 | 3300037068 | Bacteria | 2505 |
| 388 | Ga0373925_0117143 | 3300037068 | Bacteria | 2064 |
| 389 | Ga0373925_0256175 | 3300037068 | Bacteria | 1404 |
| 390 | Ga0373925_0291000 | 3300037068 | Bacteria | 1317 |
| 391 | Ga0373925_0323849 | 3300037068 | Bacteria | 1247 |
| 392 | Ga0395900_0004392 | 3300037418 | Bacteria | 14963 |
| 393 | Ga0395900_0495872 | 3300037418 | Unclassified | 1172 |
| 394 | Ga0395898_0001996 | 3300037466 | Bacteria | 25620 |
| 395 | Ga0395898_0035783 | 3300037466 | Bacteria | 4934 |
| 396 | Ga0395898_0434990 | 3300037466 | Bacteria | 1250 |
| 397 | Ga0436364_0395778 | 3300037853 | Bacteria | 30492 |
| 398 | Ga0436364_0502444 | 3300037853 | Bacteria | 31198 |
| 399 | Ga0436364_0720930 | 3300037853 | Bacteria | 12667 |
| 400 | Ga0436364_1069913 | 3300037853 | Bacteria | 1043 |
| 401 | Ga0395901_0009204 | 3300038443 | Bacteria | 10004 |
| 402 | Ga0395901_0021767 | 3300038443 | Bacteria | 6570 |
| 403 | Ga0395901_0290505 | 3300038443 | Bacteria | 1697 |
| 404 | Ga0395901_0704026 | 3300038443 | Bacteria | 1007 |
| 405 | Ga0436365_1371133 | 3300039437 | Bacteria | 5312 |
| 406 | Ga0436363_0546269 | 3300039450 | Bacteria | 1947 |
| 407 | Ga0436363_1179736 | 3300039450 | Bacteria | 2376 |
| 408 | Ga0436362_1121950 | 3300039453 | Bacteria | 1508 |
| 409 | Ga0466969_0000716 | 3300044656 | Bacteria | 17970 |
| 410 | Ga0466969_0002737 | 3300044656 | Bacteria | 9427 |
| 411 | Ga0466969_0004039 | 3300044656 | Bacteria | 7778 |
| 412 | Ga0466969_0011533 | 3300044656 | Bacteria | 4678 |
| 413 | Ga0466969_0013913 | 3300044656 | Bacteria | 4235 |
| 414 | Ga0466969_0016031 | 3300044656 | Bacteria | 3926 |
| 415 | Ga0466969_0023258 | 3300044656 | Bacteria | 3194 |
| 416 | Ga0466969_0101975 | 3300044656 | Bacteria | 1350 |
| 417 | Ga0466966_0001071 | 3300044684 | Bacteria | 17476 |
| 418 | Ga0466966_0015198 | 3300044684 | Bacteria | 5093 |
| 419 | Ga0466966_0015962 | 3300044684 | Bacteria | 4964 |
| 420 | Ga0466966_0027809 | 3300044684 | Bacteria | 3687 |
| 421 | Ga0466966_0033280 | 3300044684 | Bacteria | 3338 |
| 422 | Ga0466966_0259780 | 3300044684 | Bacteria | 1046 |
| 423 | Ga0466961_0002475 | 3300044693 | Bacteria | 11457 |
| 424 | Ga0466961_0002554 | 3300044693 | Bacteria | 11273 |
| 425 | Ga0466961_0009808 | 3300044693 | Bacteria | 6096 |
| 426 | Ga0466961_0022551 | 3300044693 | Bacteria | 4050 |
| 427 | Ga0466961_0029340 | 3300044693 | Bacteria | 3537 |
| 428 | Ga0466963_0005926 | 3300044694 | Bacteria | 7195 |
| 429 | Ga0466963_0022604 | 3300044694 | Bacteria | 3984 |
| 430 | Ga0466963_0026989 | 3300044694 | Bacteria | 3674 |
| 431 | Ga0466963_0041755 | 3300044694 | Bacteria | 3009 |
| 432 | Ga0466963_0048312 | 3300044694 | Bacteria | 2811 |
| 433 | Ga0466963_0264732 | 3300044694 | Bacteria | 1207 |
| 434 | Ga0466971_0000279 | 3300044719 | Bacteria | 19515 |
| 435 | Ga0466971_0015663 | 3300044719 | Bacteria | 3339 |
| 436 | Ga0466971_0069510 | 3300044719 | Bacteria | 1598 |
| 437 | Ga0466970_0005393 | 3300044765 | Bacteria | 6343 |
| 438 | Ga0466970_0014136 | 3300044765 | Bacteria | 4094 |
| 439 | Ga0466970_0044403 | 3300044765 | Bacteria | 2366 |
| 440 | Ga0466957_0127755 | 3300044842 | Bacteria | 1625 |
| 441 | Ga0466957_0179017 | 3300044842 | Bacteria | 1384 |
| 442 | Ga0466957_0306059 | 3300044842 | Bacteria | 1069 |
| 443 | Ga0466957_0446549 | 3300044842 | Bacteria | 891 |
| 444 | Ga0466959_0000323 | 3300045049 | Bacteria | 28214 |
| 445 | Ga0466959_0011233 | 3300045049 | Bacteria | 6425 |
| 446 | Ga0466959_0051545 | 3300045049 | Bacteria | 3017 |
| 447 | Ga0466959_0093621 | 3300045049 | Bacteria | 2156 |
| 448 | Ga0466959_0105794 | 3300045049 | Bacteria | 2012 |
| 449 | Ga0466959_0112991 | 3300045049 | Bacteria | 1937 |
| 450 | Ga0466959_0125686 | 3300045049 | Bacteria | 1820 |
| 451 | Ga0466959_0178426 | 3300045049 | Bacteria | 1487 |
| 452 | Ga0466958_0007882 | 3300045836 | Bacteria | 5886 |
| 453 | Ga0466958_0028948 | 3300045836 | Bacteria | 3286 |
| 454 | Ga0466958_0045913 | 3300045836 | Bacteria | 2636 |
| 455 | Ga0466958_0122635 | 3300045836 | Unclassified | 1628 |
| 456 | Ga0466958_0177663 | 3300045836 | Bacteria | 1350 |
| 457 | Ga0466967_0006404 | 3300045976 | Bacteria | 8323 |
| 458 | Ga0466967_0014283 | 3300045976 | Bacteria | 6179 |
| 459 | Ga0466967_0052558 | 3300045976 | Bacteria | 3577 |
| 460 | Ga0466967_0154000 | 3300045976 | Bacteria | 2151 |
| 461 | Ga0466967_0346592 | 3300045976 | Bacteria | 1437 |
| 462 | Ga0495592_0000016 | 3300046454 | Bacteria | 144922 |
| 463 | Ga0495592_0028669 | 3300046454 | Bacteria | 4214 |
| 464 | Ga0495592_0103575 | 3300046454 | Bacteria | 2024 |
| 465 | Ga0495592_0152684 | 3300046454 | Bacteria | 1595 |
| 466 | Ga0495592_0219309 | 3300046454 | Bacteria | 1273 |
| 467 | Ga0495603_0017302 | 3300046455 | Bacteria | 4365 |
| 468 | Ga0495603_0157927 | 3300046455 | Bacteria | 1316 |
| 469 | Ga0495629_0026762 | 3300046459 | Bacteria | 4095 |
| 470 | Ga0495629_0069170 | 3300046459 | Bacteria | 2463 |
| 471 | Ga0495629_0162511 | 3300046459 | Bacteria | 1551 |
| 472 | Ga0495641_0006309 | 3300046461 | Bacteria | 7711 |
| 473 | Ga0495641_0073405 | 3300046461 | Bacteria | 1535 |
| 474 | Ga0495641_0096350 | 3300046461 | Bacteria | 1320 |
| 475 | Ga0495651_0000005 | 3300046462 | Bacteria | 173396 |
| 476 | Ga0495651_0002725 | 3300046462 | Bacteria | 13708 |
| 477 | Ga0495651_0018456 | 3300046462 | Bacteria | 5402 |
| 478 | Ga0495651_0032212 | 3300046462 | Bacteria | 4089 |
| 479 | Ga0495651_0034619 | 3300046462 | Bacteria | 3936 |
| 480 | Ga0495651_0060989 | 3300046462 | Bacteria | 2887 |
| 481 | Ga0495651_0062117 | 3300046462 | Bacteria | 2858 |
| 482 | Ga0495651_0137149 | 3300046462 | Bacteria | 1778 |
| 483 | Ga0495653_0001819 | 3300046463 | Bacteria | 16822 |
| 484 | Ga0495653_0003475 | 3300046463 | Bacteria | 12660 |
| 485 | Ga0495653_0004816 | 3300046463 | Bacteria | 10941 |
| 486 | Ga0495653_0018528 | 3300046463 | Bacteria | 5651 |
| 487 | Ga0495653_0056120 | 3300046463 | Bacteria | 3003 |
| 488 | Ga0495653_0062414 | 3300046463 | Bacteria | 2815 |
| 489 | Ga0495653_0130009 | 3300046463 | Bacteria | 1784 |
| 490 | Ga0495580_0044986 | 3300046472 | Bacteria | 3137 |
| 491 | Ga0495582_0302278 | 3300046473 | Bacteria | 920 |
| 492 | Ga0495639_0003094 | 3300046475 | Bacteria | 7238 |
| 493 | Ga0495639_0185139 | 3300046475 | Bacteria | 1015 |
| 494 | Ga0495662_0002423 | 3300046476 | Bacteria | 9370 |
| 495 | Ga0495662_0005000 | 3300046476 | Bacteria | 6643 |
| 496 | Ga0495662_0020528 | 3300046476 | Bacteria | 3196 |
| 497 | Ga0495662_0083121 | 3300046476 | Bacteria | 1558 |
| 498 | Ga0495662_0124415 | 3300046476 | Bacteria | 1266 |
| 499 | Ga0495662_0127889 | 3300046476 | Bacteria | 1248 |
| 500 | Ga0495662_0128724 | 3300046476 | Bacteria | 1244 |
| 501 | Ga0495664_0003347 | 3300046477 | Bacteria | 8717 |
| 502 | Ga0495664_0101384 | 3300046477 | Bacteria | 1734 |
| 503 | Ga0495594_0010188 | 3300046499 | Bacteria | 4871 |
| 504 | Ga0495608_0000057 | 3300046511 | Bacteria | 90735 |
| 505 | Ga0495608_0004720 | 3300046511 | Bacteria | 9755 |
| 506 | Ga0495608_0093057 | 3300046511 | Bacteria | 1947 |
| 507 | Ga0495608_0095084 | 3300046511 | Bacteria | 1925 |
| 508 | Ga0495608_0199116 | 3300046511 | Bacteria | 1262 |
| 509 | Ga0495618_0005229 | 3300046514 | Bacteria | 7931 |
| 510 | Ga0495618_0019880 | 3300046514 | Bacteria | 4134 |
| 511 | Ga0495618_0024487 | 3300046514 | Bacteria | 3739 |
| 512 | Ga0495618_0060552 | 3300046514 | Bacteria | 2400 |
| 513 | Ga0495618_0171261 | 3300046514 | Bacteria | 1381 |
| 514 | Ga0495618_0291408 | 3300046514 | Bacteria | 1016 |
| 515 | Ga0495628_0000073 | 3300046516 | Bacteria | 79628 |
| 516 | Ga0495628_0020075 | 3300046516 | Bacteria | 5515 |
| 517 | Ga0495628_0030499 | 3300046516 | Bacteria | 4365 |
| 518 | Ga0495628_0054874 | 3300046516 | Bacteria | 3140 |
| 519 | Ga0495628_0069465 | 3300046516 | Bacteria | 2747 |
| 520 | Ga0495628_0070281 | 3300046516 | Bacteria | 2729 |
| 521 | Ga0495628_0095207 | 3300046516 | Bacteria | 2301 |
| 522 | Ga0495628_0153273 | 3300046516 | Bacteria | 1754 |
| 523 | Ga0495628_0165988 | 3300046516 | Bacteria | 1676 |
| 524 | Ga0495630_0006137 | 3300046517 | Bacteria | 8520 |
| 525 | Ga0495630_0012698 | 3300046517 | Bacteria | 6120 |
| 526 | Ga0495630_0026937 | 3300046517 | Bacteria | 4260 |
| 527 | Ga0495630_0065249 | 3300046517 | Bacteria | 2735 |
| 528 | Ga0495630_0096862 | 3300046517 | Bacteria | 2230 |
| 529 | Ga0495666_0007862 | 3300046526 | Bacteria | 5341 |
| 530 | Ga0495666_0029653 | 3300046526 | Bacteria | 2691 |
| 531 | Ga0495652_0000054 | 3300046529 | Bacteria | 116611 |
| 532 | Ga0495652_0013125 | 3300046529 | Bacteria | 7459 |
| 533 | Ga0495652_0028852 | 3300046529 | Bacteria | 4878 |
| 534 | Ga0495652_0053930 | 3300046529 | Bacteria | 3425 |
| 535 | Ga0495652_0073249 | 3300046529 | Bacteria | 2852 |
| 536 | Ga0495652_0150728 | 3300046529 | Bacteria | 1817 |
| 537 | Ga0495652_0183454 | 3300046529 | Bacteria | 1603 |
| 538 | Ga0495665_0001784 | 3300046531 | Bacteria | 11584 |
| 539 | Ga0495665_0032541 | 3300046531 | Bacteria | 2789 |
| 540 | Ga0495640_0002155 | 3300046533 | Bacteria | 15729 |
| 541 | Ga0495640_0015646 | 3300046533 | Bacteria | 5700 |
| 542 | Ga0495640_0017648 | 3300046533 | Bacteria | 5312 |
| 543 | Ga0495640_0032728 | 3300046533 | Bacteria | 3700 |
| 544 | Ga0495640_0054912 | 3300046533 | Bacteria | 2727 |
| 545 | Ga0495640_0059198 | 3300046533 | Bacteria | 2610 |
| 546 | Ga0495586_0004834 | 3300046535 | Bacteria | 7203 |
| 547 | Ga0495586_0016074 | 3300046535 | Bacteria | 3981 |
| 548 | Ga0495586_0062049 | 3300046535 | Bacteria | 2034 |
| 549 | Ga0495587_0000030 | 3300046536 | Bacteria | 135844 |
| 550 | Ga0495587_0002096 | 3300046536 | Bacteria | 13318 |
| 551 | Ga0495587_0011063 | 3300046536 | Bacteria | 5721 |
| 552 | Ga0495587_0012367 | 3300046536 | Bacteria | 5374 |
| 553 | Ga0495587_0015899 | 3300046536 | Bacteria | 4687 |
| 554 | Ga0495587_0037061 | 3300046536 | Bacteria | 2930 |
| 555 | Ga0495587_0118019 | 3300046536 | Bacteria | 1520 |
| 556 | Ga0495587_0137543 | 3300046536 | Bacteria | 1395 |
| 557 | Ga0495645_0004436 | 3300046543 | Bacteria | 9586 |
| 558 | Ga0495645_0020221 | 3300046543 | Bacteria | 4800 |
| 559 | Ga0495645_0054817 | 3300046543 | Bacteria | 2895 |
| 560 | Ga0495645_0054985 | 3300046543 | Bacteria | 2891 |
| 561 | Ga0495645_0058308 | 3300046543 | Bacteria | 2801 |
| 562 | Ga0495645_0138449 | 3300046543 | Bacteria | 1700 |
| 563 | Ga0495667_0000025 | 3300046559 | Bacteria | 155090 |
| 564 | Ga0495667_0000230 | 3300046559 | Bacteria | 36657 |
| 565 | Ga0495667_0010842 | 3300046559 | Bacteria | 6161 |
| 566 | Ga0495667_0012533 | 3300046559 | Bacteria | 5748 |
| 567 | Ga0495667_0026825 | 3300046559 | Bacteria | 3881 |
| 568 | Ga0495667_0038051 | 3300046559 | Bacteria | 3204 |
| 569 | Ga0495634_0006362 | 3300046642 | Bacteria | 8980 |
| 570 | Ga0495634_0006938 | 3300046642 | Bacteria | 8553 |
| 571 | Ga0495634_0027503 | 3300046642 | Bacteria | 3956 |
| 572 | Ga0495634_0194102 | 3300046642 | Bacteria | 1265 |
| 573 | Ga0495635_0058552 | 3300046663 | Bacteria | 2650 |
| 574 | Ga0495635_0110963 | 3300046663 | Bacteria | 1873 |
| 575 | Ga0495588_0005223 | 3300046674 | Bacteria | 5773 |
| 576 | Ga0495588_0047894 | 3300046674 | Bacteria | 2195 |
| 577 | Ga0495588_0169723 | 3300046674 | Bacteria | 1154 |
| 578 | Ga0495657_0000018 | 3300046675 | Bacteria | 173397 |
| 579 | Ga0495657_0002245 | 3300046675 | Bacteria | 16354 |
| 580 | Ga0495657_0028746 | 3300046675 | Bacteria | 3906 |
| 581 | Ga0495657_0135380 | 3300046675 | Bacteria | 1539 |
| 582 | Ga0495599_0000054 | 3300046678 | Bacteria | 79938 |
| 583 | Ga0495599_0001992 | 3300046678 | Bacteria | 11813 |
| 584 | Ga0495599_0009175 | 3300046678 | Bacteria | 6035 |
| 585 | Ga0495599_0011205 | 3300046678 | Bacteria | 5505 |
| 586 | Ga0495599_0038224 | 3300046678 | Bacteria | 3016 |
| 587 | Ga0495599_0045245 | 3300046678 | Bacteria | 2760 |
| 588 | Ga0495599_0046066 | 3300046678 | Bacteria | 2735 |
| 589 | Ga0495599_0078273 | 3300046678 | Bacteria | 2064 |
| 590 | Ga0495599_0087832 | 3300046678 | Bacteria | 1941 |
| 591 | Ga0495599_0091250 | 3300046678 | Bacteria | 1900 |
| 592 | Ga0495599_0121283 | 3300046678 | Bacteria | 1625 |
| 593 | Ga0495623_0000582 | 3300046679 | Bacteria | 24382 |
| 594 | Ga0495623_0037451 | 3300046679 | Bacteria | 3103 |
| 595 | Ga0495623_0041325 | 3300046679 | Bacteria | 2941 |
| 596 | Ga0495623_0043777 | 3300046679 | Bacteria | 2846 |
| 597 | Ga0495623_0050666 | 3300046679 | Bacteria | 2629 |
| 598 | Ga0495623_0064058 | 3300046679 | Bacteria | 2301 |
| 599 | Ga0495623_0070626 | 3300046679 | Bacteria | 2175 |
| 600 | Ga0495646_0005148 | 3300046680 | Bacteria | 8249 |
| 601 | Ga0495646_0018708 | 3300046680 | Bacteria | 4387 |
| 602 | Ga0495646_0021048 | 3300046680 | Bacteria | 4122 |
| 603 | Ga0495646_0069054 | 3300046680 | Bacteria | 2085 |
| 604 | Ga0495646_0100245 | 3300046680 | Bacteria | 1662 |
| 605 | Ga0495658_0030547 | 3300046683 | Bacteria | 2926 |
| 606 | Ga0495658_0039770 | 3300046683 | Bacteria | 2611 |
| 607 | Ga0495658_0043315 | 3300046683 | Bacteria | 2517 |
| 608 | Ga0495613_0009885 | 3300046689 | Bacteria | 7092 |
| 609 | Ga0495613_0040579 | 3300046689 | Bacteria | 3448 |
| 610 | Ga0495613_0044720 | 3300046689 | Bacteria | 3275 |
| 611 | Ga0495613_0128322 | 3300046689 | Bacteria | 1817 |
| 612 | Ga0495624_0006425 | 3300046690 | Bacteria | 8339 |
| 613 | Ga0495624_0018189 | 3300046690 | Bacteria | 4702 |
| 614 | Ga0495624_0134739 | 3300046690 | Bacteria | 1514 |
| 615 | Ga0495600_0003068 | 3300046809 | Bacteria | 9760 |
| 616 | Ga0495600_0004322 | 3300046809 | Bacteria | 8495 |
| 617 | Ga0495600_0004754 | 3300046809 | Bacteria | 8149 |
| 618 | Ga0495600_0015851 | 3300046809 | Bacteria | 4774 |
| 619 | Ga0495600_0027319 | 3300046809 | Bacteria | 3687 |
| 620 | Ga0495600_0040818 | 3300046809 | Bacteria | 3023 |
| 621 | Ga0495600_0063499 | 3300046809 | Bacteria | 2413 |
| 622 | Ga0495600_0084115 | 3300046809 | Bacteria | 2076 |
| 623 | Ga0495581_0003776 | 3300047315 | Bacteria | 8716 |
| 624 | Ga0495581_0007097 | 3300047315 | Bacteria | 6486 |
| 625 | Ga0495581_0022651 | 3300047315 | Bacteria | 3639 |
| 626 | Ga0495581_0029920 | 3300047315 | Bacteria | 3157 |
| 627 | Ga0495604_0000066 | 3300047317 | Bacteria | 90720 |
| 628 | Ga0495604_0002783 | 3300047317 | Bacteria | 14023 |
| 629 | Ga0495604_0020454 | 3300047317 | Bacteria | 5286 |
| 630 | Ga0495604_0032785 | 3300047317 | Bacteria | 4114 |
| 631 | Ga0495604_0040156 | 3300047317 | Bacteria | 3675 |
| 632 | Ga0495604_0044509 | 3300047317 | Bacteria | 3467 |
| 633 | Ga0495604_0082313 | 3300047317 | Bacteria | 2407 |
| 634 | Ga0495604_0086276 | 3300047317 | Bacteria | 2340 |
| 635 | Ga0495674_0012509 | 3300047319 | Bacteria | 7994 |
| 636 | Ga0495674_0023928 | 3300047319 | Bacteria | 5621 |
| 637 | Ga0495674_0029443 | 3300047319 | Bacteria | 5000 |
| 638 | Ga0495674_0233483 | 3300047319 | Bacteria | 1517 |
| 639 | Ga0495676_0155871 | 3300047321 | Bacteria | 1620 |
| 640 | Ga0495680_0000032 | 3300047322 | Bacteria | 108460 |
| 641 | Ga0495680_0016736 | 3300047322 | Bacteria | 6287 |
| 642 | Ga0495680_0044928 | 3300047322 | Bacteria | 3490 |
| 643 | Ga0495680_0045646 | 3300047322 | Bacteria | 3459 |
| 644 | Ga0495680_0053976 | 3300047322 | Bacteria | 3123 |
| 645 | Ga0495680_0151934 | 3300047322 | Bacteria | 1687 |
| 646 | Ga0495675_0002070 | 3300047444 | Bacteria | 11973 |
| 647 | Ga0495675_0008203 | 3300047444 | Bacteria | 6464 |
| 648 | Ga0495675_0018575 | 3300047444 | Bacteria | 4413 |
| 649 | Ga0495675_0044930 | 3300047444 | Bacteria | 2813 |
| 650 | Ga0495675_0098679 | 3300047444 | Bacteria | 1829 |
| 651 | Ga0495675_0127442 | 3300047444 | Bacteria | 1583 |
| 652 | Ga0495684_0004756 | 3300047471 | Bacteria | 10608 |
| 653 | Ga0495684_0028568 | 3300047471 | Bacteria | 4281 |
| 654 | Ga0495684_0073025 | 3300047471 | Bacteria | 2606 |
| 655 | Ga0495593_0032927 | 3300047673 | Bacteria | 2823 |
| 656 | Ga0495593_0086231 | 3300047673 | Bacteria | 1619 |
| 657 | Ga0495602_0000123 | 3300048088 | Bacteria | 72994 |
| 658 | Ga0495602_0048800 | 3300048088 | Bacteria | 3799 |
| 659 | Ga0495602_0103869 | 3300048088 | Bacteria | 2325 |
| 660 | Ga0495602_0164733 | 3300048088 | Bacteria | 1727 |
| 661 | Ga0495602_0318376 | 3300048088 | Bacteria | 1132 |
| 662 | Ga0495614_0022830 | 3300048089 | Bacteria | 2697 |
| 663 | Ga0496100_0033024 | 3300048903 | Bacteria | 3234 |
| 664 | Ga0496100_0204135 | 3300048903 | Bacteria | 1442 |
| 665 | Ga0496101_0539748 | 3300048904 | Bacteria | 922 |
| 666 | Ga0496102_0104616 | 3300048905 | Bacteria | 2633 |
| 667 | Ga0496102_0111292 | 3300048905 | Bacteria | 2553 |
| 668 | Ga0496102_0185165 | 3300048905 | Bacteria | 1962 |
| 669 | Ga0496104_0000379 | 3300048907 | Bacteria | 39343 |
| 670 | Ga0496104_0004919 | 3300048907 | Bacteria | 11654 |
| 671 | Ga0496104_0187602 | 3300048907 | Bacteria | 1978 |
| 672 | Ga0496104_0360413 | 3300048907 | Bacteria | 1366 |
| 673 | Ga0496105_0001710 | 3300048908 | Bacteria | 15668 |
| 674 | Ga0496105_0024550 | 3300048908 | Bacteria | 4898 |
| 675 | Ga0496105_0088830 | 3300048908 | Bacteria | 2553 |
| 676 | Ga0496105_0106487 | 3300048908 | Bacteria | 2315 |
| 677 | Ga0496105_0234497 | 3300048908 | Bacteria | 1490 |
| 678 | Ga0496107_0053301 | 3300048910 | Bacteria | 2918 |
| 679 | Ga0496107_0346361 | 3300048910 | Bacteria | 1106 |
| 680 | Ga0496108_0009245 | 3300048911 | Bacteria | 7974 |
| 681 | Ga0496108_0009877 | 3300048911 | Bacteria | 7735 |
| 682 | Ga0496108_0048946 | 3300048911 | Bacteria | 3534 |
| 683 | Ga0496109_0012280 | 3300048912 | Bacteria | 7394 |
| 684 | Ga0496109_0118527 | 3300048912 | Bacteria | 2464 |
| 685 | Ga0496109_0181316 | 3300048912 | Bacteria | 1978 |
| 686 | Ga0496110_0246974 | 3300048913 | Bacteria | 1624 |
| 687 | Ga0496111_0013190 | 3300048914 | Bacteria | 5620 |
| 688 | Ga0496111_0056704 | 3300048914 | Bacteria | 2835 |
| 689 | Ga0496112_0001030 | 3300048915 | Bacteria | 20510 |
| 690 | Ga0496112_0053785 | 3300048915 | Bacteria | 3955 |
| 691 | Ga0496113_0015665 | 3300048916 | Bacteria | 5220 |
| 692 | Ga0496113_0016320 | 3300048916 | Bacteria | 5127 |
| 693 | Ga0496113_0074800 | 3300048916 | Bacteria | 2583 |
| 694 | Ga0496113_0269712 | 3300048916 | Bacteria | 1360 |
| 695 | Ga0496114_0042203 | 3300048917 | Bacteria | 3780 |
| 696 | Ga0496114_0108079 | 3300048917 | Bacteria | 2381 |
| 697 | Ga0496114_0302122 | 3300048917 | Bacteria | 1413 |
| 698 | Ga0496115_0030215 | 3300048918 | Bacteria | 4261 |
| 699 | Ga0496115_0062786 | 3300048918 | Bacteria | 2997 |
| 700 | Ga0496115_0155481 | 3300048918 | Bacteria | 1889 |
| 701 | Ga0496115_0350505 | 3300048918 | Bacteria | 1204 |
| 702 | Ga0496126_0048297 | 3300048929 | Bacteria | 3891 |
| 703 | Ga0496126_0117897 | 3300048929 | Bacteria | 2305 |
| 704 | Ga0496126_0135611 | 3300048929 | Bacteria | 2124 |
| 705 | Ga0501031_0024616 | 3300049568 | Bacteria | 3924 |
| 706 | Ga0501032_0150078 | 3300049569 | Bacteria | 1533 |
| 707 | Ga0501036_0058097 | 3300049572 | Bacteria | 3277 |
| 708 | Ga0501038_0101412 | 3300049574 | Bacteria | 2396 |
| 709 | Ga0501039_0034025 | 3300049575 | Bacteria | 3932 |
| 710 | Ga0501042_0139358 | 3300049578 | Bacteria | 1748 |
| 711 | Ga0501047_0079113 | 3300049581 | Bacteria | 3161 |
| 712 | Ga0501047_0450673 | 3300049581 | Bacteria | 1116 |
| 713 | Ga0501068_0078793 | 3300049584 | Bacteria | 2020 |
| 714 | Ga0501070_0002103 | 3300049586 | Bacteria | 17480 |
| 715 | Ga0501071_0021797 | 3300049587 | Bacteria | 4465 |
| 716 | Ga0501072_0141140 | 3300049588 | Bacteria | 1921 |
| 717 | Ga0501074_0013736 | 3300049590 | Bacteria | 5887 |
| 718 | Ga0501074_0277423 | 3300049590 | Bacteria | 1192 |
| 719 | Ga0501077_0148621 | 3300049593 | Bacteria | 1487 |
| 720 | Ga0501080_0190330 | 3300049742 | Bacteria | 1886 |
| 721 | Ga0501081_0013383 | 3300049743 | Bacteria | 5397 |
| 722 | Ga0501035_0184389 | 3300049822 | Bacteria | 1797 |
| 723 | Ga0501044_0117468 | 3300049823 | Bacteria | 2664 |
| 724 | Ga0501044_0538536 | 3300049823 | Bacteria | 1066 |
| 725 | Ga0501045_0006807 | 3300049824 | Bacteria | 7919 |
| 726 | nmdc:mga00v17_1767_c1 | 3300050491 | Bacteria | 11217 |
| 727 | nmdc:mga0yw44_1189_c1 | 3300050492 | Bacteria | 10170 |
| 728 | nmdc:mga0yw44_18924_c1 | 3300050492 | Bacteria | 3785 |
| 729 | nmdc:mga05p37_27041_c1 | 3300050507 | Bacteria | 6983 |
| 730 | nmdc:mga06r32_7057_c1 | 3300050510 | Bacteria | 10105 |
| 731 | nmdc:mga0n895_30395_c1 | 3300050512 | Bacteria | 5163 |
| 732 | nmdc:mga0n895_45760_c1 | 3300050512 | Bacteria | 4272 |
| 733 | nmdc:mga0n895_5223_c1 | 3300050512 | Bacteria | 10818 |
| 734 | nmdc:mga0n895_71088_c1 | 3300050512 | Bacteria | 3450 |
| 735 | nmdc:mga0rr50_210270_c1 | 3300050513 | Bacteria | 1602 |
| 736 | nmdc:mga0rr50_27751_c1 | 3300050513 | Bacteria | 3970 |
| 737 | nmdc:mga0rr50_4148_c1 | 3300050513 | Bacteria | 8474 |
| 738 | nmdc:mga08x19_401264_c1 | 3300050514 | Bacteria | 962 |
| 739 | nmdc:mga08x19_60940_c1 | 3300050514 | Bacteria | 2445 |
| 740 | nmdc:mga08x19_91807_c1 | 3300050514 | Bacteria | 2005 |
| 741 | nmdc:mga0a205_184685_c1 | 3300050515 | Bacteria | 1979 |
| 742 | nmdc:mga0a205_97010_c1 | 3300050515 | Bacteria | 2847 |
| 743 | Ga0495601_0001760 | 3300053077 | Bacteria | 11992 |
| 744 | Ga0495601_0044321 | 3300053077 | Bacteria | 2796 |
| 745 | Ga0495601_0121104 | 3300053077 | Bacteria | 1699 |
| 746 | Ga0495601_0146427 | 3300053077 | Bacteria | 1541 |
| 747 | Ga0495601_0157010 | 3300053077 | Bacteria | 1485 |
| 748 | Ga0495612_0010669 | 3300053078 | Bacteria | 3712 |
| 749 | Ga0495612_0012739 | 3300053078 | Bacteria | 3390 |
| 750 | Ga0495612_0041530 | 3300053078 | Bacteria | 1876 |
| 751 | Ga0495595_0001793 | 3300053084 | Bacteria | 8369 |
| 752 | Ga0495595_0005217 | 3300053084 | Bacteria | 5248 |
| 753 | Ga0495595_0013448 | 3300053084 | Bacteria | 3457 |
| 754 | Ga0495595_0018784 | 3300053084 | Bacteria | 2991 |
| 755 | Ga0495595_0209474 | 3300053084 | Bacteria | 971 |
| 756 | Ga0495619_0015572 | 3300053085 | Bacteria | 4811 |
| 757 | Ga0495619_0025375 | 3300053085 | Bacteria | 3806 |
| 758 | Ga0495619_0067693 | 3300053085 | Bacteria | 2385 |
| 759 | Ga0495619_0075396 | 3300053085 | Bacteria | 2263 |
| 760 | Ga0495619_0249611 | 3300053085 | Bacteria | 1229 |
| 761 | Ga0500559_0002810 | 3300053136 | Bacteria | 8796 |
| 762 | Ga0501084_0011073 | 3300054114 | Bacteria | 7468 |
| 763 | Ga0501082_0019246 | 3300060353 | Bacteria | 5885 |
| 764 | Ga0466962_0001198 | 3300061719 | Bacteria | 11914 |
| 765 | Ga0466962_0007312 | 3300061719 | Bacteria | 5298 |
| 766 | Ga0466962_0011153 | 3300061719 | Bacteria | 4326 |
| 767 | Ga0466962_0118110 | 3300061719 | Bacteria | 1279 |
| 768 | 2515853667 | 2515154155 | Bacteria | 7985436 |
| 769 | 2644013682 | 2643221601 | Bacteria | 7493239 |
| 770 | 2644178688 | 2643221631 | Bacteria | 8168043 |
| 771 | 2676493498 | 2675903060 | Bacteria | 10051191 |
| 772 | 2776375648 | 2775506925 | Bacteria | 7237746 |
| 773 | 2858905149 | 2858902515 | Bacteria | 7086037 |
| 774 | 2863075363 | 2863067949 | Bacteria | 8541735 |
| 775 | 2866556273 | 2866552031 | Bacteria | 5824618 |
| 776 | 2867305582 | 2867302475 | Bacteria | 7087181 |
| 777 | 2867315171 | 2867312974 | Bacteria | 7058875 |
| 778 | 2867319832 | 2867319477 | Bacteria | 7069771 |
| 779 | 2884700922 | 2884693830 | Bacteria | 11273186 |
| 780 | 2895452361 | 2895442618 | Bacteria | 11027144 |
| 781 | 8056214688 | 8056207758 | Bacteria | 8639239 |
| 782 | Ga0111539_10051982 | |||
| 783 | JGI25404J52841_10007759 | |||
| 784 | Ga0070658_10014140 | |||
| 785 | Ga0070683_100396751 | |||
| 786 | Ga0070680_100014068 | |||
| 787 | Ga0068868_100025811 | |||
| 788 | Ga0068868_100176793 | |||
| 789 | Ga0070668_100062297 | |||
| 790 | Ga0070671_100020417 | |||
| 791 | Ga0070671_100135284 | |||
| 792 | Ga0070667_100033039 | |||
| 793 | Ga0070709_10000846 | |||
| 794 | Ga0070709_10001146 | |||
| 795 | Ga0070709_10071050 | |||
| 796 | Ga0070714_100000680 | |||
| 797 | Ga0070714_100000967 | |||
| 798 | Ga0070714_100002468 | |||
| 799 | Ga0070714_100006510 | |||
| 800 | Ga0070714_100063139 | |||
| 801 | Ga0070714_100065781 | |||
| 802 | Ga0070714_100068213 | |||
| 803 | Ga0070714_100352023 | |||
| 804 | Ga0070713_100002759 | |||
| 805 | Ga0070713_100003558 | |||
| 806 | Ga0070713_100007719 | |||
| 807 | Ga0070713_100059108 | |||
| 808 | Ga0070713_100074843 | |||
| 809 | Ga0070713_100117854 | |||
| 810 | Ga0070713_100309369 | |||
| 811 | Ga0070713_100325893 | |||
| 812 | Ga0070710_10000786 | |||
| 813 | Ga0070710_10006951 | |||
| 814 | Ga0070710_10010322 | |||
| 815 | Ga0070710_10036905 | |||
| 816 | Ga0070710_10139912 | |||
| 817 | Ga0070711_100002833 | |||
| 818 | Ga0070711_100068317 | |||
| 819 | Ga0070711_100399364 | |||
| 820 | Ga0070700_100008976 | |||
| 821 | Ga0070694_100073680 | |||
| 822 | Ga0070708_100000801 | |||
| 823 | Ga0070708_100017959 | |||
| 824 | Ga0070708_100037712 | |||
| 825 | Ga0070708_100083232 | |||
| 826 | Ga0070678_100474945 | |||
| 827 | Ga0070681_10487812 | |||
| 828 | Ga0070685_10010124 | |||
| 829 | Ga0070706_100000779 | |||
| 830 | Ga0070706_100003302 | |||
| 831 | Ga0070706_100003775 | |||
| 832 | Ga0070706_100005289 | |||
| 833 | Ga0070706_100035482 | |||
| 834 | Ga0070706_100036347 | |||
| 835 | Ga0070706_100048054 | |||
| 836 | Ga0070706_100061535 | |||
| 837 | Ga0070706_100433314 | |||
| 838 | Ga0070707_100000067 | |||
| 839 | Ga0070707_100004574 | |||
| 840 | Ga0070707_100019164 | |||
| 841 | Ga0070707_100021934 | |||
| 842 | Ga0070707_100040639 | |||
| 843 | Ga0070707_100153190 | |||
| 844 | Ga0070707_100179386 | |||
| 845 | Ga0070698_100001287 | |||
| 846 | Ga0070698_100002969 | |||
| 847 | Ga0070698_100007877 | |||
| 848 | Ga0070698_100007905 | |||
| 849 | Ga0070698_100020002 | |||
| 850 | Ga0070698_100028892 | |||
| 851 | Ga0070698_100035229 | |||
| 852 | Ga0070698_100057159 | |||
| 853 | Ga0070698_100057703 | |||
| 854 | Ga0070698_100068774 | |||
| 855 | Ga0070698_100653052 | |||
| 856 | Ga0070699_100013538 | |||
| 857 | Ga0070699_100481654 | |||
| 858 | Ga0070679_100081144 | |||
| 859 | Ga0070679_100122222 | |||
| 860 | Ga0070679_100152982 | |||
| 861 | Ga0070684_100093447 | |||
| 862 | Ga0070697_100269566 | |||
| 863 | Ga0068853_100007584 | |||
| 864 | Ga0068853_100167975 | |||
| 865 | Ga0070695_100223817 | |||
| 866 | Ga0070693_100015994 | |||
| 867 | Ga0070693_100033072 | |||
| 868 | Ga0070665_100053599 | |||
| 869 | Ga0068855_100012767 | |||
| 870 | Ga0068855_100045657 | |||
| 871 | Ga0068855_100054301 | |||
| 872 | Ga0068855_100206370 | |||
| 873 | Ga0068855_100399599 | |||
| 874 | Ga0070664_100106766 | |||
| 875 | Ga0068856_100016798 | |||
| 876 | Ga0068856_100022991 | |||
| 877 | Ga0068856_100025102 | |||
| 878 | Ga0068856_100126309 | |||
| 879 | Ga0068856_100292083 | |||
| 880 | Ga0068852_100008353 | |||
| 881 | Ga0068852_100185320 | |||
| 882 | Ga0068852_100228226 | |||
| 883 | Ga0068859_100111186 | |||
| 884 | Ga0068863_100108061 | |||
| 885 | Ga0068863_100144067 | |||
| 886 | Ga0068858_100123178 | |||
| 887 | Ga0068858_100130133 | |||
| 888 | Ga0068860_100357996 | |||
| 889 | Ga0081455_10141817 | |||
| 890 | Ga0081538_10009795 | |||
| 891 | Ga0081540_1000151 | |||
| 892 | Ga0081540_1004184 | |||
| 893 | Ga0070717_10002789 | |||
| 894 | Ga0070717_10003201 | |||
| 895 | Ga0070717_10028805 | |||
| 896 | Ga0070717_10033037 | |||
| 897 | Ga0070717_10035331 | |||
| 898 | Ga0070717_10067096 | |||
| 899 | Ga0070717_10115359 | |||
| 900 | Ga0070717_10194446 | |||
| 901 | Ga0070717_10314549 | |||
| 902 | Ga0070717_10459331 | |||
| 903 | Ga0070717_10556206 | |||
| 904 | Ga0075365_10000573 | |||
| 905 | Ga0075365_10007506 | |||
| 906 | Ga0075365_10008296 | |||
| 907 | Ga0075364_10001415 | |||
| 908 | Ga0075432_10010142 | |||
| 909 | Ga0070716_100001145 | |||
| 910 | Ga0070716_100001372 | |||
| 911 | Ga0070716_100001418 | |||
| 912 | Ga0070716_100008860 | |||
| 913 | Ga0070712_100001789 | |||
| 914 | Ga0070712_100068021 | |||
| 915 | Ga0075431_100001328 | |||
| 916 | Ga0075433_10016095 | |||
| 917 | Ga0075433_10041192 | |||
| 918 | Ga0075434_100004072 | |||
| 919 | Ga0075434_100081059 | |||
| 920 | Ga0075436_100005017 | |||
| 921 | Ga0075436_100013955 | |||
| 922 | Ga0097620_100111187 | |||
| 923 | Ga0075435_100074305 | |||
| 924 | Ga0105251_10013349 | |||
| 925 | Ga0105240_10010339 | |||
| 926 | Ga0105240_10015062 | |||
| 927 | Ga0105240_10021422 | |||
| 928 | Ga0105240_10408674 | |||
| 929 | Ga0105245_10054248 | |||
| 930 | Ga0105247_10306771 | |||
| 931 | Ga0114129_10006397 | |||
| 932 | Ga0114129_10610108 | |||
| 933 | Ga0105243_10169736 | |||
| 934 | Ga0105241_10015679 | |||
| 935 | Ga0105248_10019553 | |||
| 936 | Ga0105237_10017726 | |||
| 937 | Ga0105237_10045676 | |||
| 938 | Ga0105237_10097058 | |||
| 939 | Ga0105238_10006171 | |||
| 940 | Ga0105239_10060098 | |||
| 941 | Ga0105239_10126944 | |||
| 942 | Ga0157373_10063429 | |||
| 943 | Ga0157370_10038212 | |||
| 944 | Ga0157369_10329125 | |||
| 945 | Ga0157374_10098488 | |||
| 946 | Ga0157378_10521833 | |||
| 947 | Ga0163162_10175704 | |||
| 948 | Ga0163162_10709475 | |||
| 949 | Ga0157372_10175587 | |||
| 950 | Ga0157372_10205004 | |||
| 951 | Ga0157372_10646259 | |||
| 952 | Ga0163163_10046257 | |||
| 953 | Ga0157380_10115671 | |||
| 954 | Ga0157377_10087858 | |||
| 955 | Ga0157377_10118865 | |||
| 956 | Ga0157379_10004765 | |||
| 957 | Ga0157376_10147212 | |||
| 958 | Ga0197907_10719170 | |||
| 959 | Ga0206351_10585209 | |||
| 960 | Ga0206350_11655236 | |||
| 961 | Ga0206354_10266512 | |||
| 962 | Ga0206353_10260620 | |||
| 963 | Ga0206353_11011084 | |||
| 964 | Ga0206353_11174394 | |||
| 965 | Ga0206353_11852117 | |||
| 966 | Ga0213875_10000727 | |||
| 967 | Ga0213875_10002626 | |||
| 968 | Ga0213875_10002831 | |||
| 969 | Ga0224712_10008460 | |||
| 970 | Ga0224712_10029241 | |||
| 971 | Ga0224712_10152197 | |||
| 972 | Ga0224572_1001159 | |||
| 973 | Ga0207653_10014578 | |||
| 974 | Ga0207692_10009667 | |||
| 975 | Ga0207692_10019711 | |||
| 976 | Ga0207692_10019993 | |||
| 977 | Ga0207692_10029847 | |||
| 978 | Ga0207688_10027892 | |||
| 979 | Ga0207680_10145987 | |||
| 980 | Ga0207647_10012340 | |||
| 981 | Ga0207685_10002516 | |||
| 982 | Ga0207685_10016246 | |||
| 983 | Ga0207699_10000904 | |||
| 984 | Ga0207699_10001571 | |||
| 985 | Ga0207699_10005463 | |||
| 986 | Ga0207699_10006375 | |||
| 987 | Ga0207699_10073709 | |||
| 988 | Ga0207699_10283318 | |||
| 989 | Ga0207705_10113196 | |||
| 990 | Ga0207684_10000495 | |||
| 991 | Ga0207684_10000583 | |||
| 992 | Ga0207684_10002613 | |||
| 993 | Ga0207684_10004967 | |||
| 994 | Ga0207684_10030266 | |||
| 995 | Ga0207684_10041676 | |||
| 996 | Ga0207684_10197617 | |||
| 997 | Ga0207654_10039890 | |||
| 998 | Ga0207695_10002357 | |||
| 999 | Ga0207695_10277209 | |||
| 1000 | Ga0207671_10001397 | |||
| 1001 | Ga0207671_10074475 | |||
| 1002 | Ga0207693_10013039 | |||
| 1003 | Ga0207693_10049143 | |||
| 1004 | Ga0207693_10150269 | |||
| 1005 | Ga0207663_10022656 | |||
| 1006 | Ga0207663_10054137 | |||
| 1007 | Ga0207663_10094820 | |||
| 1008 | Ga0207662_10062535 | |||
| 1009 | Ga0207646_10000218 | |||
| 1010 | Ga0207646_10005205 | |||
| 1011 | Ga0207646_10013662 | |||
| 1012 | Ga0207646_10053323 | |||
| 1013 | Ga0207646_10061311 | |||
| 1014 | Ga0207646_10279995 | |||
| 1015 | Ga0207694_10004697 | |||
| 1016 | Ga0207694_10395645 | |||
| 1017 | Ga0207687_10144750 | |||
| 1018 | Ga0207687_10230112 | |||
| 1019 | Ga0207700_10002040 | |||
| 1020 | Ga0207700_10003217 | |||
| 1021 | Ga0207700_10016328 | |||
| 1022 | Ga0207700_10024036 | |||
| 1023 | Ga0207700_10026370 | |||
| 1024 | Ga0207700_10029235 | |||
| 1025 | Ga0207700_10062006 | |||
| 1026 | Ga0207700_10075072 | |||
| 1027 | Ga0207700_10075986 | |||
| 1028 | Ga0207700_10144849 | |||
| 1029 | Ga0207700_10162277 | |||
| 1030 | Ga0207700_10244932 | |||
| 1031 | Ga0207664_10000917 | |||
| 1032 | Ga0207664_10001098 | |||
| 1033 | Ga0207664_10002635 | |||
| 1034 | Ga0207664_10014360 | |||
| 1035 | Ga0207664_10025437 | |||
| 1036 | Ga0207664_10029061 | |||
| 1037 | Ga0207664_10040906 | |||
| 1038 | Ga0207664_10193654 | |||
| 1039 | Ga0207664_10235424 | |||
| 1040 | Ga0207690_10092706 | |||
| 1041 | Ga0207706_10029288 | |||
| 1042 | Ga0207665_10000929 | |||
| 1043 | Ga0207665_10003086 | |||
| 1044 | Ga0207665_10011381 | |||
| 1045 | Ga0207665_10024581 | |||
| 1046 | Ga0207665_10093557 | |||
| 1047 | Ga0207665_10149773 | |||
| 1048 | Ga0207711_10220352 | |||
| 1049 | Ga0207661_10302644 | |||
| 1050 | Ga0207661_10400168 | |||
| 1051 | Ga0207667_10045382 | |||
| 1052 | Ga0207667_10045791 | |||
| 1053 | Ga0207667_10133675 | |||
| 1054 | Ga0207667_10171299 | |||
| 1055 | Ga0207651_10012268 | |||
| 1056 | Ga0207658_10009700 | |||
| 1057 | Ga0207677_10053667 | |||
| 1058 | Ga0207639_10117689 | |||
| 1059 | Ga0207639_10346057 | |||
| 1060 | Ga0207639_10400805 | |||
| 1061 | Ga0207708_10004677 | |||
| 1062 | Ga0207702_10018132 | |||
| 1063 | Ga0207702_10020203 | |||
| 1064 | Ga0207702_10090947 | |||
| 1065 | Ga0207641_10108595 | |||
| 1066 | Ga0207641_10298719 | |||
| 1067 | Ga0207648_10032598 | |||
| 1068 | Ga0207674_10008612 | |||
| 1069 | Ga0207674_10021672 | |||
| 1070 | Ga0207683_10004533 | |||
| 1071 | Ga0207683_10396898 | |||
| 1072 | Ga0207698_10010512 | |||
| 1073 | Ga0207428_10106536 | |||
| 1074 | Ga0207428_10194181 | |||
| 1075 | Ga0224573_1002340 | |||
| 1076 | Ga0268266_10128323 | |||
| 1077 | Ga0268266_10245363 | |||
| 1078 | Ga0265336_10012382 | |||
| 1079 | Ga0265338_10000596 | |||
| 1080 | Ga0265338_10013006 | |||
| 1081 | Ga0265338_10021849 | |||
| 1082 | Ga0307511_10005760 | |||
| 1083 | Ga0316214_1008859 | |||
| 1084 | Ga0316212_1000295 | |||
| 1085 | Ga0373930_0004804 | |||
| 1086 | Ga0373959_0001601 | |||
| 1087 | Ga0373938_0001754 | |||
| 1088 | Ga0373926_0000360 | |||
| 1089 | Ga0373926_0009093 | |||
| 1090 | Ga0373928_0007408 | |||
| 1091 | Ga0373929_0027698 | |||
| 1092 | Ga0373934_0000053 | |||
| 1093 | Ga0373934_0003111 | |||
| 1094 | Ga0373934_0004117 | |||
| 1095 | Ga0373934_0006190 | |||
| 1096 | Ga0373940_0007390 | |||
| 1097 | Ga0373940_0015568 | |||
| 1098 | Ga0373949_0021630 | |||
| 1099 | Ga0373923_0005578 | |||
| 1100 | Ga0373923_0024932 | |||
| 1101 | Ga0373923_0052137 | |||
| 1102 | Ga0373932_0007803 | |||
| 1103 | Ga0373936_0001318 | |||
| 1104 | Ga0373936_0003379 | |||
| 1105 | Ga0373936_0037333 | |||
| 1106 | Ga0373945_0049795 | |||
| 1107 | Ga0373945_0052798 | |||
| 1108 | Ga0373953_0000470 | |||
| 1109 | Ga0373953_0000922 | |||
| 1110 | Ga0373953_0057436 | |||
| 1111 | Ga0373954_0001494 | |||
| 1112 | Ga0373954_0004958 | |||
| 1113 | Ga0373954_0016080 | |||
| 1114 | Ga0373954_0025010 | |||
| 1115 | Ga0373954_0056743 | |||
| 1116 | Ga0373956_0000325 | |||
| 1117 | Ga0373956_0002679 | |||
| 1118 | Ga0373956_0008484 | |||
| 1119 | Ga0373956_0017199 | |||
| 1120 | Ga0373956_0044279 | |||
| 1121 | Ga0373956_0071291 | |||
| 1122 | Ga0373957_0000015 | |||
| 1123 | Ga0373957_0006637 | |||
| 1124 | Ga0373957_0012535 | |||
| 1125 | Ga0373957_0034793 | |||
| 1126 | Ga0373957_0065944 | |||
| 1127 | Ga0373943_0017785 | |||
| 1128 | Ga0373943_0123384 | |||
| 1129 | Ga0373946_0056033 | |||
| 1130 | Ga0373946_0060405 | |||
| 1131 | Ga0373955_0000027 | |||
| 1132 | Ga0373955_0030168 | |||
| 1133 | Ga0373955_0037534 | |||
| 1134 | Ga0373942_0004774 | |||
| 1135 | Ga0373942_0025455 | |||
| 1136 | Ga0373924_0000084 | |||
| 1137 | Ga0373924_0001744 | |||
| 1138 | Ga0373924_0023060 | |||
| 1139 | Ga0373924_0029926 | |||
| 1140 | Ga0373924_0031872 | |||
| 1141 | Ga0373931_0013691 | |||
| 1142 | Ga0373931_0020631 | |||
| 1143 | Ga0373935_0004908 | |||
| 1144 | Ga0373935_0014258 | |||
| 1145 | Ga0373935_0038520 | |||
| 1146 | Ga0373935_0107610 | |||
| 1147 | Ga0373927_0018009 | |||
| 1148 | Ga0373927_0098327 | |||
| 1149 | Ga0373933_0000025 | |||
| 1150 | Ga0373933_0001053 | |||
| 1151 | Ga0373933_0014139 | |||
| 1152 | Ga0373933_0029824 | |||
| 1153 | Ga0373933_0107677 | |||
| 1154 | Ga0373947_0000004 | |||
| 1155 | Ga0373947_0003675 | |||
| 1156 | Ga0373947_0041997 | |||
| 1157 | Ga0373947_0070828 | |||
| 1158 | Ga0373947_0118990 | |||
| 1159 | Ga0373937_0000034 | |||
| 1160 | Ga0373937_0017863 | |||
| 1161 | Ga0373937_0031788 | |||
| 1162 | Ga0373937_0078785 | |||
| 1163 | Ga0373937_0119114 | |||
| 1164 | Ga0373937_0211451 | |||
| 1165 | Ga0373925_0000633 | |||
| 1166 | Ga0373925_0005928 | |||
| 1167 | Ga0373925_0012048 | |||
| 1168 | Ga0373925_0078600 | |||
| 1169 | Ga0373925_0117143 | |||
| 1170 | Ga0373925_0256175 | |||
| 1171 | Ga0373925_0291000 | |||
| 1172 | Ga0373925_0323849 | |||
| 1173 | Ga0395900_0004392 | |||
| 1174 | Ga0395900_0495872 | |||
| 1175 | Ga0395898_0001996 | |||
| 1176 | Ga0395898_0035783 | |||
| 1177 | Ga0395898_0434990 | |||
| 1178 | Ga0436364_0395778 | |||
| 1179 | Ga0436364_0502444 | |||
| 1180 | Ga0436364_0720930 | |||
| 1181 | Ga0436364_1069913 | |||
| 1182 | Ga0395901_0009204 | |||
| 1183 | Ga0395901_0021767 | |||
| 1184 | Ga0395901_0290505 | |||
| 1185 | Ga0395901_0704026 | |||
| 1186 | Ga0436365_1371133 | |||
| 1187 | Ga0436363_0546269 | |||
| 1188 | Ga0436363_1179736 | |||
| 1189 | Ga0436362_1121950 | |||
| 1190 | Ga0466969_0000716 | |||
| 1191 | Ga0466969_0002737 | |||
| 1192 | Ga0466969_0004039 | |||
| 1193 | Ga0466969_0011533 | |||
| 1194 | Ga0466969_0013913 | |||
| 1195 | Ga0466969_0016031 | |||
| 1196 | Ga0466969_0023258 | |||
| 1197 | Ga0466969_0101975 | |||
| 1198 | Ga0466966_0001071 | |||
| 1199 | Ga0466966_0015198 | |||
| 1200 | Ga0466966_0015962 | |||
| 1201 | Ga0466966_0027809 | |||
| 1202 | Ga0466966_0033280 | |||
| 1203 | Ga0466966_0259780 | |||
| 1204 | Ga0466961_0002475 | |||
| 1205 | Ga0466961_0002554 | |||
| 1206 | Ga0466961_0009808 | |||
| 1207 | Ga0466961_0022551 | |||
| 1208 | Ga0466961_0029340 | |||
| 1209 | Ga0466963_0005926 | |||
| 1210 | Ga0466963_0022604 | |||
| 1211 | Ga0466963_0026989 | |||
| 1212 | Ga0466963_0041755 | |||
| 1213 | Ga0466963_0048312 | |||
| 1214 | Ga0466963_0264732 | |||
| 1215 | Ga0466971_0000279 | |||
| 1216 | Ga0466971_0015663 | |||
| 1217 | Ga0466971_0069510 | |||
| 1218 | Ga0466970_0005393 | |||
| 1219 | Ga0466970_0014136 | |||
| 1220 | Ga0466970_0044403 | |||
| 1221 | Ga0466957_0127755 | |||
| 1222 | Ga0466957_0179017 | |||
| 1223 | Ga0466957_0306059 | |||
| 1224 | Ga0466957_0446549 | |||
| 1225 | Ga0466959_0000323 | |||
| 1226 | Ga0466959_0011233 | |||
| 1227 | Ga0466959_0051545 | |||
| 1228 | Ga0466959_0093621 | |||
| 1229 | Ga0466959_0105794 | |||
| 1230 | Ga0466959_0112991 | |||
| 1231 | Ga0466959_0125686 | |||
| 1232 | Ga0466959_0178426 | |||
| 1233 | Ga0466958_0007882 | |||
| 1234 | Ga0466958_0028948 | |||
| 1235 | Ga0466958_0045913 | |||
| 1236 | Ga0466958_0122635 | |||
| 1237 | Ga0466958_0177663 | |||
| 1238 | Ga0466967_0006404 | |||
| 1239 | Ga0466967_0014283 | |||
| 1240 | Ga0466967_0052558 | |||
| 1241 | Ga0466967_0154000 | |||
| 1242 | Ga0466967_0346592 | |||
| 1243 | Ga0495592_0000016 | |||
| 1244 | Ga0495592_0028669 | |||
| 1245 | Ga0495592_0103575 | |||
| 1246 | Ga0495592_0152684 | |||
| 1247 | Ga0495592_0219309 | |||
| 1248 | Ga0495603_0017302 | |||
| 1249 | Ga0495603_0157927 | |||
| 1250 | Ga0495629_0026762 | |||
| 1251 | Ga0495629_0069170 | |||
| 1252 | Ga0495629_0162511 | |||
| 1253 | Ga0495641_0006309 | |||
| 1254 | Ga0495641_0073405 | |||
| 1255 | Ga0495641_0096350 | |||
| 1256 | Ga0495651_0000005 | |||
| 1257 | Ga0495651_0002725 | |||
| 1258 | Ga0495651_0018456 | |||
| 1259 | Ga0495651_0032212 | |||
| 1260 | Ga0495651_0034619 | |||
| 1261 | Ga0495651_0060989 | |||
| 1262 | Ga0495651_0062117 | |||
| 1263 | Ga0495651_0137149 | |||
| 1264 | Ga0495653_0001819 | |||
| 1265 | Ga0495653_0003475 | |||
| 1266 | Ga0495653_0004816 | |||
| 1267 | Ga0495653_0018528 | |||
| 1268 | Ga0495653_0056120 | |||
| 1269 | Ga0495653_0062414 | |||
| 1270 | Ga0495653_0130009 | |||
| 1271 | Ga0495580_0044986 | |||
| 1272 | Ga0495582_0302278 | |||
| 1273 | Ga0495639_0003094 | |||
| 1274 | Ga0495639_0185139 | |||
| 1275 | Ga0495662_0002423 | |||
| 1276 | Ga0495662_0005000 | |||
| 1277 | Ga0495662_0020528 | |||
| 1278 | Ga0495662_0083121 | |||
| 1279 | Ga0495662_0124415 | |||
| 1280 | Ga0495662_0127889 | |||
| 1281 | Ga0495662_0128724 | |||
| 1282 | Ga0495664_0003347 | |||
| 1283 | Ga0495664_0101384 | |||
| 1284 | Ga0495594_0010188 | |||
| 1285 | Ga0495608_0000057 | |||
| 1286 | Ga0495608_0004720 | |||
| 1287 | Ga0495608_0093057 | |||
| 1288 | Ga0495608_0095084 | |||
| 1289 | Ga0495608_0199116 | |||
| 1290 | Ga0495618_0005229 | |||
| 1291 | Ga0495618_0019880 | |||
| 1292 | Ga0495618_0024487 | |||
| 1293 | Ga0495618_0060552 | |||
| 1294 | Ga0495618_0171261 | |||
| 1295 | Ga0495618_0291408 | |||
| 1296 | Ga0495628_0000073 | |||
| 1297 | Ga0495628_0020075 | |||
| 1298 | Ga0495628_0030499 | |||
| 1299 | Ga0495628_0054874 | |||
| 1300 | Ga0495628_0069465 | |||
| 1301 | Ga0495628_0070281 | |||
| 1302 | Ga0495628_0095207 | |||
| 1303 | Ga0495628_0153273 | |||
| 1304 | Ga0495628_0165988 | |||
| 1305 | Ga0495630_0006137 | |||
| 1306 | Ga0495630_0012698 | |||
| 1307 | Ga0495630_0026937 | |||
| 1308 | Ga0495630_0065249 | |||
| 1309 | Ga0495630_0096862 | |||
| 1310 | Ga0495666_0007862 | |||
| 1311 | Ga0495666_0029653 | |||
| 1312 | Ga0495652_0000054 | |||
| 1313 | Ga0495652_0013125 | |||
| 1314 | Ga0495652_0028852 | |||
| 1315 | Ga0495652_0053930 | |||
| 1316 | Ga0495652_0073249 | |||
| 1317 | Ga0495652_0150728 | |||
| 1318 | Ga0495652_0183454 | |||
| 1319 | Ga0495665_0001784 | |||
| 1320 | Ga0495665_0032541 | |||
| 1321 | Ga0495640_0002155 | |||
| 1322 | Ga0495640_0015646 | |||
| 1323 | Ga0495640_0017648 | |||
| 1324 | Ga0495640_0032728 | |||
| 1325 | Ga0495640_0054912 | |||
| 1326 | Ga0495640_0059198 | |||
| 1327 | Ga0495586_0004834 | |||
| 1328 | Ga0495586_0016074 | |||
| 1329 | Ga0495586_0062049 | |||
| 1330 | Ga0495587_0000030 | |||
| 1331 | Ga0495587_0002096 | |||
| 1332 | Ga0495587_0011063 | |||
| 1333 | Ga0495587_0012367 | |||
| 1334 | Ga0495587_0015899 | |||
| 1335 | Ga0495587_0037061 | |||
| 1336 | Ga0495587_0118019 | |||
| 1337 | Ga0495587_0137543 | |||
| 1338 | Ga0495645_0004436 | |||
| 1339 | Ga0495645_0020221 | |||
| 1340 | Ga0495645_0054817 | |||
| 1341 | Ga0495645_0054985 | |||
| 1342 | Ga0495645_0058308 | |||
| 1343 | Ga0495645_0138449 | |||
| 1344 | Ga0495667_0000025 | |||
| 1345 | Ga0495667_0000230 | |||
| 1346 | Ga0495667_0010842 | |||
| 1347 | Ga0495667_0012533 | |||
| 1348 | Ga0495667_0026825 | |||
| 1349 | Ga0495667_0038051 | |||
| 1350 | Ga0495634_0006362 | |||
| 1351 | Ga0495634_0006938 | |||
| 1352 | Ga0495634_0027503 | |||
| 1353 | Ga0495634_0194102 | |||
| 1354 | Ga0495635_0058552 | |||
| 1355 | Ga0495635_0110963 | |||
| 1356 | Ga0495588_0005223 | |||
| 1357 | Ga0495588_0047894 | |||
| 1358 | Ga0495588_0169723 | |||
| 1359 | Ga0495657_0000018 | |||
| 1360 | Ga0495657_0002245 | |||
| 1361 | Ga0495657_0028746 | |||
| 1362 | Ga0495657_0135380 | |||
| 1363 | Ga0495599_0000054 | |||
| 1364 | Ga0495599_0001992 | |||
| 1365 | Ga0495599_0009175 | |||
| 1366 | Ga0495599_0011205 | |||
| 1367 | Ga0495599_0038224 | |||
| 1368 | Ga0495599_0045245 | |||
| 1369 | Ga0495599_0046066 | |||
| 1370 | Ga0495599_0078273 | |||
| 1371 | Ga0495599_0087832 | |||
| 1372 | Ga0495599_0091250 | |||
| 1373 | Ga0495599_0121283 | |||
| 1374 | Ga0495623_0000582 | |||
| 1375 | Ga0495623_0037451 | |||
| 1376 | Ga0495623_0041325 | |||
| 1377 | Ga0495623_0043777 | |||
| 1378 | Ga0495623_0050666 | |||
| 1379 | Ga0495623_0064058 | |||
| 1380 | Ga0495623_0070626 | |||
| 1381 | Ga0495646_0005148 | |||
| 1382 | Ga0495646_0018708 | |||
| 1383 | Ga0495646_0021048 | |||
| 1384 | Ga0495646_0069054 | |||
| 1385 | Ga0495646_0100245 | |||
| 1386 | Ga0495658_0030547 | |||
| 1387 | Ga0495658_0039770 | |||
| 1388 | Ga0495658_0043315 | |||
| 1389 | Ga0495613_0009885 | |||
| 1390 | Ga0495613_0040579 | |||
| 1391 | Ga0495613_0044720 | |||
| 1392 | Ga0495613_0128322 | |||
| 1393 | Ga0495624_0006425 | |||
| 1394 | Ga0495624_0018189 | |||
| 1395 | Ga0495624_0134739 | |||
| 1396 | Ga0495600_0003068 | |||
| 1397 | Ga0495600_0004322 | |||
| 1398 | Ga0495600_0004754 | |||
| 1399 | Ga0495600_0015851 | |||
| 1400 | Ga0495600_0027319 | |||
| 1401 | Ga0495600_0040818 | |||
| 1402 | Ga0495600_0063499 | |||
| 1403 | Ga0495600_0084115 | |||
| 1404 | Ga0495581_0003776 | |||
| 1405 | Ga0495581_0007097 | |||
| 1406 | Ga0495581_0022651 | |||
| 1407 | Ga0495581_0029920 | |||
| 1408 | Ga0495604_0000066 | |||
| 1409 | Ga0495604_0002783 | |||
| 1410 | Ga0495604_0020454 | |||
| 1411 | Ga0495604_0032785 | |||
| 1412 | Ga0495604_0040156 | |||
| 1413 | Ga0495604_0044509 | |||
| 1414 | Ga0495604_0082313 | |||
| 1415 | Ga0495604_0086276 | |||
| 1416 | Ga0495674_0012509 | |||
| 1417 | Ga0495674_0023928 | |||
| 1418 | Ga0495674_0029443 | |||
| 1419 | Ga0495674_0233483 | |||
| 1420 | Ga0495676_0155871 | |||
| 1421 | Ga0495680_0000032 | |||
| 1422 | Ga0495680_0016736 | |||
| 1423 | Ga0495680_0044928 | |||
| 1424 | Ga0495680_0045646 | |||
| 1425 | Ga0495680_0053976 | |||
| 1426 | Ga0495680_0151934 | |||
| 1427 | Ga0495675_0002070 | |||
| 1428 | Ga0495675_0008203 | |||
| 1429 | Ga0495675_0018575 | |||
| 1430 | Ga0495675_0044930 | |||
| 1431 | Ga0495675_0098679 | |||
| 1432 | Ga0495675_0127442 | |||
| 1433 | Ga0495684_0004756 | |||
| 1434 | Ga0495684_0028568 | |||
| 1435 | Ga0495684_0073025 | |||
| 1436 | Ga0495593_0032927 | |||
| 1437 | Ga0495593_0086231 | |||
| 1438 | Ga0495602_0000123 | |||
| 1439 | Ga0495602_0048800 | |||
| 1440 | Ga0495602_0103869 | |||
| 1441 | Ga0495602_0164733 | |||
| 1442 | Ga0495602_0318376 | |||
| 1443 | Ga0495614_0022830 | |||
| 1444 | Ga0496100_0033024 | |||
| 1445 | Ga0496100_0204135 | |||
| 1446 | Ga0496101_0539748 | |||
| 1447 | Ga0496102_0104616 | |||
| 1448 | Ga0496102_0111292 | |||
| 1449 | Ga0496102_0185165 | |||
| 1450 | Ga0496104_0000379 | |||
| 1451 | Ga0496104_0004919 | |||
| 1452 | Ga0496104_0187602 | |||
| 1453 | Ga0496104_0360413 | |||
| 1454 | Ga0496105_0001710 | |||
| 1455 | Ga0496105_0024550 | |||
| 1456 | Ga0496105_0088830 | |||
| 1457 | Ga0496105_0106487 | |||
| 1458 | Ga0496105_0234497 | |||
| 1459 | Ga0496107_0053301 | |||
| 1460 | Ga0496107_0346361 | |||
| 1461 | Ga0496108_0009245 | |||
| 1462 | Ga0496108_0009877 | |||
| 1463 | Ga0496108_0048946 | |||
| 1464 | Ga0496109_0012280 | |||
| 1465 | Ga0496109_0118527 | |||
| 1466 | Ga0496109_0181316 | |||
| 1467 | Ga0496110_0246974 | |||
| 1468 | Ga0496111_0013190 | |||
| 1469 | Ga0496111_0056704 | |||
| 1470 | Ga0496112_0001030 | |||
| 1471 | Ga0496112_0053785 | |||
| 1472 | Ga0496113_0015665 | |||
| 1473 | Ga0496113_0016320 | |||
| 1474 | Ga0496113_0074800 | |||
| 1475 | Ga0496113_0269712 | |||
| 1476 | Ga0496114_0042203 | |||
| 1477 | Ga0496114_0108079 | |||
| 1478 | Ga0496114_0302122 | |||
| 1479 | Ga0496115_0030215 | |||
| 1480 | Ga0496115_0062786 | |||
| 1481 | Ga0496115_0155481 | |||
| 1482 | Ga0496115_0350505 | |||
| 1483 | Ga0496126_0048297 | |||
| 1484 | Ga0496126_0117897 | |||
| 1485 | Ga0496126_0135611 | |||
| 1486 | Ga0501031_0024616 | |||
| 1487 | Ga0501032_0150078 | |||
| 1488 | Ga0501036_0058097 | |||
| 1489 | Ga0501038_0101412 | |||
| 1490 | Ga0501039_0034025 | |||
| 1491 | Ga0501042_0139358 | |||
| 1492 | Ga0501047_0079113 | |||
| 1493 | Ga0501047_0450673 | |||
| 1494 | Ga0501068_0078793 | |||
| 1495 | Ga0501070_0002103 | |||
| 1496 | Ga0501071_0021797 | |||
| 1497 | Ga0501072_0141140 | |||
| 1498 | Ga0501074_0013736 | |||
| 1499 | Ga0501074_0277423 | |||
| 1500 | Ga0501077_0148621 | |||
| 1501 | Ga0501080_0190330 | |||
| 1502 | Ga0501081_0013383 | |||
| 1503 | Ga0501035_0184389 | |||
| 1504 | Ga0501044_0117468 | |||
| 1505 | Ga0501044_0538536 | |||
| 1506 | Ga0501045_0006807 | |||
| 1507 | nmdc:mga00v17_1767_c1 | |||
| 1508 | nmdc:mga0yw44_1189_c1 | |||
| 1509 | nmdc:mga0yw44_18924_c1 | |||
| 1510 | nmdc:mga05p37_27041_c1 | |||
| 1511 | nmdc:mga06r32_7057_c1 | |||
| 1512 | nmdc:mga0n895_30395_c1 | |||
| 1513 | nmdc:mga0n895_45760_c1 | |||
| 1514 | nmdc:mga0n895_5223_c1 | |||
| 1515 | nmdc:mga0n895_71088_c1 | |||
| 1516 | nmdc:mga0rr50_210270_c1 | |||
| 1517 | nmdc:mga0rr50_27751_c1 | |||
| 1518 | nmdc:mga0rr50_4148_c1 | |||
| 1519 | nmdc:mga08x19_401264_c1 | |||
| 1520 | nmdc:mga08x19_60940_c1 | |||
| 1521 | nmdc:mga08x19_91807_c1 | |||
| 1522 | nmdc:mga0a205_184685_c1 | |||
| 1523 | nmdc:mga0a205_97010_c1 | |||
| 1524 | Ga0495601_0001760 | |||
| 1525 | Ga0495601_0044321 | |||
| 1526 | Ga0495601_0121104 | |||
| 1527 | Ga0495601_0146427 | |||
| 1528 | Ga0495601_0157010 | |||
| 1529 | Ga0495612_0010669 | |||
| 1530 | Ga0495612_0012739 | |||
| 1531 | Ga0495612_0041530 | |||
| 1532 | Ga0495595_0001793 | |||
| 1533 | Ga0495595_0005217 | |||
| 1534 | Ga0495595_0013448 | |||
| 1535 | Ga0495595_0018784 | |||
| 1536 | Ga0495595_0209474 | |||
| 1537 | Ga0495619_0015572 | |||
| 1538 | Ga0495619_0025375 | |||
| 1539 | Ga0495619_0067693 | |||
| 1540 | Ga0495619_0075396 | |||
| 1541 | Ga0495619_0249611 | |||
| 1542 | Ga0500559_0002810 | |||
| 1543 | Ga0501084_0011073 | |||
| 1544 | Ga0501082_0019246 | |||
| 1545 | Ga0466962_0001198 | |||
| 1546 | Ga0466962_0007312 | |||
| 1547 | Ga0466962_0011153 | |||
| 1548 | Ga0466962_0118110 | |||
| 1549 | 2515853667 | |||
| 1550 | 2644013682 | |||
| 1551 | 2644178688 | |||
| 1552 | 2676493498 | |||
| 1553 | 2776375648 | |||
| 1554 | 2858905149 | |||
| 1555 | 2863075363 | |||
| 1556 | 2866556273 | |||
| 1557 | 2867305582 | |||
| 1558 | 2867315171 | |||
| 1559 | 2867319832 | |||
| 1560 | 2884700922 | |||
| 1561 | 2895452361 | |||
| 1562 | 8056214688 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hd1-assembly1.cif.gz_A | crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius | 0.9165 | 3 | 261 |
| 5iys-assembly1.cif.gz_A | crystal structure of a dehydrosqualene synthase in complex with ligand | 0.9078 | 3 | 287 |
| 2zcr-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 | 0.9012 | 3 | 287 |
| 3adz-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp | 0.8859 | 3 | 287 |
| 2zcr-assembly1.cif.gz_A | crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 | 0.8859 | 3 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHP3_1_280_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9351 | 1 | 285 | 1.10.600.10 |
| af_P9WHP3_1_280_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9253 | 1 | 285 | 1.10.600.10 |
| 4hd1A00 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.9142 | 3 | 261 | 1.10.600.10 |
| af_Q330K2_57_309_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.8725 | 7 | 267 | 1.10.600.10 |
| af_A0A0R0HM78_74_346_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.871 | 3 | 281 | 1.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0JYU0-F1-model_v4 | deleted | 0.9737 | 101 | 290 |
|
| AF-A0A7K0JYU0-F1-model_v4 | deleted | 0.9637 | 101 | 290 |
|
| AF-A0A523Z308-F1-model_v4 | Phytoene/squalene synthase family protein | 0.9565 | 105 | 288 |
GO:0016117
GO:0051996 |
| AF-A0A6L7WVL7-F1-model_v4 | Presqualene diphosphate synthase HpnD (EC 2.5.1.103) | 0.9561 | 1 | 287 |
GO:0004311
GO:0016117 GO:0016767 GO:0051996 |
| AF-A0A6L7WVL7-F1-model_v4 | Presqualene diphosphate synthase HpnD (EC 2.5.1.103) | 0.9494 | 1 | 287 |
GO:0004311
GO:0016117 GO:0016767 GO:0051996 |