F480560

General Info

Members Datasets Scaffolds Average Seq Length
781 284 1562 299

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10051982|Ga0111539_100519822
Length 342
Sequence MRPGGEAVDVQAAYRHCEQITWTQARNFSYGIRLLPPAKRQALAAVYAFARRIDDIGDGDLPKPAKLAALADARASVTALGAQRNLPGQNAKPAATDGDLVLVALTDAAGRFDIPLPAFGELIDGCEADVRGTTYRTFDDLLHYCRCVAGSIGRLSLGVFGTADVATAAPLADALGVALQLTNILRDIREDYLSGRIYLPAEDFERFGCSLENGALQKVPEGNGSLPSGHLARAPGDGGNEDKLAALVEFEAQRACTWYARGLTLIPLLDRRSAASAGAMAGIYFRLLQRIAASPRAVLERRMSLSAREKAMVAARSLAVALRPRGAGSLHNGAPVMKGADR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
130 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
272 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
273 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
274 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
275 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
276 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
277 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
278 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
279 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
280 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
281 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
282 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
283 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
284 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 1.41
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 4.99
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10051982 3300009094 Bacteria 4879
2 JGI25404J52841_10007759 3300003659 Bacteria 2275
3 Ga0070658_10014140 3300005327 Bacteria 6407
4 Ga0070683_100396751 3300005329 Bacteria 1316
5 Ga0070680_100014068 3300005336 Bacteria 6248
6 Ga0068868_100025811 3300005338 Bacteria 4473
7 Ga0068868_100176793 3300005338 Bacteria 1769
8 Ga0070668_100062297 3300005347 Bacteria 2889
9 Ga0070671_100020417 3300005355 Bacteria 5403
10 Ga0070671_100135284 3300005355 Bacteria 2078
11 Ga0070667_100033039 3300005367 Bacteria 4320
12 Ga0070709_10000846 3300005434 Bacteria 17122
13 Ga0070709_10001146 3300005434 Bacteria 14602
14 Ga0070709_10071050 3300005434 Bacteria 2246
15 Ga0070714_100000680 3300005435 Bacteria 23985
16 Ga0070714_100000967 3300005435 Bacteria 20523
17 Ga0070714_100002468 3300005435 Bacteria 13646
18 Ga0070714_100006510 3300005435 Bacteria 9029
19 Ga0070714_100063139 3300005435 Bacteria 3184
20 Ga0070714_100065781 3300005435 Bacteria 3123
21 Ga0070714_100068213 3300005435 Bacteria 3068
22 Ga0070714_100352023 3300005435 Bacteria 1383
23 Ga0070713_100002759 3300005436 Bacteria 11483
24 Ga0070713_100003558 3300005436 Bacteria 10292
25 Ga0070713_100007719 3300005436 Bacteria 7572
26 Ga0070713_100059108 3300005436 Bacteria 3200
27 Ga0070713_100074843 3300005436 Bacteria 2870
28 Ga0070713_100117854 3300005436 Bacteria 2324
29 Ga0070713_100309369 3300005436 Bacteria 1457
30 Ga0070713_100325893 3300005436 Bacteria 1420
31 Ga0070710_10000786 3300005437 Bacteria 15197
32 Ga0070710_10006951 3300005437 Bacteria 5458
33 Ga0070710_10010322 3300005437 Bacteria 4586
34 Ga0070710_10036905 3300005437 Bacteria 2674
35 Ga0070710_10139912 3300005437 Bacteria 1483
36 Ga0070711_100002833 3300005439 Bacteria 9961
37 Ga0070711_100068317 3300005439 Bacteria 2497
38 Ga0070711_100399364 3300005439 Bacteria 1115
39 Ga0070700_100008976 3300005441 Bacteria 5473
40 Ga0070694_100073680 3300005444 Bacteria 2359
41 Ga0070708_100000801 3300005445 Bacteria 23743
42 Ga0070708_100017959 3300005445 Bacteria 5914
43 Ga0070708_100037712 3300005445 Bacteria 4219
44 Ga0070708_100083232 3300005445 Bacteria 2900
45 Ga0070678_100474945 3300005456 Bacteria 1099
46 Ga0070681_10487812 3300005458 Bacteria 1145
47 Ga0070685_10010124 3300005466 Bacteria 4893
48 Ga0070706_100000779 3300005467 Bacteria 35638
49 Ga0070706_100003302 3300005467 Bacteria 15955
50 Ga0070706_100003775 3300005467 Bacteria 14784
51 Ga0070706_100005289 3300005467 Bacteria 12305
52 Ga0070706_100035482 3300005467 Bacteria 4606
53 Ga0070706_100036347 3300005467 Bacteria 4549
54 Ga0070706_100048054 3300005467 Bacteria 3939
55 Ga0070706_100061535 3300005467 Bacteria 3467
56 Ga0070706_100433314 3300005467 Bacteria 1224
57 Ga0070707_100000067 3300005468 Bacteria 93995
58 Ga0070707_100004574 3300005468 Bacteria 12953
59 Ga0070707_100019164 3300005468 Bacteria 6445
60 Ga0070707_100021934 3300005468 Bacteria 6039
61 Ga0070707_100040639 3300005468 Bacteria 4450
62 Ga0070707_100153190 3300005468 Bacteria 2245
63 Ga0070707_100179386 3300005468 Bacteria 2064
64 Ga0070698_100001287 3300005471 Bacteria 27980
65 Ga0070698_100002969 3300005471 Bacteria 18662
66 Ga0070698_100007877 3300005471 Bacteria 11534
67 Ga0070698_100007905 3300005471 Bacteria 11511
68 Ga0070698_100020002 3300005471 Bacteria 7018
69 Ga0070698_100028892 3300005471 Bacteria 5756
70 Ga0070698_100035229 3300005471 Bacteria 5177
71 Ga0070698_100057159 3300005471 Bacteria 3949
72 Ga0070698_100057703 3300005471 Bacteria 3928
73 Ga0070698_100068774 3300005471 Bacteria 3558
74 Ga0070698_100653052 3300005471 Bacteria 993
75 Ga0070699_100013538 3300005518 Bacteria 7023
76 Ga0070699_100481654 3300005518 Bacteria 1126
77 Ga0070679_100081144 3300005530 Bacteria 3232
78 Ga0070679_100122222 3300005530 Bacteria 2588
79 Ga0070679_100152982 3300005530 Bacteria 2283
80 Ga0070684_100093447 3300005535 Bacteria 2677
81 Ga0070697_100269566 3300005536 Bacteria 1459
82 Ga0068853_100007584 3300005539 Bacteria 8690
83 Ga0068853_100167975 3300005539 Bacteria 1984
84 Ga0070695_100223817 3300005545 Bacteria 1357
85 Ga0070693_100015994 3300005547 Bacteria 3875
86 Ga0070693_100033072 3300005547 Bacteria 2851
87 Ga0070665_100053599 3300005548 Bacteria 4044
88 Ga0068855_100012767 3300005563 Bacteria 10130
89 Ga0068855_100045657 3300005563 Bacteria 5181
90 Ga0068855_100054301 3300005563 Bacteria 4709
91 Ga0068855_100206370 3300005563 Bacteria 2210
92 Ga0068855_100399599 3300005563 Bacteria 1506
93 Ga0070664_100106766 3300005564 Bacteria 2440
94 Ga0068856_100016798 3300005614 Bacteria 7091
95 Ga0068856_100022991 3300005614 Bacteria 6061
96 Ga0068856_100025102 3300005614 Bacteria 5808
97 Ga0068856_100126309 3300005614 Bacteria 2561
98 Ga0068856_100292083 3300005614 Bacteria 1647
99 Ga0068852_100008353 3300005616 Bacteria 7627
100 Ga0068852_100185320 3300005616 Bacteria 1960
101 Ga0068852_100228226 3300005616 Bacteria 1774
102 Ga0068859_100111186 3300005617 Bacteria 2802
103 Ga0068863_100108061 3300005841 Bacteria 2648
104 Ga0068863_100144067 3300005841 Bacteria 2278
105 Ga0068858_100123178 3300005842 Bacteria 2426
106 Ga0068858_100130133 3300005842 Bacteria 2359
107 Ga0068860_100357996 3300005843 Bacteria 1437
108 Ga0081455_10141817 3300005937 Bacteria 1865
109 Ga0081538_10009795 3300005981 Bacteria 7932
110 Ga0081540_1000151 3300005983 Bacteria 71183
111 Ga0081540_1004184 3300005983 Bacteria 11101
112 Ga0070717_10002789 3300006028 Bacteria 12368
113 Ga0070717_10003201 3300006028 Bacteria 11693
114 Ga0070717_10028805 3300006028 Bacteria 4450
115 Ga0070717_10033037 3300006028 Bacteria 4172
116 Ga0070717_10035331 3300006028 Bacteria 4045
117 Ga0070717_10067096 3300006028 Bacteria 2984
118 Ga0070717_10115359 3300006028 Bacteria 2295
119 Ga0070717_10194446 3300006028 Bacteria 1774
120 Ga0070717_10314549 3300006028 Bacteria 1394
121 Ga0070717_10459331 3300006028 Bacteria 1148
122 Ga0070717_10556206 3300006028 Bacteria 1039
123 Ga0075365_10000573 3300006038 Bacteria 14269
124 Ga0075365_10007506 3300006038 Bacteria 6115
125 Ga0075365_10008296 3300006038 Bacteria 5886
126 Ga0075364_10001415 3300006051 Bacteria 13009
127 Ga0075432_10010142 3300006058 Bacteria 3196
128 Ga0070716_100001145 3300006173 Bacteria 11690
129 Ga0070716_100001372 3300006173 Bacteria 10813
130 Ga0070716_100001418 3300006173 Bacteria 10644
131 Ga0070716_100008860 3300006173 Bacteria 4999
132 Ga0070712_100001789 3300006175 Bacteria 13136
133 Ga0070712_100068021 3300006175 Bacteria 2536
134 Ga0075431_100001328 3300006847 Bacteria 22611
135 Ga0075433_10016095 3300006852 Bacteria 6152
136 Ga0075433_10041192 3300006852 Bacteria 4001
137 Ga0075434_100004072 3300006871 Bacteria 13099
138 Ga0075434_100081059 3300006871 Bacteria 3242
139 Ga0075436_100005017 3300006914 Bacteria 9097
140 Ga0075436_100013955 3300006914 Bacteria 5498
141 Ga0097620_100111187 3300006931 Bacteria 2802
142 Ga0075435_100074305 3300007076 Bacteria 2780
143 Ga0105251_10013349 3300009011 Bacteria 4599
144 Ga0105240_10010339 3300009093 Bacteria 13129
145 Ga0105240_10015062 3300009093 Bacteria 10526
146 Ga0105240_10021422 3300009093 Bacteria 8594
147 Ga0105240_10408674 3300009093 Bacteria 1527
148 Ga0105245_10054248 3300009098 Bacteria 3600
149 Ga0105247_10306771 3300009101 Bacteria 1103
150 Ga0114129_10006397 3300009147 Bacteria 16699
151 Ga0114129_10610108 3300009147 Bacteria 1413
152 Ga0105243_10169736 3300009148 Bacteria 1888
153 Ga0105241_10015679 3300009174 Bacteria 5553
154 Ga0105248_10019553 3300009177 Bacteria 7497
155 Ga0105237_10017726 3300009545 Bacteria 7382
156 Ga0105237_10045676 3300009545 Bacteria 4407
157 Ga0105237_10097058 3300009545 Bacteria 2937
158 Ga0105238_10006171 3300009551 Bacteria 11899
159 Ga0105239_10060098 3300010375 Bacteria 4171
160 Ga0105239_10126944 3300010375 Bacteria 2836
161 Ga0157373_10063429 3300013100 Bacteria 2616
162 Ga0157370_10038212 3300013104 Bacteria 4644
163 Ga0157369_10329125 3300013105 Bacteria 1587
164 Ga0157374_10098488 3300013296 Bacteria 2800
165 Ga0157378_10521833 3300013297 Bacteria 1189
166 Ga0163162_10175704 3300013306 Bacteria 2267
167 Ga0163162_10709475 3300013306 Bacteria 1127
168 Ga0157372_10175587 3300013307 Bacteria 2479
169 Ga0157372_10205004 3300013307 Bacteria 2285
170 Ga0157372_10646259 3300013307 Bacteria 1232
171 Ga0163163_10046257 3300014325 Bacteria 4275
172 Ga0157380_10115671 3300014326 Bacteria 2262
173 Ga0157377_10087858 3300014745 Bacteria 1830
174 Ga0157377_10118865 3300014745 Bacteria 1599
175 Ga0157379_10004765 3300014968 Bacteria 11655
176 Ga0157376_10147212 3300014969 Bacteria 2120
177 Ga0197907_10719170 3300020069 Bacteria 3242
178 Ga0206351_10585209 3300020077 Bacteria 1901
179 Ga0206350_11655236 3300020080 Bacteria 2678
180 Ga0206354_10266512 3300020081 Bacteria 4020
181 Ga0206353_10260620 3300020082 Bacteria 9113
182 Ga0206353_11011084 3300020082 Bacteria 1956
183 Ga0206353_11174394 3300020082 Bacteria 2166
184 Ga0206353_11852117 3300020082 Bacteria 2651
185 Ga0213875_10000727 3300021388 Bacteria 25103
186 Ga0213875_10002626 3300021388 Bacteria 10654
187 Ga0213875_10002831 3300021388 Bacteria 10172
188 Ga0224712_10008460 3300022467 Bacteria 3052
189 Ga0224712_10029241 3300022467 Bacteria 1977
190 Ga0224712_10152197 3300022467 Bacteria 1026
191 Ga0224572_1001159 3300024225 Bacteria 3750
192 Ga0207653_10014578 3300025885 Bacteria 2466
193 Ga0207692_10009667 3300025898 Bacteria 4037
194 Ga0207692_10019711 3300025898 Bacteria 3053
195 Ga0207692_10019993 3300025898 Bacteria 3037
196 Ga0207692_10029847 3300025898 Bacteria 2595
197 Ga0207688_10027892 3300025901 Bacteria 3106
198 Ga0207680_10145987 3300025903 Bacteria 1573
199 Ga0207647_10012340 3300025904 Bacteria 5949
200 Ga0207685_10002516 3300025905 Bacteria 4222
201 Ga0207685_10016246 3300025905 Bacteria 2379
202 Ga0207699_10000904 3300025906 Bacteria 14188
203 Ga0207699_10001571 3300025906 Bacteria 10834
204 Ga0207699_10005463 3300025906 Bacteria 6085
205 Ga0207699_10006375 3300025906 Bacteria 5707
206 Ga0207699_10073709 3300025906 Bacteria 2095
207 Ga0207699_10283318 3300025906 Bacteria 1152
208 Ga0207705_10113196 3300025909 Bacteria 2007
209 Ga0207684_10000495 3300025910 Bacteria 49988
210 Ga0207684_10000583 3300025910 Bacteria 44299
211 Ga0207684_10002613 3300025910 Bacteria 18016
212 Ga0207684_10004967 3300025910 Bacteria 12402
213 Ga0207684_10030266 3300025910 Bacteria 4609
214 Ga0207684_10041676 3300025910 Bacteria 3891
215 Ga0207684_10197617 3300025910 Bacteria 1734
216 Ga0207654_10039890 3300025911 Bacteria 2643
217 Ga0207695_10002357 3300025913 Bacteria 28088
218 Ga0207695_10277209 3300025913 Bacteria 1571
219 Ga0207671_10001397 3300025914 Bacteria 28073
220 Ga0207671_10074475 3300025914 Bacteria 2537
221 Ga0207693_10013039 3300025915 Bacteria 6707
222 Ga0207693_10049143 3300025915 Bacteria 3312
223 Ga0207693_10150269 3300025915 Bacteria 1832
224 Ga0207663_10022656 3300025916 Bacteria 3594
225 Ga0207663_10054137 3300025916 Bacteria 2511
226 Ga0207663_10094820 3300025916 Bacteria 1989
227 Ga0207662_10062535 3300025918 Bacteria 2237
228 Ga0207646_10000218 3300025922 Bacteria 78329
229 Ga0207646_10005205 3300025922 Bacteria 13745
230 Ga0207646_10013662 3300025922 Bacteria 7754
231 Ga0207646_10053323 3300025922 Bacteria 3617
232 Ga0207646_10061311 3300025922 Bacteria 3357
233 Ga0207646_10279995 3300025922 Bacteria 1507
234 Ga0207694_10004697 3300025924 Bacteria 10630
235 Ga0207694_10395645 3300025924 Bacteria 1148
236 Ga0207687_10144750 3300025927 Bacteria 1807
237 Ga0207687_10230112 3300025927 Bacteria 1464
238 Ga0207700_10002040 3300025928 Bacteria 11551
239 Ga0207700_10003217 3300025928 Bacteria 9429
240 Ga0207700_10016328 3300025928 Bacteria 4930
241 Ga0207700_10024036 3300025928 Bacteria 4213
242 Ga0207700_10026370 3300025928 Bacteria 4050
243 Ga0207700_10029235 3300025928 Bacteria 3886
244 Ga0207700_10062006 3300025928 Bacteria 2838
245 Ga0207700_10075072 3300025928 Bacteria 2618
246 Ga0207700_10075986 3300025928 Bacteria 2605
247 Ga0207700_10144849 3300025928 Bacteria 1957
248 Ga0207700_10162277 3300025928 Bacteria 1857
249 Ga0207700_10244932 3300025928 Bacteria 1529
250 Ga0207664_10000917 3300025929 Bacteria 19842
251 Ga0207664_10001098 3300025929 Bacteria 18046
252 Ga0207664_10002635 3300025929 Bacteria 11886
253 Ga0207664_10014360 3300025929 Bacteria 5716
254 Ga0207664_10025437 3300025929 Bacteria 4460
255 Ga0207664_10029061 3300025929 Bacteria 4208
256 Ga0207664_10040906 3300025929 Bacteria 3608
257 Ga0207664_10193654 3300025929 Bacteria 1751
258 Ga0207664_10235424 3300025929 Bacteria 1593
259 Ga0207690_10092706 3300025932 Bacteria 2139
260 Ga0207706_10029288 3300025933 Bacteria 4916
261 Ga0207665_10000929 3300025939 Bacteria 19812
262 Ga0207665_10003086 3300025939 Bacteria 11172
263 Ga0207665_10011381 3300025939 Bacteria 5842
264 Ga0207665_10024581 3300025939 Bacteria 3972
265 Ga0207665_10093557 3300025939 Bacteria 2087
266 Ga0207665_10149773 3300025939 Bacteria 1670
267 Ga0207711_10220352 3300025941 Bacteria 1735
268 Ga0207661_10302644 3300025944 Bacteria 1434
269 Ga0207661_10400168 3300025944 Bacteria 1245
270 Ga0207667_10045382 3300025949 Bacteria 4655
271 Ga0207667_10045791 3300025949 Bacteria 4632
272 Ga0207667_10133675 3300025949 Bacteria 2555
273 Ga0207667_10171299 3300025949 Bacteria 2231
274 Ga0207651_10012268 3300025960 Bacteria 4841
275 Ga0207658_10009700 3300025986 Bacteria 6536
276 Ga0207677_10053667 3300026023 Bacteria 2745
277 Ga0207639_10117689 3300026041 Bacteria 2178
278 Ga0207639_10346057 3300026041 Bacteria 1326
279 Ga0207639_10400805 3300026041 Bacteria 1236
280 Ga0207708_10004677 3300026075 Bacteria 10069
281 Ga0207702_10018132 3300026078 Bacteria 5823
282 Ga0207702_10020203 3300026078 Bacteria 5517
283 Ga0207702_10090947 3300026078 Bacteria 2671
284 Ga0207641_10108595 3300026088 Bacteria 2456
285 Ga0207641_10298719 3300026088 Bacteria 1520
286 Ga0207648_10032598 3300026089 Bacteria 4598
287 Ga0207674_10008612 3300026116 Bacteria 11759
288 Ga0207674_10021672 3300026116 Bacteria 6918
289 Ga0207683_10004533 3300026121 Bacteria 11975
290 Ga0207683_10396898 3300026121 Bacteria 1269
291 Ga0207698_10010512 3300026142 Bacteria 5954
292 Ga0207428_10106536 3300027907 Bacteria 2161
293 Ga0207428_10194181 3300027907 Bacteria 1529
294 Ga0224573_1002340 3300028019 Bacteria 1438
295 Ga0268266_10128323 3300028379 Bacteria 2266
296 Ga0268266_10245363 3300028379 Bacteria 1654
297 Ga0265336_10012382 3300028666 Bacteria 2872
298 Ga0265338_10000596 3300028800 Bacteria 63688
299 Ga0265338_10013006 3300028800 Bacteria 9439
300 Ga0265338_10021849 3300028800 Bacteria 6650
301 Ga0307511_10005760 3300030521 Bacteria 12536
302 Ga0316214_1008859 3300033545 Bacteria 1357
303 Ga0316212_1000295 3300033547 Bacteria 5934
304 Ga0373930_0004804 3300034816 Bacteria 2218
305 Ga0373959_0001601 3300034820 Bacteria 3606
306 Ga0373938_0001754 3300034957 Bacteria 3460
307 Ga0373926_0000360 3300035083 Bacteria 11581
308 Ga0373926_0009093 3300035083 Bacteria 3315
309 Ga0373928_0007408 3300035084 Bacteria 2117
310 Ga0373929_0027698 3300035085 Bacteria 1192
311 Ga0373934_0000053 3300035086 Bacteria 39071
312 Ga0373934_0003111 3300035086 Bacteria 6052
313 Ga0373934_0004117 3300035086 Bacteria 5362
314 Ga0373934_0006190 3300035086 Bacteria 4434
315 Ga0373940_0007390 3300035088 Bacteria 2479
316 Ga0373940_0015568 3300035088 Bacteria 1873
317 Ga0373949_0021630 3300035090 Bacteria 1478
318 Ga0373923_0005578 3300035111 Bacteria 4281
319 Ga0373923_0024932 3300035111 Bacteria 2365
320 Ga0373923_0052137 3300035111 Bacteria 1718
321 Ga0373932_0007803 3300035112 Bacteria 2554
322 Ga0373936_0001318 3300035113 Bacteria 8991
323 Ga0373936_0003379 3300035113 Bacteria 5980
324 Ga0373936_0037333 3300035113 Bacteria 1939
325 Ga0373945_0049795 3300035116 Bacteria 1538
326 Ga0373945_0052798 3300035116 Bacteria 1498
327 Ga0373953_0000470 3300035117 Bacteria 11115
328 Ga0373953_0000922 3300035117 Bacteria 8234
329 Ga0373953_0057436 3300035117 Bacteria 1584
330 Ga0373954_0001494 3300035118 Bacteria 9506
331 Ga0373954_0004958 3300035118 Bacteria 5746
332 Ga0373954_0016080 3300035118 Bacteria 3347
333 Ga0373954_0025010 3300035118 Bacteria 2726
334 Ga0373954_0056743 3300035118 Bacteria 1844
335 Ga0373956_0000325 3300035119 Bacteria 19198
336 Ga0373956_0002679 3300035119 Bacteria 7205
337 Ga0373956_0008484 3300035119 Bacteria 4161
338 Ga0373956_0017199 3300035119 Bacteria 3046
339 Ga0373956_0044279 3300035119 Bacteria 1983
340 Ga0373956_0071291 3300035119 Bacteria 1585
341 Ga0373957_0000015 3300035120 Bacteria 43575
342 Ga0373957_0006637 3300035120 Bacteria 3658
343 Ga0373957_0012535 3300035120 Bacteria 2857
344 Ga0373957_0034793 3300035120 Bacteria 1868
345 Ga0373957_0065944 3300035120 Bacteria 1409
346 Ga0373943_0017785 3300035170 Bacteria 3256
347 Ga0373943_0123384 3300035170 Bacteria 1379
348 Ga0373946_0056033 3300035171 Bacteria 1663
349 Ga0373946_0060405 3300035171 Bacteria 1611
350 Ga0373955_0000027 3300035172 Bacteria 58251
351 Ga0373955_0030168 3300035172 Bacteria 2827
352 Ga0373955_0037534 3300035172 Bacteria 2576
353 Ga0373942_0004774 3300035207 Bacteria 3145
354 Ga0373942_0025455 3300035207 Bacteria 1525
355 Ga0373924_0000084 3300035410 Bacteria 25342
356 Ga0373924_0001744 3300035410 Bacteria 7177
357 Ga0373924_0023060 3300035410 Bacteria 2437
358 Ga0373924_0029926 3300035410 Bacteria 2179
359 Ga0373924_0031872 3300035410 Bacteria 2121
360 Ga0373931_0013691 3300035691 Bacteria 3954
361 Ga0373931_0020631 3300035691 Bacteria 3298
362 Ga0373935_0004908 3300035692 Bacteria 7858
363 Ga0373935_0014258 3300035692 Bacteria 4797
364 Ga0373935_0038520 3300035692 Bacteria 2993
365 Ga0373935_0107610 3300035692 Bacteria 1846
366 Ga0373927_0018009 3300035695 Bacteria 4645
367 Ga0373927_0098327 3300035695 Bacteria 1903
368 Ga0373933_0000025 3300035724 Bacteria 90735
369 Ga0373933_0001053 3300035724 Bacteria 16697
370 Ga0373933_0014139 3300035724 Bacteria 4432
371 Ga0373933_0029824 3300035724 Bacteria 3156
372 Ga0373933_0107677 3300035724 Bacteria 1735
373 Ga0373947_0000004 3300035725 Bacteria 248228
374 Ga0373947_0003675 3300035725 Bacteria 9046
375 Ga0373947_0041997 3300035725 Bacteria 2729
376 Ga0373947_0070828 3300035725 Bacteria 2137
377 Ga0373947_0118990 3300035725 Bacteria 1676
378 Ga0373937_0000034 3300036401 Bacteria 116552
379 Ga0373937_0017863 3300036401 Bacteria 6328
380 Ga0373937_0031788 3300036401 Bacteria 4784
381 Ga0373937_0078785 3300036401 Bacteria 3045
382 Ga0373937_0119114 3300036401 Bacteria 2459
383 Ga0373937_0211451 3300036401 Bacteria 1825
384 Ga0373925_0000633 3300037068 Bacteria 33249
385 Ga0373925_0005928 3300037068 Bacteria 9056
386 Ga0373925_0012048 3300037068 Bacteria 6261
387 Ga0373925_0078600 3300037068 Bacteria 2505
388 Ga0373925_0117143 3300037068 Bacteria 2064
389 Ga0373925_0256175 3300037068 Bacteria 1404
390 Ga0373925_0291000 3300037068 Bacteria 1317
391 Ga0373925_0323849 3300037068 Bacteria 1247
392 Ga0395900_0004392 3300037418 Bacteria 14963
393 Ga0395900_0495872 3300037418 Unclassified 1172
394 Ga0395898_0001996 3300037466 Bacteria 25620
395 Ga0395898_0035783 3300037466 Bacteria 4934
396 Ga0395898_0434990 3300037466 Bacteria 1250
397 Ga0436364_0395778 3300037853 Bacteria 30492
398 Ga0436364_0502444 3300037853 Bacteria 31198
399 Ga0436364_0720930 3300037853 Bacteria 12667
400 Ga0436364_1069913 3300037853 Bacteria 1043
401 Ga0395901_0009204 3300038443 Bacteria 10004
402 Ga0395901_0021767 3300038443 Bacteria 6570
403 Ga0395901_0290505 3300038443 Bacteria 1697
404 Ga0395901_0704026 3300038443 Bacteria 1007
405 Ga0436365_1371133 3300039437 Bacteria 5312
406 Ga0436363_0546269 3300039450 Bacteria 1947
407 Ga0436363_1179736 3300039450 Bacteria 2376
408 Ga0436362_1121950 3300039453 Bacteria 1508
409 Ga0466969_0000716 3300044656 Bacteria 17970
410 Ga0466969_0002737 3300044656 Bacteria 9427
411 Ga0466969_0004039 3300044656 Bacteria 7778
412 Ga0466969_0011533 3300044656 Bacteria 4678
413 Ga0466969_0013913 3300044656 Bacteria 4235
414 Ga0466969_0016031 3300044656 Bacteria 3926
415 Ga0466969_0023258 3300044656 Bacteria 3194
416 Ga0466969_0101975 3300044656 Bacteria 1350
417 Ga0466966_0001071 3300044684 Bacteria 17476
418 Ga0466966_0015198 3300044684 Bacteria 5093
419 Ga0466966_0015962 3300044684 Bacteria 4964
420 Ga0466966_0027809 3300044684 Bacteria 3687
421 Ga0466966_0033280 3300044684 Bacteria 3338
422 Ga0466966_0259780 3300044684 Bacteria 1046
423 Ga0466961_0002475 3300044693 Bacteria 11457
424 Ga0466961_0002554 3300044693 Bacteria 11273
425 Ga0466961_0009808 3300044693 Bacteria 6096
426 Ga0466961_0022551 3300044693 Bacteria 4050
427 Ga0466961_0029340 3300044693 Bacteria 3537
428 Ga0466963_0005926 3300044694 Bacteria 7195
429 Ga0466963_0022604 3300044694 Bacteria 3984
430 Ga0466963_0026989 3300044694 Bacteria 3674
431 Ga0466963_0041755 3300044694 Bacteria 3009
432 Ga0466963_0048312 3300044694 Bacteria 2811
433 Ga0466963_0264732 3300044694 Bacteria 1207
434 Ga0466971_0000279 3300044719 Bacteria 19515
435 Ga0466971_0015663 3300044719 Bacteria 3339
436 Ga0466971_0069510 3300044719 Bacteria 1598
437 Ga0466970_0005393 3300044765 Bacteria 6343
438 Ga0466970_0014136 3300044765 Bacteria 4094
439 Ga0466970_0044403 3300044765 Bacteria 2366
440 Ga0466957_0127755 3300044842 Bacteria 1625
441 Ga0466957_0179017 3300044842 Bacteria 1384
442 Ga0466957_0306059 3300044842 Bacteria 1069
443 Ga0466957_0446549 3300044842 Bacteria 891
444 Ga0466959_0000323 3300045049 Bacteria 28214
445 Ga0466959_0011233 3300045049 Bacteria 6425
446 Ga0466959_0051545 3300045049 Bacteria 3017
447 Ga0466959_0093621 3300045049 Bacteria 2156
448 Ga0466959_0105794 3300045049 Bacteria 2012
449 Ga0466959_0112991 3300045049 Bacteria 1937
450 Ga0466959_0125686 3300045049 Bacteria 1820
451 Ga0466959_0178426 3300045049 Bacteria 1487
452 Ga0466958_0007882 3300045836 Bacteria 5886
453 Ga0466958_0028948 3300045836 Bacteria 3286
454 Ga0466958_0045913 3300045836 Bacteria 2636
455 Ga0466958_0122635 3300045836 Unclassified 1628
456 Ga0466958_0177663 3300045836 Bacteria 1350
457 Ga0466967_0006404 3300045976 Bacteria 8323
458 Ga0466967_0014283 3300045976 Bacteria 6179
459 Ga0466967_0052558 3300045976 Bacteria 3577
460 Ga0466967_0154000 3300045976 Bacteria 2151
461 Ga0466967_0346592 3300045976 Bacteria 1437
462 Ga0495592_0000016 3300046454 Bacteria 144922
463 Ga0495592_0028669 3300046454 Bacteria 4214
464 Ga0495592_0103575 3300046454 Bacteria 2024
465 Ga0495592_0152684 3300046454 Bacteria 1595
466 Ga0495592_0219309 3300046454 Bacteria 1273
467 Ga0495603_0017302 3300046455 Bacteria 4365
468 Ga0495603_0157927 3300046455 Bacteria 1316
469 Ga0495629_0026762 3300046459 Bacteria 4095
470 Ga0495629_0069170 3300046459 Bacteria 2463
471 Ga0495629_0162511 3300046459 Bacteria 1551
472 Ga0495641_0006309 3300046461 Bacteria 7711
473 Ga0495641_0073405 3300046461 Bacteria 1535
474 Ga0495641_0096350 3300046461 Bacteria 1320
475 Ga0495651_0000005 3300046462 Bacteria 173396
476 Ga0495651_0002725 3300046462 Bacteria 13708
477 Ga0495651_0018456 3300046462 Bacteria 5402
478 Ga0495651_0032212 3300046462 Bacteria 4089
479 Ga0495651_0034619 3300046462 Bacteria 3936
480 Ga0495651_0060989 3300046462 Bacteria 2887
481 Ga0495651_0062117 3300046462 Bacteria 2858
482 Ga0495651_0137149 3300046462 Bacteria 1778
483 Ga0495653_0001819 3300046463 Bacteria 16822
484 Ga0495653_0003475 3300046463 Bacteria 12660
485 Ga0495653_0004816 3300046463 Bacteria 10941
486 Ga0495653_0018528 3300046463 Bacteria 5651
487 Ga0495653_0056120 3300046463 Bacteria 3003
488 Ga0495653_0062414 3300046463 Bacteria 2815
489 Ga0495653_0130009 3300046463 Bacteria 1784
490 Ga0495580_0044986 3300046472 Bacteria 3137
491 Ga0495582_0302278 3300046473 Bacteria 920
492 Ga0495639_0003094 3300046475 Bacteria 7238
493 Ga0495639_0185139 3300046475 Bacteria 1015
494 Ga0495662_0002423 3300046476 Bacteria 9370
495 Ga0495662_0005000 3300046476 Bacteria 6643
496 Ga0495662_0020528 3300046476 Bacteria 3196
497 Ga0495662_0083121 3300046476 Bacteria 1558
498 Ga0495662_0124415 3300046476 Bacteria 1266
499 Ga0495662_0127889 3300046476 Bacteria 1248
500 Ga0495662_0128724 3300046476 Bacteria 1244
501 Ga0495664_0003347 3300046477 Bacteria 8717
502 Ga0495664_0101384 3300046477 Bacteria 1734
503 Ga0495594_0010188 3300046499 Bacteria 4871
504 Ga0495608_0000057 3300046511 Bacteria 90735
505 Ga0495608_0004720 3300046511 Bacteria 9755
506 Ga0495608_0093057 3300046511 Bacteria 1947
507 Ga0495608_0095084 3300046511 Bacteria 1925
508 Ga0495608_0199116 3300046511 Bacteria 1262
509 Ga0495618_0005229 3300046514 Bacteria 7931
510 Ga0495618_0019880 3300046514 Bacteria 4134
511 Ga0495618_0024487 3300046514 Bacteria 3739
512 Ga0495618_0060552 3300046514 Bacteria 2400
513 Ga0495618_0171261 3300046514 Bacteria 1381
514 Ga0495618_0291408 3300046514 Bacteria 1016
515 Ga0495628_0000073 3300046516 Bacteria 79628
516 Ga0495628_0020075 3300046516 Bacteria 5515
517 Ga0495628_0030499 3300046516 Bacteria 4365
518 Ga0495628_0054874 3300046516 Bacteria 3140
519 Ga0495628_0069465 3300046516 Bacteria 2747
520 Ga0495628_0070281 3300046516 Bacteria 2729
521 Ga0495628_0095207 3300046516 Bacteria 2301
522 Ga0495628_0153273 3300046516 Bacteria 1754
523 Ga0495628_0165988 3300046516 Bacteria 1676
524 Ga0495630_0006137 3300046517 Bacteria 8520
525 Ga0495630_0012698 3300046517 Bacteria 6120
526 Ga0495630_0026937 3300046517 Bacteria 4260
527 Ga0495630_0065249 3300046517 Bacteria 2735
528 Ga0495630_0096862 3300046517 Bacteria 2230
529 Ga0495666_0007862 3300046526 Bacteria 5341
530 Ga0495666_0029653 3300046526 Bacteria 2691
531 Ga0495652_0000054 3300046529 Bacteria 116611
532 Ga0495652_0013125 3300046529 Bacteria 7459
533 Ga0495652_0028852 3300046529 Bacteria 4878
534 Ga0495652_0053930 3300046529 Bacteria 3425
535 Ga0495652_0073249 3300046529 Bacteria 2852
536 Ga0495652_0150728 3300046529 Bacteria 1817
537 Ga0495652_0183454 3300046529 Bacteria 1603
538 Ga0495665_0001784 3300046531 Bacteria 11584
539 Ga0495665_0032541 3300046531 Bacteria 2789
540 Ga0495640_0002155 3300046533 Bacteria 15729
541 Ga0495640_0015646 3300046533 Bacteria 5700
542 Ga0495640_0017648 3300046533 Bacteria 5312
543 Ga0495640_0032728 3300046533 Bacteria 3700
544 Ga0495640_0054912 3300046533 Bacteria 2727
545 Ga0495640_0059198 3300046533 Bacteria 2610
546 Ga0495586_0004834 3300046535 Bacteria 7203
547 Ga0495586_0016074 3300046535 Bacteria 3981
548 Ga0495586_0062049 3300046535 Bacteria 2034
549 Ga0495587_0000030 3300046536 Bacteria 135844
550 Ga0495587_0002096 3300046536 Bacteria 13318
551 Ga0495587_0011063 3300046536 Bacteria 5721
552 Ga0495587_0012367 3300046536 Bacteria 5374
553 Ga0495587_0015899 3300046536 Bacteria 4687
554 Ga0495587_0037061 3300046536 Bacteria 2930
555 Ga0495587_0118019 3300046536 Bacteria 1520
556 Ga0495587_0137543 3300046536 Bacteria 1395
557 Ga0495645_0004436 3300046543 Bacteria 9586
558 Ga0495645_0020221 3300046543 Bacteria 4800
559 Ga0495645_0054817 3300046543 Bacteria 2895
560 Ga0495645_0054985 3300046543 Bacteria 2891
561 Ga0495645_0058308 3300046543 Bacteria 2801
562 Ga0495645_0138449 3300046543 Bacteria 1700
563 Ga0495667_0000025 3300046559 Bacteria 155090
564 Ga0495667_0000230 3300046559 Bacteria 36657
565 Ga0495667_0010842 3300046559 Bacteria 6161
566 Ga0495667_0012533 3300046559 Bacteria 5748
567 Ga0495667_0026825 3300046559 Bacteria 3881
568 Ga0495667_0038051 3300046559 Bacteria 3204
569 Ga0495634_0006362 3300046642 Bacteria 8980
570 Ga0495634_0006938 3300046642 Bacteria 8553
571 Ga0495634_0027503 3300046642 Bacteria 3956
572 Ga0495634_0194102 3300046642 Bacteria 1265
573 Ga0495635_0058552 3300046663 Bacteria 2650
574 Ga0495635_0110963 3300046663 Bacteria 1873
575 Ga0495588_0005223 3300046674 Bacteria 5773
576 Ga0495588_0047894 3300046674 Bacteria 2195
577 Ga0495588_0169723 3300046674 Bacteria 1154
578 Ga0495657_0000018 3300046675 Bacteria 173397
579 Ga0495657_0002245 3300046675 Bacteria 16354
580 Ga0495657_0028746 3300046675 Bacteria 3906
581 Ga0495657_0135380 3300046675 Bacteria 1539
582 Ga0495599_0000054 3300046678 Bacteria 79938
583 Ga0495599_0001992 3300046678 Bacteria 11813
584 Ga0495599_0009175 3300046678 Bacteria 6035
585 Ga0495599_0011205 3300046678 Bacteria 5505
586 Ga0495599_0038224 3300046678 Bacteria 3016
587 Ga0495599_0045245 3300046678 Bacteria 2760
588 Ga0495599_0046066 3300046678 Bacteria 2735
589 Ga0495599_0078273 3300046678 Bacteria 2064
590 Ga0495599_0087832 3300046678 Bacteria 1941
591 Ga0495599_0091250 3300046678 Bacteria 1900
592 Ga0495599_0121283 3300046678 Bacteria 1625
593 Ga0495623_0000582 3300046679 Bacteria 24382
594 Ga0495623_0037451 3300046679 Bacteria 3103
595 Ga0495623_0041325 3300046679 Bacteria 2941
596 Ga0495623_0043777 3300046679 Bacteria 2846
597 Ga0495623_0050666 3300046679 Bacteria 2629
598 Ga0495623_0064058 3300046679 Bacteria 2301
599 Ga0495623_0070626 3300046679 Bacteria 2175
600 Ga0495646_0005148 3300046680 Bacteria 8249
601 Ga0495646_0018708 3300046680 Bacteria 4387
602 Ga0495646_0021048 3300046680 Bacteria 4122
603 Ga0495646_0069054 3300046680 Bacteria 2085
604 Ga0495646_0100245 3300046680 Bacteria 1662
605 Ga0495658_0030547 3300046683 Bacteria 2926
606 Ga0495658_0039770 3300046683 Bacteria 2611
607 Ga0495658_0043315 3300046683 Bacteria 2517
608 Ga0495613_0009885 3300046689 Bacteria 7092
609 Ga0495613_0040579 3300046689 Bacteria 3448
610 Ga0495613_0044720 3300046689 Bacteria 3275
611 Ga0495613_0128322 3300046689 Bacteria 1817
612 Ga0495624_0006425 3300046690 Bacteria 8339
613 Ga0495624_0018189 3300046690 Bacteria 4702
614 Ga0495624_0134739 3300046690 Bacteria 1514
615 Ga0495600_0003068 3300046809 Bacteria 9760
616 Ga0495600_0004322 3300046809 Bacteria 8495
617 Ga0495600_0004754 3300046809 Bacteria 8149
618 Ga0495600_0015851 3300046809 Bacteria 4774
619 Ga0495600_0027319 3300046809 Bacteria 3687
620 Ga0495600_0040818 3300046809 Bacteria 3023
621 Ga0495600_0063499 3300046809 Bacteria 2413
622 Ga0495600_0084115 3300046809 Bacteria 2076
623 Ga0495581_0003776 3300047315 Bacteria 8716
624 Ga0495581_0007097 3300047315 Bacteria 6486
625 Ga0495581_0022651 3300047315 Bacteria 3639
626 Ga0495581_0029920 3300047315 Bacteria 3157
627 Ga0495604_0000066 3300047317 Bacteria 90720
628 Ga0495604_0002783 3300047317 Bacteria 14023
629 Ga0495604_0020454 3300047317 Bacteria 5286
630 Ga0495604_0032785 3300047317 Bacteria 4114
631 Ga0495604_0040156 3300047317 Bacteria 3675
632 Ga0495604_0044509 3300047317 Bacteria 3467
633 Ga0495604_0082313 3300047317 Bacteria 2407
634 Ga0495604_0086276 3300047317 Bacteria 2340
635 Ga0495674_0012509 3300047319 Bacteria 7994
636 Ga0495674_0023928 3300047319 Bacteria 5621
637 Ga0495674_0029443 3300047319 Bacteria 5000
638 Ga0495674_0233483 3300047319 Bacteria 1517
639 Ga0495676_0155871 3300047321 Bacteria 1620
640 Ga0495680_0000032 3300047322 Bacteria 108460
641 Ga0495680_0016736 3300047322 Bacteria 6287
642 Ga0495680_0044928 3300047322 Bacteria 3490
643 Ga0495680_0045646 3300047322 Bacteria 3459
644 Ga0495680_0053976 3300047322 Bacteria 3123
645 Ga0495680_0151934 3300047322 Bacteria 1687
646 Ga0495675_0002070 3300047444 Bacteria 11973
647 Ga0495675_0008203 3300047444 Bacteria 6464
648 Ga0495675_0018575 3300047444 Bacteria 4413
649 Ga0495675_0044930 3300047444 Bacteria 2813
650 Ga0495675_0098679 3300047444 Bacteria 1829
651 Ga0495675_0127442 3300047444 Bacteria 1583
652 Ga0495684_0004756 3300047471 Bacteria 10608
653 Ga0495684_0028568 3300047471 Bacteria 4281
654 Ga0495684_0073025 3300047471 Bacteria 2606
655 Ga0495593_0032927 3300047673 Bacteria 2823
656 Ga0495593_0086231 3300047673 Bacteria 1619
657 Ga0495602_0000123 3300048088 Bacteria 72994
658 Ga0495602_0048800 3300048088 Bacteria 3799
659 Ga0495602_0103869 3300048088 Bacteria 2325
660 Ga0495602_0164733 3300048088 Bacteria 1727
661 Ga0495602_0318376 3300048088 Bacteria 1132
662 Ga0495614_0022830 3300048089 Bacteria 2697
663 Ga0496100_0033024 3300048903 Bacteria 3234
664 Ga0496100_0204135 3300048903 Bacteria 1442
665 Ga0496101_0539748 3300048904 Bacteria 922
666 Ga0496102_0104616 3300048905 Bacteria 2633
667 Ga0496102_0111292 3300048905 Bacteria 2553
668 Ga0496102_0185165 3300048905 Bacteria 1962
669 Ga0496104_0000379 3300048907 Bacteria 39343
670 Ga0496104_0004919 3300048907 Bacteria 11654
671 Ga0496104_0187602 3300048907 Bacteria 1978
672 Ga0496104_0360413 3300048907 Bacteria 1366
673 Ga0496105_0001710 3300048908 Bacteria 15668
674 Ga0496105_0024550 3300048908 Bacteria 4898
675 Ga0496105_0088830 3300048908 Bacteria 2553
676 Ga0496105_0106487 3300048908 Bacteria 2315
677 Ga0496105_0234497 3300048908 Bacteria 1490
678 Ga0496107_0053301 3300048910 Bacteria 2918
679 Ga0496107_0346361 3300048910 Bacteria 1106
680 Ga0496108_0009245 3300048911 Bacteria 7974
681 Ga0496108_0009877 3300048911 Bacteria 7735
682 Ga0496108_0048946 3300048911 Bacteria 3534
683 Ga0496109_0012280 3300048912 Bacteria 7394
684 Ga0496109_0118527 3300048912 Bacteria 2464
685 Ga0496109_0181316 3300048912 Bacteria 1978
686 Ga0496110_0246974 3300048913 Bacteria 1624
687 Ga0496111_0013190 3300048914 Bacteria 5620
688 Ga0496111_0056704 3300048914 Bacteria 2835
689 Ga0496112_0001030 3300048915 Bacteria 20510
690 Ga0496112_0053785 3300048915 Bacteria 3955
691 Ga0496113_0015665 3300048916 Bacteria 5220
692 Ga0496113_0016320 3300048916 Bacteria 5127
693 Ga0496113_0074800 3300048916 Bacteria 2583
694 Ga0496113_0269712 3300048916 Bacteria 1360
695 Ga0496114_0042203 3300048917 Bacteria 3780
696 Ga0496114_0108079 3300048917 Bacteria 2381
697 Ga0496114_0302122 3300048917 Bacteria 1413
698 Ga0496115_0030215 3300048918 Bacteria 4261
699 Ga0496115_0062786 3300048918 Bacteria 2997
700 Ga0496115_0155481 3300048918 Bacteria 1889
701 Ga0496115_0350505 3300048918 Bacteria 1204
702 Ga0496126_0048297 3300048929 Bacteria 3891
703 Ga0496126_0117897 3300048929 Bacteria 2305
704 Ga0496126_0135611 3300048929 Bacteria 2124
705 Ga0501031_0024616 3300049568 Bacteria 3924
706 Ga0501032_0150078 3300049569 Bacteria 1533
707 Ga0501036_0058097 3300049572 Bacteria 3277
708 Ga0501038_0101412 3300049574 Bacteria 2396
709 Ga0501039_0034025 3300049575 Bacteria 3932
710 Ga0501042_0139358 3300049578 Bacteria 1748
711 Ga0501047_0079113 3300049581 Bacteria 3161
712 Ga0501047_0450673 3300049581 Bacteria 1116
713 Ga0501068_0078793 3300049584 Bacteria 2020
714 Ga0501070_0002103 3300049586 Bacteria 17480
715 Ga0501071_0021797 3300049587 Bacteria 4465
716 Ga0501072_0141140 3300049588 Bacteria 1921
717 Ga0501074_0013736 3300049590 Bacteria 5887
718 Ga0501074_0277423 3300049590 Bacteria 1192
719 Ga0501077_0148621 3300049593 Bacteria 1487
720 Ga0501080_0190330 3300049742 Bacteria 1886
721 Ga0501081_0013383 3300049743 Bacteria 5397
722 Ga0501035_0184389 3300049822 Bacteria 1797
723 Ga0501044_0117468 3300049823 Bacteria 2664
724 Ga0501044_0538536 3300049823 Bacteria 1066
725 Ga0501045_0006807 3300049824 Bacteria 7919
726 nmdc:mga00v17_1767_c1 3300050491 Bacteria 11217
727 nmdc:mga0yw44_1189_c1 3300050492 Bacteria 10170
728 nmdc:mga0yw44_18924_c1 3300050492 Bacteria 3785
729 nmdc:mga05p37_27041_c1 3300050507 Bacteria 6983
730 nmdc:mga06r32_7057_c1 3300050510 Bacteria 10105
731 nmdc:mga0n895_30395_c1 3300050512 Bacteria 5163
732 nmdc:mga0n895_45760_c1 3300050512 Bacteria 4272
733 nmdc:mga0n895_5223_c1 3300050512 Bacteria 10818
734 nmdc:mga0n895_71088_c1 3300050512 Bacteria 3450
735 nmdc:mga0rr50_210270_c1 3300050513 Bacteria 1602
736 nmdc:mga0rr50_27751_c1 3300050513 Bacteria 3970
737 nmdc:mga0rr50_4148_c1 3300050513 Bacteria 8474
738 nmdc:mga08x19_401264_c1 3300050514 Bacteria 962
739 nmdc:mga08x19_60940_c1 3300050514 Bacteria 2445
740 nmdc:mga08x19_91807_c1 3300050514 Bacteria 2005
741 nmdc:mga0a205_184685_c1 3300050515 Bacteria 1979
742 nmdc:mga0a205_97010_c1 3300050515 Bacteria 2847
743 Ga0495601_0001760 3300053077 Bacteria 11992
744 Ga0495601_0044321 3300053077 Bacteria 2796
745 Ga0495601_0121104 3300053077 Bacteria 1699
746 Ga0495601_0146427 3300053077 Bacteria 1541
747 Ga0495601_0157010 3300053077 Bacteria 1485
748 Ga0495612_0010669 3300053078 Bacteria 3712
749 Ga0495612_0012739 3300053078 Bacteria 3390
750 Ga0495612_0041530 3300053078 Bacteria 1876
751 Ga0495595_0001793 3300053084 Bacteria 8369
752 Ga0495595_0005217 3300053084 Bacteria 5248
753 Ga0495595_0013448 3300053084 Bacteria 3457
754 Ga0495595_0018784 3300053084 Bacteria 2991
755 Ga0495595_0209474 3300053084 Bacteria 971
756 Ga0495619_0015572 3300053085 Bacteria 4811
757 Ga0495619_0025375 3300053085 Bacteria 3806
758 Ga0495619_0067693 3300053085 Bacteria 2385
759 Ga0495619_0075396 3300053085 Bacteria 2263
760 Ga0495619_0249611 3300053085 Bacteria 1229
761 Ga0500559_0002810 3300053136 Bacteria 8796
762 Ga0501084_0011073 3300054114 Bacteria 7468
763 Ga0501082_0019246 3300060353 Bacteria 5885
764 Ga0466962_0001198 3300061719 Bacteria 11914
765 Ga0466962_0007312 3300061719 Bacteria 5298
766 Ga0466962_0011153 3300061719 Bacteria 4326
767 Ga0466962_0118110 3300061719 Bacteria 1279
768 2515853667 2515154155 Bacteria 7985436
769 2644013682 2643221601 Bacteria 7493239
770 2644178688 2643221631 Bacteria 8168043
771 2676493498 2675903060 Bacteria 10051191
772 2776375648 2775506925 Bacteria 7237746
773 2858905149 2858902515 Bacteria 7086037
774 2863075363 2863067949 Bacteria 8541735
775 2866556273 2866552031 Bacteria 5824618
776 2867305582 2867302475 Bacteria 7087181
777 2867315171 2867312974 Bacteria 7058875
778 2867319832 2867319477 Bacteria 7069771
779 2884700922 2884693830 Bacteria 11273186
780 2895452361 2895442618 Bacteria 11027144
781 8056214688 8056207758 Bacteria 8639239
782 Ga0111539_10051982
783 JGI25404J52841_10007759
784 Ga0070658_10014140
785 Ga0070683_100396751
786 Ga0070680_100014068
787 Ga0068868_100025811
788 Ga0068868_100176793
789 Ga0070668_100062297
790 Ga0070671_100020417
791 Ga0070671_100135284
792 Ga0070667_100033039
793 Ga0070709_10000846
794 Ga0070709_10001146
795 Ga0070709_10071050
796 Ga0070714_100000680
797 Ga0070714_100000967
798 Ga0070714_100002468
799 Ga0070714_100006510
800 Ga0070714_100063139
801 Ga0070714_100065781
802 Ga0070714_100068213
803 Ga0070714_100352023
804 Ga0070713_100002759
805 Ga0070713_100003558
806 Ga0070713_100007719
807 Ga0070713_100059108
808 Ga0070713_100074843
809 Ga0070713_100117854
810 Ga0070713_100309369
811 Ga0070713_100325893
812 Ga0070710_10000786
813 Ga0070710_10006951
814 Ga0070710_10010322
815 Ga0070710_10036905
816 Ga0070710_10139912
817 Ga0070711_100002833
818 Ga0070711_100068317
819 Ga0070711_100399364
820 Ga0070700_100008976
821 Ga0070694_100073680
822 Ga0070708_100000801
823 Ga0070708_100017959
824 Ga0070708_100037712
825 Ga0070708_100083232
826 Ga0070678_100474945
827 Ga0070681_10487812
828 Ga0070685_10010124
829 Ga0070706_100000779
830 Ga0070706_100003302
831 Ga0070706_100003775
832 Ga0070706_100005289
833 Ga0070706_100035482
834 Ga0070706_100036347
835 Ga0070706_100048054
836 Ga0070706_100061535
837 Ga0070706_100433314
838 Ga0070707_100000067
839 Ga0070707_100004574
840 Ga0070707_100019164
841 Ga0070707_100021934
842 Ga0070707_100040639
843 Ga0070707_100153190
844 Ga0070707_100179386
845 Ga0070698_100001287
846 Ga0070698_100002969
847 Ga0070698_100007877
848 Ga0070698_100007905
849 Ga0070698_100020002
850 Ga0070698_100028892
851 Ga0070698_100035229
852 Ga0070698_100057159
853 Ga0070698_100057703
854 Ga0070698_100068774
855 Ga0070698_100653052
856 Ga0070699_100013538
857 Ga0070699_100481654
858 Ga0070679_100081144
859 Ga0070679_100122222
860 Ga0070679_100152982
861 Ga0070684_100093447
862 Ga0070697_100269566
863 Ga0068853_100007584
864 Ga0068853_100167975
865 Ga0070695_100223817
866 Ga0070693_100015994
867 Ga0070693_100033072
868 Ga0070665_100053599
869 Ga0068855_100012767
870 Ga0068855_100045657
871 Ga0068855_100054301
872 Ga0068855_100206370
873 Ga0068855_100399599
874 Ga0070664_100106766
875 Ga0068856_100016798
876 Ga0068856_100022991
877 Ga0068856_100025102
878 Ga0068856_100126309
879 Ga0068856_100292083
880 Ga0068852_100008353
881 Ga0068852_100185320
882 Ga0068852_100228226
883 Ga0068859_100111186
884 Ga0068863_100108061
885 Ga0068863_100144067
886 Ga0068858_100123178
887 Ga0068858_100130133
888 Ga0068860_100357996
889 Ga0081455_10141817
890 Ga0081538_10009795
891 Ga0081540_1000151
892 Ga0081540_1004184
893 Ga0070717_10002789
894 Ga0070717_10003201
895 Ga0070717_10028805
896 Ga0070717_10033037
897 Ga0070717_10035331
898 Ga0070717_10067096
899 Ga0070717_10115359
900 Ga0070717_10194446
901 Ga0070717_10314549
902 Ga0070717_10459331
903 Ga0070717_10556206
904 Ga0075365_10000573
905 Ga0075365_10007506
906 Ga0075365_10008296
907 Ga0075364_10001415
908 Ga0075432_10010142
909 Ga0070716_100001145
910 Ga0070716_100001372
911 Ga0070716_100001418
912 Ga0070716_100008860
913 Ga0070712_100001789
914 Ga0070712_100068021
915 Ga0075431_100001328
916 Ga0075433_10016095
917 Ga0075433_10041192
918 Ga0075434_100004072
919 Ga0075434_100081059
920 Ga0075436_100005017
921 Ga0075436_100013955
922 Ga0097620_100111187
923 Ga0075435_100074305
924 Ga0105251_10013349
925 Ga0105240_10010339
926 Ga0105240_10015062
927 Ga0105240_10021422
928 Ga0105240_10408674
929 Ga0105245_10054248
930 Ga0105247_10306771
931 Ga0114129_10006397
932 Ga0114129_10610108
933 Ga0105243_10169736
934 Ga0105241_10015679
935 Ga0105248_10019553
936 Ga0105237_10017726
937 Ga0105237_10045676
938 Ga0105237_10097058
939 Ga0105238_10006171
940 Ga0105239_10060098
941 Ga0105239_10126944
942 Ga0157373_10063429
943 Ga0157370_10038212
944 Ga0157369_10329125
945 Ga0157374_10098488
946 Ga0157378_10521833
947 Ga0163162_10175704
948 Ga0163162_10709475
949 Ga0157372_10175587
950 Ga0157372_10205004
951 Ga0157372_10646259
952 Ga0163163_10046257
953 Ga0157380_10115671
954 Ga0157377_10087858
955 Ga0157377_10118865
956 Ga0157379_10004765
957 Ga0157376_10147212
958 Ga0197907_10719170
959 Ga0206351_10585209
960 Ga0206350_11655236
961 Ga0206354_10266512
962 Ga0206353_10260620
963 Ga0206353_11011084
964 Ga0206353_11174394
965 Ga0206353_11852117
966 Ga0213875_10000727
967 Ga0213875_10002626
968 Ga0213875_10002831
969 Ga0224712_10008460
970 Ga0224712_10029241
971 Ga0224712_10152197
972 Ga0224572_1001159
973 Ga0207653_10014578
974 Ga0207692_10009667
975 Ga0207692_10019711
976 Ga0207692_10019993
977 Ga0207692_10029847
978 Ga0207688_10027892
979 Ga0207680_10145987
980 Ga0207647_10012340
981 Ga0207685_10002516
982 Ga0207685_10016246
983 Ga0207699_10000904
984 Ga0207699_10001571
985 Ga0207699_10005463
986 Ga0207699_10006375
987 Ga0207699_10073709
988 Ga0207699_10283318
989 Ga0207705_10113196
990 Ga0207684_10000495
991 Ga0207684_10000583
992 Ga0207684_10002613
993 Ga0207684_10004967
994 Ga0207684_10030266
995 Ga0207684_10041676
996 Ga0207684_10197617
997 Ga0207654_10039890
998 Ga0207695_10002357
999 Ga0207695_10277209
1000 Ga0207671_10001397
1001 Ga0207671_10074475
1002 Ga0207693_10013039
1003 Ga0207693_10049143
1004 Ga0207693_10150269
1005 Ga0207663_10022656
1006 Ga0207663_10054137
1007 Ga0207663_10094820
1008 Ga0207662_10062535
1009 Ga0207646_10000218
1010 Ga0207646_10005205
1011 Ga0207646_10013662
1012 Ga0207646_10053323
1013 Ga0207646_10061311
1014 Ga0207646_10279995
1015 Ga0207694_10004697
1016 Ga0207694_10395645
1017 Ga0207687_10144750
1018 Ga0207687_10230112
1019 Ga0207700_10002040
1020 Ga0207700_10003217
1021 Ga0207700_10016328
1022 Ga0207700_10024036
1023 Ga0207700_10026370
1024 Ga0207700_10029235
1025 Ga0207700_10062006
1026 Ga0207700_10075072
1027 Ga0207700_10075986
1028 Ga0207700_10144849
1029 Ga0207700_10162277
1030 Ga0207700_10244932
1031 Ga0207664_10000917
1032 Ga0207664_10001098
1033 Ga0207664_10002635
1034 Ga0207664_10014360
1035 Ga0207664_10025437
1036 Ga0207664_10029061
1037 Ga0207664_10040906
1038 Ga0207664_10193654
1039 Ga0207664_10235424
1040 Ga0207690_10092706
1041 Ga0207706_10029288
1042 Ga0207665_10000929
1043 Ga0207665_10003086
1044 Ga0207665_10011381
1045 Ga0207665_10024581
1046 Ga0207665_10093557
1047 Ga0207665_10149773
1048 Ga0207711_10220352
1049 Ga0207661_10302644
1050 Ga0207661_10400168
1051 Ga0207667_10045382
1052 Ga0207667_10045791
1053 Ga0207667_10133675
1054 Ga0207667_10171299
1055 Ga0207651_10012268
1056 Ga0207658_10009700
1057 Ga0207677_10053667
1058 Ga0207639_10117689
1059 Ga0207639_10346057
1060 Ga0207639_10400805
1061 Ga0207708_10004677
1062 Ga0207702_10018132
1063 Ga0207702_10020203
1064 Ga0207702_10090947
1065 Ga0207641_10108595
1066 Ga0207641_10298719
1067 Ga0207648_10032598
1068 Ga0207674_10008612
1069 Ga0207674_10021672
1070 Ga0207683_10004533
1071 Ga0207683_10396898
1072 Ga0207698_10010512
1073 Ga0207428_10106536
1074 Ga0207428_10194181
1075 Ga0224573_1002340
1076 Ga0268266_10128323
1077 Ga0268266_10245363
1078 Ga0265336_10012382
1079 Ga0265338_10000596
1080 Ga0265338_10013006
1081 Ga0265338_10021849
1082 Ga0307511_10005760
1083 Ga0316214_1008859
1084 Ga0316212_1000295
1085 Ga0373930_0004804
1086 Ga0373959_0001601
1087 Ga0373938_0001754
1088 Ga0373926_0000360
1089 Ga0373926_0009093
1090 Ga0373928_0007408
1091 Ga0373929_0027698
1092 Ga0373934_0000053
1093 Ga0373934_0003111
1094 Ga0373934_0004117
1095 Ga0373934_0006190
1096 Ga0373940_0007390
1097 Ga0373940_0015568
1098 Ga0373949_0021630
1099 Ga0373923_0005578
1100 Ga0373923_0024932
1101 Ga0373923_0052137
1102 Ga0373932_0007803
1103 Ga0373936_0001318
1104 Ga0373936_0003379
1105 Ga0373936_0037333
1106 Ga0373945_0049795
1107 Ga0373945_0052798
1108 Ga0373953_0000470
1109 Ga0373953_0000922
1110 Ga0373953_0057436
1111 Ga0373954_0001494
1112 Ga0373954_0004958
1113 Ga0373954_0016080
1114 Ga0373954_0025010
1115 Ga0373954_0056743
1116 Ga0373956_0000325
1117 Ga0373956_0002679
1118 Ga0373956_0008484
1119 Ga0373956_0017199
1120 Ga0373956_0044279
1121 Ga0373956_0071291
1122 Ga0373957_0000015
1123 Ga0373957_0006637
1124 Ga0373957_0012535
1125 Ga0373957_0034793
1126 Ga0373957_0065944
1127 Ga0373943_0017785
1128 Ga0373943_0123384
1129 Ga0373946_0056033
1130 Ga0373946_0060405
1131 Ga0373955_0000027
1132 Ga0373955_0030168
1133 Ga0373955_0037534
1134 Ga0373942_0004774
1135 Ga0373942_0025455
1136 Ga0373924_0000084
1137 Ga0373924_0001744
1138 Ga0373924_0023060
1139 Ga0373924_0029926
1140 Ga0373924_0031872
1141 Ga0373931_0013691
1142 Ga0373931_0020631
1143 Ga0373935_0004908
1144 Ga0373935_0014258
1145 Ga0373935_0038520
1146 Ga0373935_0107610
1147 Ga0373927_0018009
1148 Ga0373927_0098327
1149 Ga0373933_0000025
1150 Ga0373933_0001053
1151 Ga0373933_0014139
1152 Ga0373933_0029824
1153 Ga0373933_0107677
1154 Ga0373947_0000004
1155 Ga0373947_0003675
1156 Ga0373947_0041997
1157 Ga0373947_0070828
1158 Ga0373947_0118990
1159 Ga0373937_0000034
1160 Ga0373937_0017863
1161 Ga0373937_0031788
1162 Ga0373937_0078785
1163 Ga0373937_0119114
1164 Ga0373937_0211451
1165 Ga0373925_0000633
1166 Ga0373925_0005928
1167 Ga0373925_0012048
1168 Ga0373925_0078600
1169 Ga0373925_0117143
1170 Ga0373925_0256175
1171 Ga0373925_0291000
1172 Ga0373925_0323849
1173 Ga0395900_0004392
1174 Ga0395900_0495872
1175 Ga0395898_0001996
1176 Ga0395898_0035783
1177 Ga0395898_0434990
1178 Ga0436364_0395778
1179 Ga0436364_0502444
1180 Ga0436364_0720930
1181 Ga0436364_1069913
1182 Ga0395901_0009204
1183 Ga0395901_0021767
1184 Ga0395901_0290505
1185 Ga0395901_0704026
1186 Ga0436365_1371133
1187 Ga0436363_0546269
1188 Ga0436363_1179736
1189 Ga0436362_1121950
1190 Ga0466969_0000716
1191 Ga0466969_0002737
1192 Ga0466969_0004039
1193 Ga0466969_0011533
1194 Ga0466969_0013913
1195 Ga0466969_0016031
1196 Ga0466969_0023258
1197 Ga0466969_0101975
1198 Ga0466966_0001071
1199 Ga0466966_0015198
1200 Ga0466966_0015962
1201 Ga0466966_0027809
1202 Ga0466966_0033280
1203 Ga0466966_0259780
1204 Ga0466961_0002475
1205 Ga0466961_0002554
1206 Ga0466961_0009808
1207 Ga0466961_0022551
1208 Ga0466961_0029340
1209 Ga0466963_0005926
1210 Ga0466963_0022604
1211 Ga0466963_0026989
1212 Ga0466963_0041755
1213 Ga0466963_0048312
1214 Ga0466963_0264732
1215 Ga0466971_0000279
1216 Ga0466971_0015663
1217 Ga0466971_0069510
1218 Ga0466970_0005393
1219 Ga0466970_0014136
1220 Ga0466970_0044403
1221 Ga0466957_0127755
1222 Ga0466957_0179017
1223 Ga0466957_0306059
1224 Ga0466957_0446549
1225 Ga0466959_0000323
1226 Ga0466959_0011233
1227 Ga0466959_0051545
1228 Ga0466959_0093621
1229 Ga0466959_0105794
1230 Ga0466959_0112991
1231 Ga0466959_0125686
1232 Ga0466959_0178426
1233 Ga0466958_0007882
1234 Ga0466958_0028948
1235 Ga0466958_0045913
1236 Ga0466958_0122635
1237 Ga0466958_0177663
1238 Ga0466967_0006404
1239 Ga0466967_0014283
1240 Ga0466967_0052558
1241 Ga0466967_0154000
1242 Ga0466967_0346592
1243 Ga0495592_0000016
1244 Ga0495592_0028669
1245 Ga0495592_0103575
1246 Ga0495592_0152684
1247 Ga0495592_0219309
1248 Ga0495603_0017302
1249 Ga0495603_0157927
1250 Ga0495629_0026762
1251 Ga0495629_0069170
1252 Ga0495629_0162511
1253 Ga0495641_0006309
1254 Ga0495641_0073405
1255 Ga0495641_0096350
1256 Ga0495651_0000005
1257 Ga0495651_0002725
1258 Ga0495651_0018456
1259 Ga0495651_0032212
1260 Ga0495651_0034619
1261 Ga0495651_0060989
1262 Ga0495651_0062117
1263 Ga0495651_0137149
1264 Ga0495653_0001819
1265 Ga0495653_0003475
1266 Ga0495653_0004816
1267 Ga0495653_0018528
1268 Ga0495653_0056120
1269 Ga0495653_0062414
1270 Ga0495653_0130009
1271 Ga0495580_0044986
1272 Ga0495582_0302278
1273 Ga0495639_0003094
1274 Ga0495639_0185139
1275 Ga0495662_0002423
1276 Ga0495662_0005000
1277 Ga0495662_0020528
1278 Ga0495662_0083121
1279 Ga0495662_0124415
1280 Ga0495662_0127889
1281 Ga0495662_0128724
1282 Ga0495664_0003347
1283 Ga0495664_0101384
1284 Ga0495594_0010188
1285 Ga0495608_0000057
1286 Ga0495608_0004720
1287 Ga0495608_0093057
1288 Ga0495608_0095084
1289 Ga0495608_0199116
1290 Ga0495618_0005229
1291 Ga0495618_0019880
1292 Ga0495618_0024487
1293 Ga0495618_0060552
1294 Ga0495618_0171261
1295 Ga0495618_0291408
1296 Ga0495628_0000073
1297 Ga0495628_0020075
1298 Ga0495628_0030499
1299 Ga0495628_0054874
1300 Ga0495628_0069465
1301 Ga0495628_0070281
1302 Ga0495628_0095207
1303 Ga0495628_0153273
1304 Ga0495628_0165988
1305 Ga0495630_0006137
1306 Ga0495630_0012698
1307 Ga0495630_0026937
1308 Ga0495630_0065249
1309 Ga0495630_0096862
1310 Ga0495666_0007862
1311 Ga0495666_0029653
1312 Ga0495652_0000054
1313 Ga0495652_0013125
1314 Ga0495652_0028852
1315 Ga0495652_0053930
1316 Ga0495652_0073249
1317 Ga0495652_0150728
1318 Ga0495652_0183454
1319 Ga0495665_0001784
1320 Ga0495665_0032541
1321 Ga0495640_0002155
1322 Ga0495640_0015646
1323 Ga0495640_0017648
1324 Ga0495640_0032728
1325 Ga0495640_0054912
1326 Ga0495640_0059198
1327 Ga0495586_0004834
1328 Ga0495586_0016074
1329 Ga0495586_0062049
1330 Ga0495587_0000030
1331 Ga0495587_0002096
1332 Ga0495587_0011063
1333 Ga0495587_0012367
1334 Ga0495587_0015899
1335 Ga0495587_0037061
1336 Ga0495587_0118019
1337 Ga0495587_0137543
1338 Ga0495645_0004436
1339 Ga0495645_0020221
1340 Ga0495645_0054817
1341 Ga0495645_0054985
1342 Ga0495645_0058308
1343 Ga0495645_0138449
1344 Ga0495667_0000025
1345 Ga0495667_0000230
1346 Ga0495667_0010842
1347 Ga0495667_0012533
1348 Ga0495667_0026825
1349 Ga0495667_0038051
1350 Ga0495634_0006362
1351 Ga0495634_0006938
1352 Ga0495634_0027503
1353 Ga0495634_0194102
1354 Ga0495635_0058552
1355 Ga0495635_0110963
1356 Ga0495588_0005223
1357 Ga0495588_0047894
1358 Ga0495588_0169723
1359 Ga0495657_0000018
1360 Ga0495657_0002245
1361 Ga0495657_0028746
1362 Ga0495657_0135380
1363 Ga0495599_0000054
1364 Ga0495599_0001992
1365 Ga0495599_0009175
1366 Ga0495599_0011205
1367 Ga0495599_0038224
1368 Ga0495599_0045245
1369 Ga0495599_0046066
1370 Ga0495599_0078273
1371 Ga0495599_0087832
1372 Ga0495599_0091250
1373 Ga0495599_0121283
1374 Ga0495623_0000582
1375 Ga0495623_0037451
1376 Ga0495623_0041325
1377 Ga0495623_0043777
1378 Ga0495623_0050666
1379 Ga0495623_0064058
1380 Ga0495623_0070626
1381 Ga0495646_0005148
1382 Ga0495646_0018708
1383 Ga0495646_0021048
1384 Ga0495646_0069054
1385 Ga0495646_0100245
1386 Ga0495658_0030547
1387 Ga0495658_0039770
1388 Ga0495658_0043315
1389 Ga0495613_0009885
1390 Ga0495613_0040579
1391 Ga0495613_0044720
1392 Ga0495613_0128322
1393 Ga0495624_0006425
1394 Ga0495624_0018189
1395 Ga0495624_0134739
1396 Ga0495600_0003068
1397 Ga0495600_0004322
1398 Ga0495600_0004754
1399 Ga0495600_0015851
1400 Ga0495600_0027319
1401 Ga0495600_0040818
1402 Ga0495600_0063499
1403 Ga0495600_0084115
1404 Ga0495581_0003776
1405 Ga0495581_0007097
1406 Ga0495581_0022651
1407 Ga0495581_0029920
1408 Ga0495604_0000066
1409 Ga0495604_0002783
1410 Ga0495604_0020454
1411 Ga0495604_0032785
1412 Ga0495604_0040156
1413 Ga0495604_0044509
1414 Ga0495604_0082313
1415 Ga0495604_0086276
1416 Ga0495674_0012509
1417 Ga0495674_0023928
1418 Ga0495674_0029443
1419 Ga0495674_0233483
1420 Ga0495676_0155871
1421 Ga0495680_0000032
1422 Ga0495680_0016736
1423 Ga0495680_0044928
1424 Ga0495680_0045646
1425 Ga0495680_0053976
1426 Ga0495680_0151934
1427 Ga0495675_0002070
1428 Ga0495675_0008203
1429 Ga0495675_0018575
1430 Ga0495675_0044930
1431 Ga0495675_0098679
1432 Ga0495675_0127442
1433 Ga0495684_0004756
1434 Ga0495684_0028568
1435 Ga0495684_0073025
1436 Ga0495593_0032927
1437 Ga0495593_0086231
1438 Ga0495602_0000123
1439 Ga0495602_0048800
1440 Ga0495602_0103869
1441 Ga0495602_0164733
1442 Ga0495602_0318376
1443 Ga0495614_0022830
1444 Ga0496100_0033024
1445 Ga0496100_0204135
1446 Ga0496101_0539748
1447 Ga0496102_0104616
1448 Ga0496102_0111292
1449 Ga0496102_0185165
1450 Ga0496104_0000379
1451 Ga0496104_0004919
1452 Ga0496104_0187602
1453 Ga0496104_0360413
1454 Ga0496105_0001710
1455 Ga0496105_0024550
1456 Ga0496105_0088830
1457 Ga0496105_0106487
1458 Ga0496105_0234497
1459 Ga0496107_0053301
1460 Ga0496107_0346361
1461 Ga0496108_0009245
1462 Ga0496108_0009877
1463 Ga0496108_0048946
1464 Ga0496109_0012280
1465 Ga0496109_0118527
1466 Ga0496109_0181316
1467 Ga0496110_0246974
1468 Ga0496111_0013190
1469 Ga0496111_0056704
1470 Ga0496112_0001030
1471 Ga0496112_0053785
1472 Ga0496113_0015665
1473 Ga0496113_0016320
1474 Ga0496113_0074800
1475 Ga0496113_0269712
1476 Ga0496114_0042203
1477 Ga0496114_0108079
1478 Ga0496114_0302122
1479 Ga0496115_0030215
1480 Ga0496115_0062786
1481 Ga0496115_0155481
1482 Ga0496115_0350505
1483 Ga0496126_0048297
1484 Ga0496126_0117897
1485 Ga0496126_0135611
1486 Ga0501031_0024616
1487 Ga0501032_0150078
1488 Ga0501036_0058097
1489 Ga0501038_0101412
1490 Ga0501039_0034025
1491 Ga0501042_0139358
1492 Ga0501047_0079113
1493 Ga0501047_0450673
1494 Ga0501068_0078793
1495 Ga0501070_0002103
1496 Ga0501071_0021797
1497 Ga0501072_0141140
1498 Ga0501074_0013736
1499 Ga0501074_0277423
1500 Ga0501077_0148621
1501 Ga0501080_0190330
1502 Ga0501081_0013383
1503 Ga0501035_0184389
1504 Ga0501044_0117468
1505 Ga0501044_0538536
1506 Ga0501045_0006807
1507 nmdc:mga00v17_1767_c1
1508 nmdc:mga0yw44_1189_c1
1509 nmdc:mga0yw44_18924_c1
1510 nmdc:mga05p37_27041_c1
1511 nmdc:mga06r32_7057_c1
1512 nmdc:mga0n895_30395_c1
1513 nmdc:mga0n895_45760_c1
1514 nmdc:mga0n895_5223_c1
1515 nmdc:mga0n895_71088_c1
1516 nmdc:mga0rr50_210270_c1
1517 nmdc:mga0rr50_27751_c1
1518 nmdc:mga0rr50_4148_c1
1519 nmdc:mga08x19_401264_c1
1520 nmdc:mga08x19_60940_c1
1521 nmdc:mga08x19_91807_c1
1522 nmdc:mga0a205_184685_c1
1523 nmdc:mga0a205_97010_c1
1524 Ga0495601_0001760
1525 Ga0495601_0044321
1526 Ga0495601_0121104
1527 Ga0495601_0146427
1528 Ga0495601_0157010
1529 Ga0495612_0010669
1530 Ga0495612_0012739
1531 Ga0495612_0041530
1532 Ga0495595_0001793
1533 Ga0495595_0005217
1534 Ga0495595_0013448
1535 Ga0495595_0018784
1536 Ga0495595_0209474
1537 Ga0495619_0015572
1538 Ga0495619_0025375
1539 Ga0495619_0067693
1540 Ga0495619_0075396
1541 Ga0495619_0249611
1542 Ga0500559_0002810
1543 Ga0501084_0011073
1544 Ga0501082_0019246
1545 Ga0466962_0001198
1546 Ga0466962_0007312
1547 Ga0466962_0011153
1548 Ga0466962_0118110
1549 2515853667
1550 2644013682
1551 2644178688
1552 2676493498
1553 2776375648
1554 2858905149
1555 2863075363
1556 2866556273
1557 2867305582
1558 2867315171
1559 2867319832
1560 2884700922
1561 2895452361
1562 8056214688

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

23

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.9165 3 261
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.9078 3 287
2zcr-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 0.9012 3 287
3adz-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with intermediate pspp 0.8859 3 287
2zcr-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 0.8859 3 287
ID Description Score Start End Superfamily
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9351 1 285 1.10.600.10
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9253 1 285 1.10.600.10
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9142 3 261 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8725 7 267 1.10.600.10
af_A0A0R0HM78_74_346_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.871 3 281 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7K0JYU0-F1-model_v4 deleted 0.9737 101 290
AF-A0A7K0JYU0-F1-model_v4 deleted 0.9637 101 290
AF-A0A523Z308-F1-model_v4 Phytoene/squalene synthase family protein 0.9565 105 288 GO:0016117
GO:0051996
AF-A0A6L7WVL7-F1-model_v4 Presqualene diphosphate synthase HpnD (EC 2.5.1.103) 0.9561 1 287 GO:0004311
GO:0016117
GO:0016767
GO:0051996
AF-A0A6L7WVL7-F1-model_v4 Presqualene diphosphate synthase HpnD (EC 2.5.1.103) 0.9494 1 287 GO:0004311
GO:0016117
GO:0016767
GO:0051996

Map