F480538

General Info

Members Datasets Scaffolds Average Seq Length
780 286 1560 236

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0407949|Ga0496115_0407949_232_1080
Length 282
Sequence MTMHKGYAGSCVISCADPGRRHRLFTKPLPSRIHQADTAHLAWFRMPSVLLIEDDGVIARSIGAHLRHGGLDVEWAEDGERGLRKLRFERPDVAVVDLMLPGLDGWTVTERARAEGIVTPIIVISARGSEHDKVHALEIGADDYLAKPFGMRELLARVHAALRRSQIAPTPLRTGPIEVAGLVVDPDQQRAFLVSPSGEQHDARLTPTEFRLLCVLAQNSGRAMSRDELQQRVWNVPYRPRDRSVDVCVRKLREKIDRKATHSYLQTHYGIGYRFDPVPHAA

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 18.08
Rhizosphere 81.28
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0407949 3300048918 Bacteria 1102
2 Ga0070658_10006695 3300005327 Bacteria 9331
3 Ga0070676_10085801 3300005328 Bacteria 1919
4 Ga0070683_100000218 3300005329 Bacteria 39251
5 Ga0070683_100006622 3300005329 Bacteria 9726
6 Ga0070683_100112158 3300005329 Bacteria 2573
7 Ga0070683_100205965 3300005329 Bacteria 1868
8 Ga0070683_100691799 3300005329 Bacteria 976
9 Ga0070690_100013179 3300005330 Bacteria 4880
10 Ga0070690_100401948 3300005330 Bacteria 1006
11 Ga0070670_100128852 3300005331 Bacteria 2184
12 Ga0068869_100548183 3300005334 Bacteria 971
13 Ga0070680_100039255 3300005336 Bacteria 3832
14 Ga0070680_100093471 3300005336 Bacteria 2491
15 Ga0070680_100269582 3300005336 Bacteria 1441
16 Ga0070682_100022471 3300005337 Bacteria 3736
17 Ga0070682_100038731 3300005337 Bacteria 2925
18 Ga0070682_100098082 3300005337 Bacteria 1930
19 Ga0070682_100120023 3300005337 Bacteria 1763
20 Ga0068868_100002265 3300005338 Bacteria 13299
21 Ga0068868_100137164 3300005338 Bacteria 2006
22 Ga0070660_100002048 3300005339 Bacteria 13908
23 Ga0070660_100021496 3300005339 Bacteria 4760
24 Ga0070660_100157137 3300005339 Bacteria 1831
25 Ga0070689_100020273 3300005340 Bacteria 4931
26 Ga0070689_100615825 3300005340 Bacteria 942
27 Ga0070691_10191683 3300005341 Bacteria 1070
28 Ga0070691_10218085 3300005341 Bacteria 1010
29 Ga0070661_100191942 3300005344 Bacteria 1558
30 Ga0070661_100265365 3300005344 Bacteria 1328
31 Ga0070692_10007023 3300005345 Bacteria 4935
32 Ga0070692_10164879 3300005345 Bacteria 1272
33 Ga0070671_100124720 3300005355 Bacteria 2168
34 Ga0070671_100251602 3300005355 Bacteria 1501
35 Ga0070688_100011065 3300005365 Bacteria 5005
36 Ga0070659_100009909 3300005366 Bacteria 7008
37 Ga0070659_100040837 3300005366 Bacteria 3626
38 Ga0070714_100008603 3300005435 Bacteria 7985
39 Ga0070714_100039162 3300005435 Bacteria 3989
40 Ga0070714_100045243 3300005435 Bacteria 3730
41 Ga0070714_100067563 3300005435 Bacteria 3082
42 Ga0070714_100128045 3300005435 Bacteria 2266
43 Ga0070714_100212498 3300005435 Bacteria 1774
44 Ga0070714_100595432 3300005435 Bacteria 1061
45 Ga0070713_100081596 3300005436 Bacteria 2760
46 Ga0070713_100145743 3300005436 Bacteria 2102
47 Ga0070713_100331804 3300005436 Bacteria 1407
48 Ga0070710_10037527 3300005437 Bacteria 2656
49 Ga0070710_10404561 3300005437 Bacteria 916
50 Ga0070701_10098867 3300005438 Bacteria 1612
51 Ga0070701_10121541 3300005438 Bacteria 1472
52 Ga0070701_10228133 3300005438 Bacteria 1114
53 Ga0070711_100007331 3300005439 Bacteria 6711
54 Ga0070711_100012527 3300005439 Bacteria 5300
55 Ga0070711_100017998 3300005439 Bacteria 4505
56 Ga0070711_100209740 3300005439 Bacteria 1508
57 Ga0070711_100253782 3300005439 Bacteria 1381
58 Ga0070711_100262411 3300005439 Bacteria 1359
59 Ga0070711_100570458 3300005439 Bacteria 941
60 Ga0070705_100039471 3300005440 Bacteria 2679
61 Ga0070705_100083995 3300005440 Bacteria 1964
62 Ga0070705_100492399 3300005440 Bacteria 929
63 Ga0070700_100015502 3300005441 Bacteria 4323
64 Ga0070700_100125450 3300005441 Bacteria 1725
65 Ga0070694_100016327 3300005444 Bacteria 4674
66 Ga0070694_100141369 3300005444 Bacteria 1749
67 Ga0070663_100118016 3300005455 Bacteria 2001
68 Ga0070663_100217543 3300005455 Bacteria 1498
69 Ga0070678_100004158 3300005456 Bacteria 8161
70 Ga0070678_100008197 3300005456 Bacteria 6246
71 Ga0070678_100064627 3300005456 Bacteria 2713
72 Ga0070678_100197068 3300005456 Bacteria 1660
73 Ga0070681_10145307 3300005458 Bacteria 2301
74 Ga0068867_100095337 3300005459 Bacteria 2264
75 Ga0068867_100453824 3300005459 Bacteria 1093
76 Ga0070685_10308953 3300005466 Bacteria 1068
77 Ga0070707_100190659 3300005468 Bacteria 1999
78 Ga0070707_100828763 3300005468 Bacteria 889
79 Ga0070698_100356294 3300005471 Unclassified 1395
80 Ga0070699_100552500 3300005518 Unclassified 1048
81 Ga0070679_100010503 3300005530 Bacteria 8785
82 Ga0070679_100090243 3300005530 Bacteria 3053
83 Ga0070679_100233379 3300005530 Bacteria 1799
84 Ga0070684_100000519 3300005535 Bacteria 26402
85 Ga0070684_100000817 3300005535 Bacteria 21765
86 Ga0070684_100043270 3300005535 Bacteria 3888
87 Ga0070684_100088067 3300005535 Bacteria 2758
88 Ga0070684_100089601 3300005535 Bacteria 2734
89 Ga0070684_100121674 3300005535 Bacteria 2348
90 Ga0070684_100190222 3300005535 Bacteria 1867
91 Ga0070684_100685627 3300005535 Bacteria 955
92 Ga0070697_100473558 3300005536 Bacteria 1093
93 Ga0068853_100054280 3300005539 Bacteria 3453
94 Ga0068853_100190974 3300005539 Bacteria 1861
95 Ga0068853_100476368 3300005539 Bacteria 1176
96 Ga0070672_100056763 3300005543 Bacteria 3072
97 Ga0070686_100102994 3300005544 Bacteria 1931
98 Ga0070695_100209966 3300005545 Bacteria 1397
99 Ga0070696_100000163 3300005546 Bacteria 37742
100 Ga0070696_100067016 3300005546 Bacteria 2519
101 Ga0070696_100212901 3300005546 Bacteria 1447
102 Ga0070696_100547400 3300005546 Bacteria 927
103 Ga0070693_100003837 3300005547 Bacteria 7041
104 Ga0070693_100035335 3300005547 Bacteria 2771
105 Ga0070693_100098663 3300005547 Bacteria 1776
106 Ga0070665_100244502 3300005548 Bacteria 1795
107 Ga0070665_100341127 3300005548 Bacteria 1503
108 Ga0070665_100436223 3300005548 Bacteria 1319
109 Ga0070704_100046683 3300005549 Bacteria 3023
110 Ga0070704_100389996 3300005549 Bacteria 1186
111 Ga0068855_100018297 3300005563 Bacteria 8417
112 Ga0068855_100415797 3300005563 Bacteria 1472
113 Ga0068855_100415932 3300005563 Bacteria 1471
114 Ga0068855_100700333 3300005563 Bacteria 1084
115 Ga0070664_100048484 3300005564 Bacteria 3590
116 Ga0070664_100063388 3300005564 Bacteria 3151
117 Ga0070664_100117685 3300005564 Bacteria 2324
118 Ga0068857_100000135 3300005577 Bacteria 45022
119 Ga0068857_100001050 3300005577 Bacteria 21375
120 Ga0068857_100045690 3300005577 Bacteria 3885
121 Ga0068857_100203840 3300005577 Bacteria 1803
122 Ga0068857_100589450 3300005577 Bacteria 1050
123 Ga0068854_100070051 3300005578 Bacteria 2562
124 Ga0068854_100090934 3300005578 Bacteria 2270
125 Ga0068854_100185096 3300005578 Bacteria 1629
126 Ga0068856_100003986 3300005614 Bacteria 14792
127 Ga0068856_100044012 3300005614 Bacteria 4392
128 Ga0068856_100230411 3300005614 Bacteria 1868
129 Ga0068856_100554447 3300005614 Bacteria 1170
130 Ga0068856_100679827 3300005614 Bacteria 1050
131 Ga0070702_100003074 3300005615 Bacteria 7386
132 Ga0070702_100010545 3300005615 Bacteria 4557
133 Ga0070702_100058581 3300005615 Bacteria 2232
134 Ga0070702_100251642 3300005615 Bacteria 1198
135 Ga0070702_100276495 3300005615 Bacteria 1151
136 Ga0068852_100044717 3300005616 Bacteria 3764
137 Ga0068852_100100146 3300005616 Bacteria 2613
138 Ga0068852_100111791 3300005616 Bacteria 2484
139 Ga0068864_100162668 3300005618 Bacteria 2030
140 Ga0068864_100331452 3300005618 Bacteria 1432
141 Ga0068864_100368863 3300005618 Bacteria 1358
142 Ga0068866_10013296 3300005718 Bacteria 3608
143 Ga0068866_10051213 3300005718 Bacteria 2101
144 Ga0068851_10098684 3300005834 Bacteria 1547
145 Ga0068863_100822119 3300005841 Bacteria 927
146 Ga0068858_100146365 3300005842 Bacteria 2219
147 Ga0068858_100261134 3300005842 Bacteria 1646
148 Ga0068858_100436345 3300005842 Bacteria 1261
149 Ga0068860_100032269 3300005843 Bacteria 5033
150 Ga0068860_100057421 3300005843 Bacteria 3700
151 Ga0081455_10005352 3300005937 Bacteria 14094
152 Ga0070717_10049138 3300006028 Bacteria 3462
153 Ga0070717_10057737 3300006028 Bacteria 3208
154 Ga0070717_10058865 3300006028 Bacteria 3177
155 Ga0070717_10147453 3300006028 Bacteria 2033
156 Ga0070717_10276048 3300006028 Bacteria 1489
157 Ga0070717_10367614 3300006028 Bacteria 1288
158 Ga0075432_10006908 3300006058 Bacteria 3864
159 Ga0070715_10014718 3300006163 Bacteria 2903
160 Ga0070716_100156254 3300006173 Bacteria 1473
161 Ga0070716_100159624 3300006173 Bacteria 1460
162 Ga0070716_100203400 3300006173 Bacteria 1318
163 Ga0070716_100372323 3300006173 Bacteria 1018
164 Ga0070712_100033438 3300006175 Bacteria 3480
165 Ga0070712_100045705 3300006175 Bacteria 3024
166 Ga0070712_100250409 3300006175 Bacteria 1415
167 Ga0097621_100035508 3300006237 Bacteria 3984
168 Ga0097621_100046455 3300006237 Bacteria 3513
169 Ga0097621_100065707 3300006237 Bacteria 2986
170 Ga0068871_100016223 3300006358 Bacteria 5602
171 Ga0068871_100084072 3300006358 Bacteria 2641
172 Ga0068871_100183606 3300006358 Bacteria 1799
173 Ga0075428_100056765 3300006844 Bacteria 4287
174 Ga0075428_100093526 3300006844 Bacteria 3278
175 Ga0075428_100261766 3300006844 Bacteria 1862
176 Ga0075428_100601037 3300006844 Bacteria 1175
177 Ga0075433_10053887 3300006852 Bacteria 3508
178 Ga0075433_10308325 3300006852 Bacteria 1401
179 Ga0075433_10353693 3300006852 Bacteria 1298
180 Ga0075433_10372833 3300006852 Bacteria 1260
181 Ga0075434_100000569 3300006871 Bacteria 28397
182 Ga0075434_100001181 3300006871 Bacteria 21635
183 Ga0075434_100027039 3300006871 Bacteria 5630
184 Ga0075434_100070475 3300006871 Bacteria 3486
185 Ga0068865_100041591 3300006881 Bacteria 3129
186 Ga0068865_100163207 3300006881 Bacteria 1701
187 Ga0068865_100187718 3300006881 Bacteria 1596
188 Ga0068865_100235053 3300006881 Bacteria 1440
189 Ga0075436_100010703 3300006914 Bacteria 6291
190 Ga0075436_100030852 3300006914 Bacteria 3689
191 Ga0075436_100106676 3300006914 Bacteria 1954
192 Ga0075436_100167275 3300006914 Bacteria 1552
193 Ga0075435_100000480 3300007076 Bacteria 24310
194 Ga0075435_100023363 3300007076 Bacteria 4781
195 Ga0075435_100120600 3300007076 Bacteria 2188
196 Ga0075435_100186202 3300007076 Bacteria 1756
197 Ga0105240_10021482 3300009093 Bacteria 8583
198 Ga0105240_10057947 3300009093 Bacteria 4837
199 Ga0105240_10064056 3300009093 Bacteria 4570
200 Ga0105240_10134678 3300009093 Bacteria 2959
201 Ga0111539_10034004 3300009094 Bacteria 6184
202 Ga0111539_10441317 3300009094 Bacteria 1515
203 Ga0105245_10022841 3300009098 Bacteria 5488
204 Ga0105245_10025552 3300009098 Bacteria 5195
205 Ga0105245_10095468 3300009098 Bacteria 2743
206 Ga0105245_10142308 3300009098 Bacteria 2260
207 Ga0105245_10265653 3300009098 Bacteria 1671
208 Ga0105245_10279553 3300009098 Bacteria 1631
209 Ga0105245_10535756 3300009098 Bacteria 1191
210 Ga0105245_11080275 3300009098 Bacteria 848
211 Ga0105247_10008628 3300009101 Bacteria 6212
212 Ga0105247_10162205 3300009101 Bacteria 1481
213 Ga0105247_10405848 3300009101 Bacteria 972
214 Ga0114129_10027161 3300009147 Bacteria 8103
215 Ga0114129_10030517 3300009147 Bacteria 7627
216 Ga0114129_10166992 3300009147 Bacteria 3003
217 Ga0114129_10742717 3300009147 Bacteria 1257
218 Ga0105243_10043345 3300009148 Bacteria 3526
219 Ga0105243_10088672 3300009148 Bacteria 2542
220 Ga0105243_10206902 3300009148 Bacteria 1725
221 Ga0105243_10253943 3300009148 Bacteria 1571
222 Ga0105243_10748688 3300009148 Bacteria 958
223 Ga0105241_10021124 3300009174 Bacteria 4813
224 Ga0105241_10022695 3300009174 Bacteria 4650
225 Ga0105241_10069179 3300009174 Bacteria 2737
226 Ga0105241_10069520 3300009174 Bacteria 2730
227 Ga0105241_10430509 3300009174 Bacteria 1163
228 Ga0105242_10017540 3300009176 Bacteria 5581
229 Ga0105242_10245723 3300009176 Bacteria 1611
230 Ga0105242_10355072 3300009176 Bacteria 1355
231 Ga0105242_10780975 3300009176 Bacteria 943
232 Ga0105248_10023787 3300009177 Bacteria 6809
233 Ga0105248_10107775 3300009177 Bacteria 3142
234 Ga0105248_10108181 3300009177 Bacteria 3135
235 Ga0105248_10199382 3300009177 Bacteria 2255
236 Ga0105237_10022131 3300009545 Bacteria 6522
237 Ga0105238_10015727 3300009551 Bacteria 7660
238 Ga0105238_10075243 3300009551 Bacteria 3368
239 Ga0105249_10167802 3300009553 Bacteria 2126
240 Ga0105249_10207494 3300009553 Bacteria 1921
241 Ga0105249_10383915 3300009553 Bacteria 1431
242 Ga0105249_10553451 3300009553 Bacteria 1201
243 Ga0099796_10002213 3300010159 Bacteria 4215
244 Ga0105239_10064896 3300010375 Bacteria 4008
245 Ga0105239_10087859 3300010375 Bacteria 3427
246 Ga0105239_10364287 3300010375 Bacteria 1633
247 Ga0105239_10420604 3300010375 Bacteria 1514
248 Ga0105239_10455794 3300010375 Bacteria 1451
249 Ga0105239_10911926 3300010375 Bacteria 1009
250 Ga0105246_10008777 3300011119 Bacteria 6218
251 Ga0105246_10011257 3300011119 Bacteria 5549
252 Ga0105246_10011430 3300011119 Bacteria 5509
253 Ga0157371_10226559 3300013102 Bacteria 1343
254 Ga0157369_10148509 3300013105 Bacteria 2478
255 Ga0157369_10822674 3300013105 Bacteria 954
256 Ga0157374_10004645 3300013296 Bacteria 11518
257 Ga0157374_10365412 3300013296 Bacteria 1436
258 Ga0157378_10014302 3300013297 Bacteria 6948
259 Ga0157372_10027764 3300013307 Bacteria 6169
260 Ga0157372_10218664 3300013307 Bacteria 2208
261 Ga0157372_10729519 3300013307 Bacteria 1152
262 Ga0157375_10030657 3300013308 Bacteria 5074
263 Ga0157375_10298151 3300013308 Bacteria 1775
264 Ga0157375_10500267 3300013308 Bacteria 1380
265 Ga0163163_10004166 3300014325 Bacteria 12324
266 Ga0163163_10356642 3300014325 Bacteria 1519
267 Ga0157380_10234648 3300014326 Bacteria 1650
268 Ga0157380_10542697 3300014326 Bacteria 1139
269 Ga0157377_10065292 3300014745 Bacteria 2090
270 Ga0157377_10124155 3300014745 Bacteria 1568
271 Ga0157377_10126943 3300014745 Bacteria 1553
272 Ga0157379_10003690 3300014968 Bacteria 13018
273 Ga0157379_10020892 3300014968 Bacteria 5793
274 Ga0157379_10222967 3300014968 Bacteria 1708
275 Ga0157379_10231559 3300014968 Bacteria 1674
276 Ga0157376_10014025 3300014969 Bacteria 5999
277 Ga0157376_10037969 3300014969 Bacteria 3916
278 Ga0157376_10647543 3300014969 Bacteria 1057
279 Ga0163161_10120925 3300017792 Bacteria 1967
280 Ga0163161_10218167 3300017792 Bacteria 1476
281 Ga0163161_10359903 3300017792 Bacteria 1159
282 Ga0197907_11337543 3300020069 Bacteria 1664
283 Ga0206356_10514987 3300020070 Bacteria 1014
284 Ga0206350_11014227 3300020080 Bacteria 801
285 Ga0206354_10826566 3300020081 Bacteria 1498
286 Ga0224712_10105775 3300022467 Bacteria 1200
287 Ga0207656_10110876 3300025321 Bacteria 1268
288 Ga0207656_10125604 3300025321 Bacteria 1198
289 Ga0207656_10168925 3300025321 Bacteria 1044
290 Ga0207642_10024515 3300025899 Bacteria 2426
291 Ga0207642_10138897 3300025899 Bacteria 1278
292 Ga0207710_10183220 3300025900 Bacteria 1028
293 Ga0207688_10001897 3300025901 Bacteria 11202
294 Ga0207688_10046335 3300025901 Bacteria 2428
295 Ga0207685_10003766 3300025905 Bacteria 3743
296 Ga0207685_10035462 3300025905 Bacteria 1821
297 Ga0207699_10078613 3300025906 Bacteria 2038
298 Ga0207645_10055734 3300025907 Bacteria 2524
299 Ga0207643_10083135 3300025908 Bacteria 1857
300 Ga0207705_10039526 3300025909 Bacteria 3382
301 Ga0207707_10245001 3300025912 Bacteria 1557
302 Ga0207695_10046548 3300025913 Bacteria 4598
303 Ga0207695_10057119 3300025913 Bacteria 4057
304 Ga0207695_10058961 3300025913 Bacteria 3983
305 Ga0207695_10737917 3300025913 Bacteria 865
306 Ga0207693_10004151 3300025915 Bacteria 12288
307 Ga0207693_10065791 3300025915 Bacteria 2838
308 Ga0207693_10236907 3300025915 Bacteria 1433
309 Ga0207663_10004286 3300025916 Bacteria 7081
310 Ga0207663_10133470 3300025916 Bacteria 1719
311 Ga0207663_10268304 3300025916 Bacteria 1263
312 Ga0207663_10399118 3300025916 Bacteria 1051
313 Ga0207660_10026317 3300025917 Bacteria 3961
314 Ga0207660_10074791 3300025917 Bacteria 2473
315 Ga0207657_10002907 3300025919 Bacteria 18391
316 Ga0207657_10040793 3300025919 Bacteria 4110
317 Ga0207657_10041153 3300025919 Bacteria 4087
318 Ga0207657_10081326 3300025919 Bacteria 2721
319 Ga0207649_10353316 3300025920 Bacteria 1088
320 Ga0207652_10014242 3300025921 Bacteria 6441
321 Ga0207652_10454640 3300025921 Bacteria 1154
322 Ga0207652_10763385 3300025921 Bacteria 860
323 Ga0207646_10163865 3300025922 Bacteria 2007
324 Ga0207694_10036290 3300025924 Bacteria 3783
325 Ga0207694_10049827 3300025924 Bacteria 3242
326 Ga0207694_10127364 3300025924 Bacteria 2038
327 Ga0207650_10124735 3300025925 Bacteria 2009
328 Ga0207687_10001306 3300025927 Bacteria 17014
329 Ga0207687_10005439 3300025927 Bacteria 8423
330 Ga0207687_10024115 3300025927 Bacteria 4061
331 Ga0207687_10091379 3300025927 Bacteria 2220
332 Ga0207687_10403154 3300025927 Bacteria 1125
333 Ga0207700_10023525 3300025928 Bacteria 4249
334 Ga0207700_10109561 3300025928 Bacteria 2219
335 Ga0207700_10218362 3300025928 Bacteria 1615
336 Ga0207700_10381291 3300025928 Bacteria 1233
337 Ga0207700_10438327 3300025928 Bacteria 1150
338 Ga0207664_10006819 3300025929 Bacteria 7893
339 Ga0207664_10610824 3300025929 Bacteria 979
340 Ga0207644_10282956 3300025931 Bacteria 1332
341 Ga0207644_10317143 3300025931 Bacteria 1260
342 Ga0207690_10001884 3300025932 Bacteria 12873
343 Ga0207690_10028615 3300025932 Bacteria 3533
344 Ga0207686_10005704 3300025934 Bacteria 6674
345 Ga0207686_10007243 3300025934 Bacteria 5973
346 Ga0207686_10071384 3300025934 Bacteria 2234
347 Ga0207686_10110841 3300025934 Bacteria 1851
348 Ga0207686_10211598 3300025934 Bacteria 1394
349 Ga0207686_10511294 3300025934 Bacteria 933
350 Ga0207709_10204008 3300025935 Bacteria 1414
351 Ga0207709_10460569 3300025935 Bacteria 985
352 Ga0207670_10296133 3300025936 Bacteria 1265
353 Ga0207704_10074117 3300025938 Bacteria 2171
354 Ga0207704_10111794 3300025938 Bacteria 1848
355 Ga0207704_10264209 3300025938 Bacteria 1299
356 Ga0207704_10297802 3300025938 Bacteria 1234
357 Ga0207665_10004234 3300025939 Bacteria 9548
358 Ga0207665_10169569 3300025939 Bacteria 1575
359 Ga0207691_10170998 3300025940 Bacteria 1903
360 Ga0207691_10492195 3300025940 Bacteria 1042
361 Ga0207711_10024162 3300025941 Bacteria 5087
362 Ga0207711_10151471 3300025941 Bacteria 2093
363 Ga0207711_10247284 3300025941 Bacteria 1637
364 Ga0207689_10305712 3300025942 Bacteria 1318
365 Ga0207661_10004039 3300025944 Bacteria 10254
366 Ga0207661_10026110 3300025944 Bacteria 4447
367 Ga0207661_10152908 3300025944 Bacteria 1996
368 Ga0207661_10216301 3300025944 Bacteria 1691
369 Ga0207679_10038611 3300025945 Bacteria 3403
370 Ga0207679_10146695 3300025945 Bacteria 1915
371 Ga0207667_10052572 3300025949 Bacteria 4289
372 Ga0207667_10162907 3300025949 Bacteria 2293
373 Ga0207667_10245261 3300025949 Bacteria 1833
374 Ga0207667_10849259 3300025949 Bacteria 907
375 Ga0207651_10208110 3300025960 Bacteria 1573
376 Ga0207712_10386945 3300025961 Bacteria 1172
377 Ga0207712_10411461 3300025961 Bacteria 1139
378 Ga0207712_10617321 3300025961 Bacteria 939
379 Ga0207668_10734732 3300025972 Bacteria 870
380 Ga0207640_10139212 3300025981 Bacteria 1766
381 Ga0207640_10205467 3300025981 Bacteria 1496
382 Ga0207640_10284457 3300025981 Bacteria 1300
383 Ga0207658_10618403 3300025986 Bacteria 974
384 Ga0207677_10015846 3300026023 Bacteria 4447
385 Ga0207677_10444909 3300026023 Bacteria 1109
386 Ga0207703_10036941 3300026035 Bacteria 3890
387 Ga0207703_10244331 3300026035 Bacteria 1615
388 Ga0207639_10127751 3300026041 Bacteria 2099
389 Ga0207639_10463581 3300026041 Bacteria 1152
390 Ga0207678_10070729 3300026067 Bacteria 2991
391 Ga0207678_10079791 3300026067 Bacteria 2802
392 Ga0207678_10312501 3300026067 Bacteria 1351
393 Ga0207678_10336846 3300026067 Bacteria 1299
394 Ga0207678_10357617 3300026067 Bacteria 1260
395 Ga0207708_10012038 3300026075 Bacteria 6446
396 Ga0207708_10017591 3300026075 Bacteria 5382
397 Ga0207702_10008788 3300026078 Bacteria 8514
398 Ga0207702_10185027 3300026078 Bacteria 1921
399 Ga0207702_10740323 3300026078 Bacteria 970
400 Ga0207641_10682985 3300026088 Bacteria 1010
401 Ga0207648_10060248 3300026089 Bacteria 3310
402 Ga0207648_10664361 3300026089 Bacteria 964
403 Ga0207676_10036889 3300026095 Bacteria 3721
404 Ga0207676_10316258 3300026095 Bacteria 1431
405 Ga0207674_10001951 3300026116 Bacteria 26164
406 Ga0207674_10007032 3300026116 Bacteria 13156
407 Ga0207674_10054458 3300026116 Bacteria 4072
408 Ga0207674_10117001 3300026116 Bacteria 2636
409 Ga0207675_100167987 3300026118 Bacteria 2096
410 Ga0207683_10000767 3300026121 Bacteria 29194
411 Ga0207683_10001783 3300026121 Bacteria 19049
412 Ga0207683_10016457 3300026121 Bacteria 6294
413 Ga0207683_10026367 3300026121 Bacteria 5015
414 Ga0207683_10042118 3300026121 Bacteria 3988
415 Ga0207698_10032206 3300026142 Bacteria 3795
416 Ga0207698_10060069 3300026142 Bacteria 2955
417 Ga0207698_10092692 3300026142 Bacteria 2477
418 Ga0207428_10003094 3300027907 Bacteria 16362
419 Ga0207428_10365451 3300027907 Bacteria 1060
420 Ga0268266_10339909 3300028379 Bacteria 1409
421 Ga0268265_10455239 3300028380 Bacteria 1196
422 Ga0268264_10057079 3300028381 Bacteria 3265
423 Ga0265319_1004084 3300028563 Bacteria 7355
424 Ga0265319_1004524 3300028563 Bacteria 6861
425 Ga0265319_1049289 3300028563 Bacteria 1395
426 Ga0265334_10004671 3300028573 Bacteria 6041
427 Ga0265318_10000633 3300028577 Bacteria 24181
428 Ga0265318_10076456 3300028577 Bacteria 1238
429 Ga0265338_10013126 3300028800 Bacteria 9386
430 Ga0265338_10017133 3300028800 Bacteria 7830
431 Ga0265338_10198028 3300028800 Bacteria 1517
432 Ga0265760_10043818 3300031090 Bacteria 1338
433 Ga0265330_10002779 3300031235 Bacteria 9395
434 Ga0265332_10007895 3300031238 Bacteria 4797
435 Ga0265328_10003728 3300031239 Bacteria 6719
436 Ga0265320_10010565 3300031240 Bacteria 5487
437 Ga0265320_10045690 3300031240 Bacteria 2150
438 Ga0265320_10081873 3300031240 Bacteria 1506
439 Ga0265325_10042599 3300031241 Bacteria 2372
440 Ga0265329_10001093 3300031242 Bacteria 13312
441 Ga0265340_10003071 3300031247 Bacteria 9478
442 Ga0265339_10006107 3300031249 Bacteria 7947
443 Ga0265331_10011311 3300031250 Bacteria 4891
444 Ga0265327_10003583 3300031251 Bacteria 14664
445 Ga0265327_10018223 3300031251 Bacteria 4362
446 Ga0265316_10013122 3300031344 Bacteria 7380
447 Ga0265316_10065343 3300031344 Bacteria 2818
448 Ga0265316_10198226 3300031344 Bacteria 1489
449 Ga0265314_10040948 3300031711 Bacteria 3320
450 Ga0265342_10016793 3300031712 Bacteria 4772
451 Ga0307516_10000209 3300031730 Bacteria 75193
452 Ga0307510_10372647 3300033180 Bacteria 874
453 Ga0373944_0049043 3300035089 Bacteria 1326
454 Ga0373936_0081902 3300035113 Bacteria 1344
455 Ga0373945_0002120 3300035116 Bacteria 6188
456 Ga0373954_0020901 3300035118 Bacteria 2962
457 Ga0373954_0030591 3300035118 Bacteria 2483
458 Ga0373956_0093820 3300035119 Bacteria 1387
459 Ga0373943_0014891 3300035170 Bacteria 3529
460 Ga0373946_0011827 3300035171 Bacteria 3263
461 Ga0373955_0123873 3300035172 Bacteria 1504
462 Ga0373935_0193252 3300035692 Bacteria 1403
463 Ga0373927_0229185 3300035695 Bacteria 1221
464 Ga0373933_0225218 3300035724 Bacteria 1204
465 Ga0373933_0255925 3300035724 Bacteria 1128
466 Ga0373933_0410437 3300035724 Bacteria 884
467 Ga0373947_0002002 3300035725 Bacteria 12429
468 Ga0373947_0089875 3300035725 Bacteria 1913
469 Ga0373947_0245436 3300035725 Bacteria 1183
470 Ga0373947_0264226 3300035725 Bacteria 1141
471 Ga0373947_0265886 3300035725 Bacteria 1137
472 Ga0373937_0117659 3300036401 Bacteria 2475
473 Ga0373937_0172356 3300036401 Bacteria 2030
474 Ga0373937_0281559 3300036401 Bacteria 1570
475 Ga0373937_0373952 3300036401 Bacteria 1351
476 Ga0373925_0008556 3300037068 Bacteria 7457
477 Ga0373925_0207965 3300037068 Bacteria 1558
478 Ga0373925_0440667 3300037068 Bacteria 1066
479 Ga0395900_0076405 3300037418 Bacteria 3442
480 Ga0395900_0100780 3300037418 Bacteria 2967
481 Ga0395900_0297131 3300037418 Bacteria 1602
482 Ga0395898_0008647 3300037466 Bacteria 10740
483 Ga0395898_0013822 3300037466 Bacteria 8299
484 Ga0395898_0021914 3300037466 Bacteria 6472
485 Ga0395905_0050505 3300037471 Bacteria 3896
486 Ga0395901_0017795 3300038443 Bacteria 7252
487 Ga0395901_0071420 3300038443 Bacteria 3618
488 Ga0395901_0165360 3300038443 Bacteria 2323
489 Ga0395901_0256392 3300038443 Bacteria 1821
490 Ga0395901_0433720 3300038443 Bacteria 1346
491 Ga0242420_001628 3300038996 Bacteria 3047
492 Ga0466963_0176887 3300044694 Bacteria 1489
493 Ga0466963_0289942 3300044694 Bacteria 1150
494 Ga0466964_0193373 3300044706 Bacteria 972
495 Ga0466971_0068454 3300044719 Bacteria 1610
496 Ga0466971_0121967 3300044719 Bacteria 1207
497 Ga0466968_0013240 3300044735 Bacteria 3242
498 Ga0466957_0007847 3300044842 Bacteria 6051
499 Ga0466960_0055183 3300044901 Bacteria 1932
500 Ga0466960_0092637 3300044901 Bacteria 1543
501 Ga0466960_0245838 3300044901 Bacteria 992
502 Ga0466960_0300334 3300044901 Bacteria 904
503 Ga0466958_0180223 3300045836 Bacteria 1340
504 Ga0466958_0201920 3300045836 Bacteria 1265
505 Ga0466967_0045102 3300045976 Bacteria 3829
506 Ga0466967_0053431 3300045976 Bacteria 3550
507 Ga0466967_0191699 3300045976 Bacteria 1932
508 Ga0466967_0196852 3300045976 Bacteria 1907
509 Ga0495603_0032327 3300046455 Bacteria 3148
510 Ga0495603_0036023 3300046455 Bacteria 2971
511 Ga0495603_0045582 3300046455 Bacteria 2614
512 Ga0495603_0079712 3300046455 Bacteria 1919
513 Ga0495603_0339329 3300046455 Bacteria 862
514 Ga0495629_0037833 3300046459 Bacteria 3400
515 Ga0495629_0093363 3300046459 Bacteria 2100
516 Ga0495641_0038389 3300046461 Bacteria 2237
517 Ga0495641_0101393 3300046461 Bacteria 1284
518 Ga0495653_0007547 3300046463 Bacteria 8889
519 Ga0495653_0146622 3300046463 Bacteria 1653
520 Ga0495653_0160137 3300046463 Bacteria 1563
521 Ga0495580_0048272 3300046472 Bacteria 3015
522 Ga0495582_0002521 3300046473 Bacteria 10189
523 Ga0495582_0050636 3300046473 Bacteria 2289
524 Ga0495582_0136545 3300046473 Bacteria 1388
525 Ga0495639_0003770 3300046475 Bacteria 6515
526 Ga0495662_0006111 3300046476 Bacteria 6019
527 Ga0495662_0155506 3300046476 Bacteria 1126
528 Ga0495594_0023914 3300046499 Bacteria 3277
529 Ga0495594_0121322 3300046499 Bacteria 1478
530 Ga0495594_0137217 3300046499 Bacteria 1387
531 Ga0495608_0018824 3300046511 Bacteria 4757
532 Ga0495608_0249968 3300046511 Bacteria 1106
533 Ga0495618_0093921 3300046514 Bacteria 1918
534 Ga0495630_0251528 3300046517 Bacteria 1350
535 Ga0495652_0258865 3300046529 Bacteria 1285
536 Ga0495652_0510421 3300046529 Bacteria 832
537 Ga0495665_0001853 3300046531 Bacteria 11413
538 Ga0495640_0126130 3300046533 Bacteria 1660
539 Ga0495640_0331506 3300046533 Bacteria 941
540 Ga0495586_0053344 3300046535 Bacteria 2190
541 Ga0495587_0089662 3300046536 Bacteria 1777
542 Ga0495645_0272013 3300046543 Bacteria 1118
543 Ga0495645_0301830 3300046543 Bacteria 1046
544 Ga0495667_0002132 3300046559 Bacteria 13181
545 Ga0495667_0113613 3300046559 Bacteria 1750
546 Ga0495634_0031981 3300046642 Bacteria 3620
547 Ga0495634_0328498 3300046642 Bacteria 919
548 Ga0495635_0019902 3300046663 Bacteria 4677
549 Ga0495635_0079510 3300046663 Bacteria 2244
550 Ga0495635_0153913 3300046663 Bacteria 1565
551 Ga0495635_0166501 3300046663 Bacteria 1500
552 Ga0495588_0130593 3300046674 Bacteria 1325
553 Ga0495588_0154834 3300046674 Bacteria 1211
554 Ga0495588_0206650 3300046674 Bacteria 1037
555 Ga0495657_0017822 3300046675 Bacteria 5149
556 Ga0495657_0227665 3300046675 Bacteria 1129
557 Ga0495599_0160161 3300046678 Bacteria 1391
558 Ga0495647_0001961 3300046681 Bacteria 6419
559 Ga0495647_0076319 3300046681 Bacteria 1351
560 Ga0495658_0000424 3300046683 Bacteria 23685
561 Ga0495658_0018675 3300046683 Bacteria 3609
562 Ga0495658_0115493 3300046683 Bacteria 1618
563 Ga0495658_0291565 3300046683 Bacteria 1031
564 Ga0495613_0060927 3300046689 Bacteria 2764
565 Ga0495613_0311703 3300046689 Bacteria 1087
566 Ga0495624_0015546 3300046690 Bacteria 5136
567 Ga0495624_0048502 3300046690 Bacteria 2695
568 Ga0495670_0441649 3300046691 Bacteria 705
569 Ga0495600_0014307 3300046809 Bacteria 4998
570 Ga0495604_0045631 3300047317 Bacteria 3419
571 Ga0495674_0025336 3300047319 Bacteria 5439
572 Ga0495674_0078402 3300047319 Bacteria 2838
573 Ga0495674_0079727 3300047319 Bacteria 2811
574 Ga0495674_0088697 3300047319 Bacteria 2645
575 Ga0495674_0619792 3300047319 Bacteria 856
576 Ga0495676_0024653 3300047321 Bacteria 5203
577 Ga0495676_0082539 3300047321 Bacteria 2432
578 Ga0495676_0168830 3300047321 Bacteria 1541
579 Ga0495680_0013025 3300047322 Bacteria 7274
580 Ga0495680_0204661 3300047322 Bacteria 1415
581 Ga0495680_0354917 3300047322 Bacteria 1020
582 Ga0495675_0039146 3300047444 Bacteria 3019
583 Ga0495684_0008657 3300047471 Bacteria 7871
584 Ga0495593_0012338 3300047673 Bacteria 4882
585 Ga0495602_0041579 3300048088 Bacteria 4197
586 Ga0495602_0343444 3300048088 Bacteria 1079
587 Ga0495602_0389097 3300048088 Bacteria 997
588 Ga0495614_0006615 3300048089 Bacteria 5190
589 Ga0496100_0003698 3300048903 Bacteria 8009
590 Ga0496100_0012130 3300048903 Bacteria 4928
591 Ga0496100_0026506 3300048903 Bacteria 3554
592 Ga0496100_0026958 3300048903 Bacteria 3528
593 Ga0496100_0071376 3300048903 Bacteria 2318
594 Ga0496100_0502513 3300048903 Bacteria 934
595 Ga0496101_0003040 3300048904 Bacteria 10345
596 Ga0496101_0006947 3300048904 Bacteria 7313
597 Ga0496101_0010347 3300048904 Bacteria 6159
598 Ga0496101_0023661 3300048904 Bacteria 4245
599 Ga0496101_0089002 3300048904 Bacteria 2294
600 Ga0496101_0212935 3300048904 Bacteria 1497
601 Ga0496101_0235683 3300048904 Bacteria 1423
602 Ga0496101_0247544 3300048904 Bacteria 1388
603 Ga0496101_0359594 3300048904 Bacteria 1144
604 Ga0496102_0008915 3300048905 Bacteria 8608
605 Ga0496102_0016590 3300048905 Bacteria 6438
606 Ga0496102_0019826 3300048905 Bacteria 5928
607 Ga0496102_0022412 3300048905 Bacteria 5595
608 Ga0496102_0024265 3300048905 Bacteria 5391
609 Ga0496102_0133799 3300048905 Bacteria 2322
610 Ga0496102_0145442 3300048905 Bacteria 2225
611 Ga0496102_0659521 3300048905 Bacteria 969
612 Ga0496103_0007482 3300048906 Bacteria 6507
613 Ga0496103_0010045 3300048906 Bacteria 5596
614 Ga0496103_0060916 3300048906 Bacteria 2346
615 Ga0496103_0103564 3300048906 Bacteria 1803
616 Ga0496103_0137137 3300048906 Bacteria 1564
617 Ga0496103_0201090 3300048906 Bacteria 1281
618 Ga0496104_0013209 3300048907 Bacteria 7444
619 Ga0496104_0056689 3300048907 Bacteria 3706
620 Ga0496104_0087606 3300048907 Bacteria 2973
621 Ga0496104_0093498 3300048907 Bacteria 2876
622 Ga0496104_0128194 3300048907 Bacteria 2436
623 Ga0496104_0390566 3300048907 Bacteria 1304
624 Ga0496105_0004075 3300048908 Bacteria 10940
625 Ga0496105_0012123 3300048908 Bacteria 6825
626 Ga0496105_0013822 3300048908 Bacteria 6411
627 Ga0496105_0036333 3300048908 Bacteria 4058
628 Ga0496105_0041149 3300048908 Bacteria 3809
629 Ga0496105_0080544 3300048908 Bacteria 2690
630 Ga0496105_0152022 3300048908 Bacteria 1902
631 Ga0496105_0170500 3300048908 Bacteria 1784
632 Ga0496105_0200414 3300048908 Bacteria 1629
633 Ga0496105_0227988 3300048908 Bacteria 1515
634 Ga0496105_0270266 3300048908 Bacteria 1373
635 Ga0496106_0004433 3300048909 Bacteria 10404
636 Ga0496106_0008051 3300048909 Bacteria 7785
637 Ga0496106_0009986 3300048909 Bacteria 7010
638 Ga0496106_0018525 3300048909 Bacteria 5149
639 Ga0496106_0033647 3300048909 Bacteria 3824
640 Ga0496106_0077538 3300048909 Bacteria 2548
641 Ga0496106_0095925 3300048909 Bacteria 2294
642 Ga0496106_0125345 3300048909 Bacteria 2010
643 Ga0496106_0131781 3300048909 Bacteria 1961
644 Ga0496106_0132627 3300048909 Bacteria 1954
645 Ga0496106_0388768 3300048909 Bacteria 1121
646 Ga0496107_0002015 3300048910 Bacteria 12962
647 Ga0496107_0002467 3300048910 Bacteria 11998
648 Ga0496107_0007954 3300048910 Bacteria 7316
649 Ga0496107_0012972 3300048910 Bacteria 5822
650 Ga0496107_0014029 3300048910 Bacteria 5609
651 Ga0496107_0050106 3300048910 Bacteria 3009
652 Ga0496107_0078049 3300048910 Bacteria 2412
653 Ga0496107_0108012 3300048910 Bacteria 2043
654 Ga0496107_0268122 3300048910 Bacteria 1271
655 Ga0496108_0001510 3300048911 Bacteria 18420
656 Ga0496108_0020785 3300048911 Bacteria 5396
657 Ga0496108_0035507 3300048911 Bacteria 4145
658 Ga0496108_0058831 3300048911 Bacteria 3231
659 Ga0496108_0060842 3300048911 Bacteria 3177
660 Ga0496108_0062104 3300048911 Bacteria 3146
661 Ga0496108_0082221 3300048911 Bacteria 2730
662 Ga0496108_0204595 3300048911 Bacteria 1713
663 Ga0496108_0284049 3300048911 Bacteria 1441
664 Ga0496109_0006555 3300048912 Bacteria 9799
665 Ga0496109_0016137 3300048912 Bacteria 6527
666 Ga0496109_0020161 3300048912 Bacteria 5890
667 Ga0496109_0027779 3300048912 Bacteria 5056
668 Ga0496109_0029787 3300048912 Bacteria 4890
669 Ga0496109_0031480 3300048912 Bacteria 4760
670 Ga0496109_0066101 3300048912 Bacteria 3310
671 Ga0496109_0126359 3300048912 Bacteria 2384
672 Ga0496109_0280084 3300048912 Bacteria 1572
673 Ga0496109_0282356 3300048912 Bacteria 1565
674 Ga0496109_0342246 3300048912 Bacteria 1412
675 Ga0496109_0404028 3300048912 Bacteria 1290
676 Ga0496110_0004353 3300048913 Bacteria 10961
677 Ga0496110_0042245 3300048913 Bacteria 3979
678 Ga0496110_0046249 3300048913 Bacteria 3807
679 Ga0496110_0135425 3300048913 Bacteria 2226
680 Ga0496110_0271349 3300048913 Bacteria 1544
681 Ga0496110_0422365 3300048913 Bacteria 1215
682 Ga0496111_0001954 3300048914 Bacteria 12230
683 Ga0496111_0003726 3300048914 Bacteria 9487
684 Ga0496111_0014707 3300048914 Bacteria 5353
685 Ga0496111_0096277 3300048914 Bacteria 2172
686 Ga0496111_0210621 3300048914 Bacteria 1444
687 Ga0496111_0250731 3300048914 Bacteria 1314
688 Ga0496111_0266046 3300048914 Bacteria 1272
689 Ga0496111_0552712 3300048914 Bacteria 845
690 Ga0496112_0001296 3300048915 Bacteria 18991
691 Ga0496112_0024061 3300048915 Bacteria 5828
692 Ga0496112_0033057 3300048915 Bacteria 5024
693 Ga0496112_0137351 3300048915 Bacteria 2415
694 Ga0496112_0150312 3300048915 Bacteria 2296
695 Ga0496112_0273348 3300048915 Bacteria 1638
696 Ga0496112_0340368 3300048915 Bacteria 1443
697 Ga0496112_0389835 3300048915 Bacteria 1333
698 Ga0496112_0663982 3300048915 Bacteria 972
699 Ga0496113_0013874 3300048916 Bacteria 5476
700 Ga0496113_0018058 3300048916 Bacteria 4907
701 Ga0496113_0065048 3300048916 Bacteria 2759
702 Ga0496113_0122916 3300048916 Bacteria 2031
703 Ga0496113_0125063 3300048916 Bacteria 2013
704 Ga0496114_0002619 3300048917 Bacteria 13729
705 Ga0496114_0008217 3300048917 Bacteria 8270
706 Ga0496114_0008976 3300048917 Bacteria 7928
707 Ga0496114_0010890 3300048917 Bacteria 7246
708 Ga0496114_0020656 3300048917 Bacteria 5345
709 Ga0496114_0021982 3300048917 Bacteria 5193
710 Ga0496114_0031376 3300048917 Bacteria 4373
711 Ga0496114_0043501 3300048917 Bacteria 3724
712 Ga0496114_0049651 3300048917 Bacteria 3491
713 Ga0496114_0051368 3300048917 Bacteria 3432
714 Ga0496114_0053612 3300048917 Bacteria 3361
715 Ga0496114_0075009 3300048917 Bacteria 2848
716 Ga0496115_0001827 3300048918 Bacteria 15235
717 Ga0496115_0015867 3300048918 Bacteria 5723
718 Ga0496115_0017905 3300048918 Bacteria 5427
719 Ga0496115_0026245 3300048918 Bacteria 4545
720 Ga0496115_0039163 3300048918 Bacteria 3764
721 Ga0496115_0048682 3300048918 Bacteria 3390
722 Ga0496115_0049072 3300048918 Bacteria 3377
723 Ga0496115_0081747 3300048918 Bacteria 2631
724 Ga0496115_0185534 3300048918 Bacteria 1719
725 Ga0496115_0270651 3300048918 Bacteria 1396
726 Ga0496115_0554416 3300048918 Unclassified 918
727 Ga0496115_0622999 3300048918 Bacteria 856
728 Ga0496115_0720871 3300048918 Bacteria 782
729 Ga0496126_0089364 3300048929 Bacteria 2712
730 Ga0501036_0145122 3300049572 Bacteria 2002
731 Ga0501040_0270291 3300049576 Bacteria 1214
732 Ga0501067_0000031 3300049583 Bacteria 87732
733 Ga0501067_0000179 3300049583 Bacteria 35841
734 Ga0501067_0002096 3300049583 Bacteria 10987
735 Ga0501067_0141029 3300049583 Bacteria 1342
736 Ga0501068_0000010 3300049584 Bacteria 66003
737 Ga0501068_0000226 3300049584 Bacteria 27345
738 Ga0501069_0000029 3300049585 Bacteria 105687
739 Ga0501069_0000032 3300049585 Bacteria 96425
740 Ga0501069_0105231 3300049585 Bacteria 1603
741 Ga0501070_0008602 3300049586 Bacteria 8631
742 Ga0501070_0050447 3300049586 Bacteria 3455
743 Ga0501071_0010637 3300049587 Bacteria 6172
744 Ga0501071_0310632 3300049587 Bacteria 1196
745 Ga0501081_0192568 3300049743 Bacteria 1477
746 nmdc:mga05p37_590809_c1 3300050507 Bacteria 1255
747 nmdc:mga05p37_62982_c1 3300050507 Bacteria 4565
748 nmdc:mga06r32_67730_c1 3300050510 Bacteria 3447
749 nmdc:mga08y16_510636_c1 3300050511 Bacteria 1220
750 nmdc:mga08y16_82115_c1 3300050511 Bacteria 3360
751 nmdc:mga0n895_246130_c1 3300050512 Bacteria 1815
752 nmdc:mga0n895_431_c1 3300050512 Bacteria 28183
753 nmdc:mga0n895_449_c1 3300050512 Bacteria 27620
754 nmdc:mga0n895_50747_c1 3300050512 Bacteria 4068
755 nmdc:mga0n895_8056_c1 3300050512 Bacteria 9094
756 nmdc:mga0rr50_1670_c1 3300050513 Bacteria 12225
757 nmdc:mga0rr50_271459_c1 3300050513 Bacteria 1414
758 nmdc:mga0rr50_288330_c1 3300050513 Bacteria 1371
759 nmdc:mga0rr50_96285_c1 3300050513 Bacteria 2316
760 nmdc:mga08x19_132955_c1 3300050514 Bacteria 1675
761 nmdc:mga08x19_20397_c1 3300050514 Bacteria 4081
762 nmdc:mga08x19_25380_c1 3300050514 Bacteria 3691
763 nmdc:mga08x19_54204_c1 3300050514 Bacteria 2580
764 nmdc:mga0a205_195703_c1 3300050515 Bacteria 1913
765 nmdc:mga0a205_334814_c1 3300050515 Bacteria 1383
766 nmdc:mga0a205_73491_c1 3300050515 Bacteria 3303
767 Ga0495601_0052304 3300053077 Bacteria 2578
768 Ga0495601_0222122 3300053077 Bacteria 1234
769 Ga0495601_0226500 3300053077 Bacteria 1221
770 Ga0495601_0385448 3300053077 Bacteria 909
771 Ga0495612_0083488 3300053078 Bacteria 1344
772 Ga0495612_0126233 3300053078 Bacteria 1103
773 Ga0500635_0012534 3300053080 Bacteria 2438
774 Ga0495595_0051108 3300053084 Bacteria 1915
775 Ga0495595_0189318 3300053084 Bacteria 1022
776 Ga0495619_0216755 3300053085 Bacteria 1326
777 Ga0495619_0221963 3300053085 Bacteria 1309
778 Ga0500645_054578 3300053730 Bacteria 1162
779 Ga0530510_0000745 3300061734 Bacteria 21090
780 Ga0530510_0125785 3300061734 Bacteria 1884
781 Ga0496115_0407949
782 Ga0070658_10006695
783 Ga0070676_10085801
784 Ga0070683_100000218
785 Ga0070683_100006622
786 Ga0070683_100112158
787 Ga0070683_100205965
788 Ga0070683_100691799
789 Ga0070690_100013179
790 Ga0070690_100401948
791 Ga0070670_100128852
792 Ga0068869_100548183
793 Ga0070680_100039255
794 Ga0070680_100093471
795 Ga0070680_100269582
796 Ga0070682_100022471
797 Ga0070682_100038731
798 Ga0070682_100098082
799 Ga0070682_100120023
800 Ga0068868_100002265
801 Ga0068868_100137164
802 Ga0070660_100002048
803 Ga0070660_100021496
804 Ga0070660_100157137
805 Ga0070689_100020273
806 Ga0070689_100615825
807 Ga0070691_10191683
808 Ga0070691_10218085
809 Ga0070661_100191942
810 Ga0070661_100265365
811 Ga0070692_10007023
812 Ga0070692_10164879
813 Ga0070671_100124720
814 Ga0070671_100251602
815 Ga0070688_100011065
816 Ga0070659_100009909
817 Ga0070659_100040837
818 Ga0070714_100008603
819 Ga0070714_100039162
820 Ga0070714_100045243
821 Ga0070714_100067563
822 Ga0070714_100128045
823 Ga0070714_100212498
824 Ga0070714_100595432
825 Ga0070713_100081596
826 Ga0070713_100145743
827 Ga0070713_100331804
828 Ga0070710_10037527
829 Ga0070710_10404561
830 Ga0070701_10098867
831 Ga0070701_10121541
832 Ga0070701_10228133
833 Ga0070711_100007331
834 Ga0070711_100012527
835 Ga0070711_100017998
836 Ga0070711_100209740
837 Ga0070711_100253782
838 Ga0070711_100262411
839 Ga0070711_100570458
840 Ga0070705_100039471
841 Ga0070705_100083995
842 Ga0070705_100492399
843 Ga0070700_100015502
844 Ga0070700_100125450
845 Ga0070694_100016327
846 Ga0070694_100141369
847 Ga0070663_100118016
848 Ga0070663_100217543
849 Ga0070678_100004158
850 Ga0070678_100008197
851 Ga0070678_100064627
852 Ga0070678_100197068
853 Ga0070681_10145307
854 Ga0068867_100095337
855 Ga0068867_100453824
856 Ga0070685_10308953
857 Ga0070707_100190659
858 Ga0070707_100828763
859 Ga0070698_100356294
860 Ga0070699_100552500
861 Ga0070679_100010503
862 Ga0070679_100090243
863 Ga0070679_100233379
864 Ga0070684_100000519
865 Ga0070684_100000817
866 Ga0070684_100043270
867 Ga0070684_100088067
868 Ga0070684_100089601
869 Ga0070684_100121674
870 Ga0070684_100190222
871 Ga0070684_100685627
872 Ga0070697_100473558
873 Ga0068853_100054280
874 Ga0068853_100190974
875 Ga0068853_100476368
876 Ga0070672_100056763
877 Ga0070686_100102994
878 Ga0070695_100209966
879 Ga0070696_100000163
880 Ga0070696_100067016
881 Ga0070696_100212901
882 Ga0070696_100547400
883 Ga0070693_100003837
884 Ga0070693_100035335
885 Ga0070693_100098663
886 Ga0070665_100244502
887 Ga0070665_100341127
888 Ga0070665_100436223
889 Ga0070704_100046683
890 Ga0070704_100389996
891 Ga0068855_100018297
892 Ga0068855_100415797
893 Ga0068855_100415932
894 Ga0068855_100700333
895 Ga0070664_100048484
896 Ga0070664_100063388
897 Ga0070664_100117685
898 Ga0068857_100000135
899 Ga0068857_100001050
900 Ga0068857_100045690
901 Ga0068857_100203840
902 Ga0068857_100589450
903 Ga0068854_100070051
904 Ga0068854_100090934
905 Ga0068854_100185096
906 Ga0068856_100003986
907 Ga0068856_100044012
908 Ga0068856_100230411
909 Ga0068856_100554447
910 Ga0068856_100679827
911 Ga0070702_100003074
912 Ga0070702_100010545
913 Ga0070702_100058581
914 Ga0070702_100251642
915 Ga0070702_100276495
916 Ga0068852_100044717
917 Ga0068852_100100146
918 Ga0068852_100111791
919 Ga0068864_100162668
920 Ga0068864_100331452
921 Ga0068864_100368863
922 Ga0068866_10013296
923 Ga0068866_10051213
924 Ga0068851_10098684
925 Ga0068863_100822119
926 Ga0068858_100146365
927 Ga0068858_100261134
928 Ga0068858_100436345
929 Ga0068860_100032269
930 Ga0068860_100057421
931 Ga0081455_10005352
932 Ga0070717_10049138
933 Ga0070717_10057737
934 Ga0070717_10058865
935 Ga0070717_10147453
936 Ga0070717_10276048
937 Ga0070717_10367614
938 Ga0075432_10006908
939 Ga0070715_10014718
940 Ga0070716_100156254
941 Ga0070716_100159624
942 Ga0070716_100203400
943 Ga0070716_100372323
944 Ga0070712_100033438
945 Ga0070712_100045705
946 Ga0070712_100250409
947 Ga0097621_100035508
948 Ga0097621_100046455
949 Ga0097621_100065707
950 Ga0068871_100016223
951 Ga0068871_100084072
952 Ga0068871_100183606
953 Ga0075428_100056765
954 Ga0075428_100093526
955 Ga0075428_100261766
956 Ga0075428_100601037
957 Ga0075433_10053887
958 Ga0075433_10308325
959 Ga0075433_10353693
960 Ga0075433_10372833
961 Ga0075434_100000569
962 Ga0075434_100001181
963 Ga0075434_100027039
964 Ga0075434_100070475
965 Ga0068865_100041591
966 Ga0068865_100163207
967 Ga0068865_100187718
968 Ga0068865_100235053
969 Ga0075436_100010703
970 Ga0075436_100030852
971 Ga0075436_100106676
972 Ga0075436_100167275
973 Ga0075435_100000480
974 Ga0075435_100023363
975 Ga0075435_100120600
976 Ga0075435_100186202
977 Ga0105240_10021482
978 Ga0105240_10057947
979 Ga0105240_10064056
980 Ga0105240_10134678
981 Ga0111539_10034004
982 Ga0111539_10441317
983 Ga0105245_10022841
984 Ga0105245_10025552
985 Ga0105245_10095468
986 Ga0105245_10142308
987 Ga0105245_10265653
988 Ga0105245_10279553
989 Ga0105245_10535756
990 Ga0105245_11080275
991 Ga0105247_10008628
992 Ga0105247_10162205
993 Ga0105247_10405848
994 Ga0114129_10027161
995 Ga0114129_10030517
996 Ga0114129_10166992
997 Ga0114129_10742717
998 Ga0105243_10043345
999 Ga0105243_10088672
1000 Ga0105243_10206902
1001 Ga0105243_10253943
1002 Ga0105243_10748688
1003 Ga0105241_10021124
1004 Ga0105241_10022695
1005 Ga0105241_10069179
1006 Ga0105241_10069520
1007 Ga0105241_10430509
1008 Ga0105242_10017540
1009 Ga0105242_10245723
1010 Ga0105242_10355072
1011 Ga0105242_10780975
1012 Ga0105248_10023787
1013 Ga0105248_10107775
1014 Ga0105248_10108181
1015 Ga0105248_10199382
1016 Ga0105237_10022131
1017 Ga0105238_10015727
1018 Ga0105238_10075243
1019 Ga0105249_10167802
1020 Ga0105249_10207494
1021 Ga0105249_10383915
1022 Ga0105249_10553451
1023 Ga0099796_10002213
1024 Ga0105239_10064896
1025 Ga0105239_10087859
1026 Ga0105239_10364287
1027 Ga0105239_10420604
1028 Ga0105239_10455794
1029 Ga0105239_10911926
1030 Ga0105246_10008777
1031 Ga0105246_10011257
1032 Ga0105246_10011430
1033 Ga0157371_10226559
1034 Ga0157369_10148509
1035 Ga0157369_10822674
1036 Ga0157374_10004645
1037 Ga0157374_10365412
1038 Ga0157378_10014302
1039 Ga0157372_10027764
1040 Ga0157372_10218664
1041 Ga0157372_10729519
1042 Ga0157375_10030657
1043 Ga0157375_10298151
1044 Ga0157375_10500267
1045 Ga0163163_10004166
1046 Ga0163163_10356642
1047 Ga0157380_10234648
1048 Ga0157380_10542697
1049 Ga0157377_10065292
1050 Ga0157377_10124155
1051 Ga0157377_10126943
1052 Ga0157379_10003690
1053 Ga0157379_10020892
1054 Ga0157379_10222967
1055 Ga0157379_10231559
1056 Ga0157376_10014025
1057 Ga0157376_10037969
1058 Ga0157376_10647543
1059 Ga0163161_10120925
1060 Ga0163161_10218167
1061 Ga0163161_10359903
1062 Ga0197907_11337543
1063 Ga0206356_10514987
1064 Ga0206350_11014227
1065 Ga0206354_10826566
1066 Ga0224712_10105775
1067 Ga0207656_10110876
1068 Ga0207656_10125604
1069 Ga0207656_10168925
1070 Ga0207642_10024515
1071 Ga0207642_10138897
1072 Ga0207710_10183220
1073 Ga0207688_10001897
1074 Ga0207688_10046335
1075 Ga0207685_10003766
1076 Ga0207685_10035462
1077 Ga0207699_10078613
1078 Ga0207645_10055734
1079 Ga0207643_10083135
1080 Ga0207705_10039526
1081 Ga0207707_10245001
1082 Ga0207695_10046548
1083 Ga0207695_10057119
1084 Ga0207695_10058961
1085 Ga0207695_10737917
1086 Ga0207693_10004151
1087 Ga0207693_10065791
1088 Ga0207693_10236907
1089 Ga0207663_10004286
1090 Ga0207663_10133470
1091 Ga0207663_10268304
1092 Ga0207663_10399118
1093 Ga0207660_10026317
1094 Ga0207660_10074791
1095 Ga0207657_10002907
1096 Ga0207657_10040793
1097 Ga0207657_10041153
1098 Ga0207657_10081326
1099 Ga0207649_10353316
1100 Ga0207652_10014242
1101 Ga0207652_10454640
1102 Ga0207652_10763385
1103 Ga0207646_10163865
1104 Ga0207694_10036290
1105 Ga0207694_10049827
1106 Ga0207694_10127364
1107 Ga0207650_10124735
1108 Ga0207687_10001306
1109 Ga0207687_10005439
1110 Ga0207687_10024115
1111 Ga0207687_10091379
1112 Ga0207687_10403154
1113 Ga0207700_10023525
1114 Ga0207700_10109561
1115 Ga0207700_10218362
1116 Ga0207700_10381291
1117 Ga0207700_10438327
1118 Ga0207664_10006819
1119 Ga0207664_10610824
1120 Ga0207644_10282956
1121 Ga0207644_10317143
1122 Ga0207690_10001884
1123 Ga0207690_10028615
1124 Ga0207686_10005704
1125 Ga0207686_10007243
1126 Ga0207686_10071384
1127 Ga0207686_10110841
1128 Ga0207686_10211598
1129 Ga0207686_10511294
1130 Ga0207709_10204008
1131 Ga0207709_10460569
1132 Ga0207670_10296133
1133 Ga0207704_10074117
1134 Ga0207704_10111794
1135 Ga0207704_10264209
1136 Ga0207704_10297802
1137 Ga0207665_10004234
1138 Ga0207665_10169569
1139 Ga0207691_10170998
1140 Ga0207691_10492195
1141 Ga0207711_10024162
1142 Ga0207711_10151471
1143 Ga0207711_10247284
1144 Ga0207689_10305712
1145 Ga0207661_10004039
1146 Ga0207661_10026110
1147 Ga0207661_10152908
1148 Ga0207661_10216301
1149 Ga0207679_10038611
1150 Ga0207679_10146695
1151 Ga0207667_10052572
1152 Ga0207667_10162907
1153 Ga0207667_10245261
1154 Ga0207667_10849259
1155 Ga0207651_10208110
1156 Ga0207712_10386945
1157 Ga0207712_10411461
1158 Ga0207712_10617321
1159 Ga0207668_10734732
1160 Ga0207640_10139212
1161 Ga0207640_10205467
1162 Ga0207640_10284457
1163 Ga0207658_10618403
1164 Ga0207677_10015846
1165 Ga0207677_10444909
1166 Ga0207703_10036941
1167 Ga0207703_10244331
1168 Ga0207639_10127751
1169 Ga0207639_10463581
1170 Ga0207678_10070729
1171 Ga0207678_10079791
1172 Ga0207678_10312501
1173 Ga0207678_10336846
1174 Ga0207678_10357617
1175 Ga0207708_10012038
1176 Ga0207708_10017591
1177 Ga0207702_10008788
1178 Ga0207702_10185027
1179 Ga0207702_10740323
1180 Ga0207641_10682985
1181 Ga0207648_10060248
1182 Ga0207648_10664361
1183 Ga0207676_10036889
1184 Ga0207676_10316258
1185 Ga0207674_10001951
1186 Ga0207674_10007032
1187 Ga0207674_10054458
1188 Ga0207674_10117001
1189 Ga0207675_100167987
1190 Ga0207683_10000767
1191 Ga0207683_10001783
1192 Ga0207683_10016457
1193 Ga0207683_10026367
1194 Ga0207683_10042118
1195 Ga0207698_10032206
1196 Ga0207698_10060069
1197 Ga0207698_10092692
1198 Ga0207428_10003094
1199 Ga0207428_10365451
1200 Ga0268266_10339909
1201 Ga0268265_10455239
1202 Ga0268264_10057079
1203 Ga0265319_1004084
1204 Ga0265319_1004524
1205 Ga0265319_1049289
1206 Ga0265334_10004671
1207 Ga0265318_10000633
1208 Ga0265318_10076456
1209 Ga0265338_10013126
1210 Ga0265338_10017133
1211 Ga0265338_10198028
1212 Ga0265760_10043818
1213 Ga0265330_10002779
1214 Ga0265332_10007895
1215 Ga0265328_10003728
1216 Ga0265320_10010565
1217 Ga0265320_10045690
1218 Ga0265320_10081873
1219 Ga0265325_10042599
1220 Ga0265329_10001093
1221 Ga0265340_10003071
1222 Ga0265339_10006107
1223 Ga0265331_10011311
1224 Ga0265327_10003583
1225 Ga0265327_10018223
1226 Ga0265316_10013122
1227 Ga0265316_10065343
1228 Ga0265316_10198226
1229 Ga0265314_10040948
1230 Ga0265342_10016793
1231 Ga0307516_10000209
1232 Ga0307510_10372647
1233 Ga0373944_0049043
1234 Ga0373936_0081902
1235 Ga0373945_0002120
1236 Ga0373954_0020901
1237 Ga0373954_0030591
1238 Ga0373956_0093820
1239 Ga0373943_0014891
1240 Ga0373946_0011827
1241 Ga0373955_0123873
1242 Ga0373935_0193252
1243 Ga0373927_0229185
1244 Ga0373933_0225218
1245 Ga0373933_0255925
1246 Ga0373933_0410437
1247 Ga0373947_0002002
1248 Ga0373947_0089875
1249 Ga0373947_0245436
1250 Ga0373947_0264226
1251 Ga0373947_0265886
1252 Ga0373937_0117659
1253 Ga0373937_0172356
1254 Ga0373937_0281559
1255 Ga0373937_0373952
1256 Ga0373925_0008556
1257 Ga0373925_0207965
1258 Ga0373925_0440667
1259 Ga0395900_0076405
1260 Ga0395900_0100780
1261 Ga0395900_0297131
1262 Ga0395898_0008647
1263 Ga0395898_0013822
1264 Ga0395898_0021914
1265 Ga0395905_0050505
1266 Ga0395901_0017795
1267 Ga0395901_0071420
1268 Ga0395901_0165360
1269 Ga0395901_0256392
1270 Ga0395901_0433720
1271 Ga0242420_001628
1272 Ga0466963_0176887
1273 Ga0466963_0289942
1274 Ga0466964_0193373
1275 Ga0466971_0068454
1276 Ga0466971_0121967
1277 Ga0466968_0013240
1278 Ga0466957_0007847
1279 Ga0466960_0055183
1280 Ga0466960_0092637
1281 Ga0466960_0245838
1282 Ga0466960_0300334
1283 Ga0466958_0180223
1284 Ga0466958_0201920
1285 Ga0466967_0045102
1286 Ga0466967_0053431
1287 Ga0466967_0191699
1288 Ga0466967_0196852
1289 Ga0495603_0032327
1290 Ga0495603_0036023
1291 Ga0495603_0045582
1292 Ga0495603_0079712
1293 Ga0495603_0339329
1294 Ga0495629_0037833
1295 Ga0495629_0093363
1296 Ga0495641_0038389
1297 Ga0495641_0101393
1298 Ga0495653_0007547
1299 Ga0495653_0146622
1300 Ga0495653_0160137
1301 Ga0495580_0048272
1302 Ga0495582_0002521
1303 Ga0495582_0050636
1304 Ga0495582_0136545
1305 Ga0495639_0003770
1306 Ga0495662_0006111
1307 Ga0495662_0155506
1308 Ga0495594_0023914
1309 Ga0495594_0121322
1310 Ga0495594_0137217
1311 Ga0495608_0018824
1312 Ga0495608_0249968
1313 Ga0495618_0093921
1314 Ga0495630_0251528
1315 Ga0495652_0258865
1316 Ga0495652_0510421
1317 Ga0495665_0001853
1318 Ga0495640_0126130
1319 Ga0495640_0331506
1320 Ga0495586_0053344
1321 Ga0495587_0089662
1322 Ga0495645_0272013
1323 Ga0495645_0301830
1324 Ga0495667_0002132
1325 Ga0495667_0113613
1326 Ga0495634_0031981
1327 Ga0495634_0328498
1328 Ga0495635_0019902
1329 Ga0495635_0079510
1330 Ga0495635_0153913
1331 Ga0495635_0166501
1332 Ga0495588_0130593
1333 Ga0495588_0154834
1334 Ga0495588_0206650
1335 Ga0495657_0017822
1336 Ga0495657_0227665
1337 Ga0495599_0160161
1338 Ga0495647_0001961
1339 Ga0495647_0076319
1340 Ga0495658_0000424
1341 Ga0495658_0018675
1342 Ga0495658_0115493
1343 Ga0495658_0291565
1344 Ga0495613_0060927
1345 Ga0495613_0311703
1346 Ga0495624_0015546
1347 Ga0495624_0048502
1348 Ga0495670_0441649
1349 Ga0495600_0014307
1350 Ga0495604_0045631
1351 Ga0495674_0025336
1352 Ga0495674_0078402
1353 Ga0495674_0079727
1354 Ga0495674_0088697
1355 Ga0495674_0619792
1356 Ga0495676_0024653
1357 Ga0495676_0082539
1358 Ga0495676_0168830
1359 Ga0495680_0013025
1360 Ga0495680_0204661
1361 Ga0495680_0354917
1362 Ga0495675_0039146
1363 Ga0495684_0008657
1364 Ga0495593_0012338
1365 Ga0495602_0041579
1366 Ga0495602_0343444
1367 Ga0495602_0389097
1368 Ga0495614_0006615
1369 Ga0496100_0003698
1370 Ga0496100_0012130
1371 Ga0496100_0026506
1372 Ga0496100_0026958
1373 Ga0496100_0071376
1374 Ga0496100_0502513
1375 Ga0496101_0003040
1376 Ga0496101_0006947
1377 Ga0496101_0010347
1378 Ga0496101_0023661
1379 Ga0496101_0089002
1380 Ga0496101_0212935
1381 Ga0496101_0235683
1382 Ga0496101_0247544
1383 Ga0496101_0359594
1384 Ga0496102_0008915
1385 Ga0496102_0016590
1386 Ga0496102_0019826
1387 Ga0496102_0022412
1388 Ga0496102_0024265
1389 Ga0496102_0133799
1390 Ga0496102_0145442
1391 Ga0496102_0659521
1392 Ga0496103_0007482
1393 Ga0496103_0010045
1394 Ga0496103_0060916
1395 Ga0496103_0103564
1396 Ga0496103_0137137
1397 Ga0496103_0201090
1398 Ga0496104_0013209
1399 Ga0496104_0056689
1400 Ga0496104_0087606
1401 Ga0496104_0093498
1402 Ga0496104_0128194
1403 Ga0496104_0390566
1404 Ga0496105_0004075
1405 Ga0496105_0012123
1406 Ga0496105_0013822
1407 Ga0496105_0036333
1408 Ga0496105_0041149
1409 Ga0496105_0080544
1410 Ga0496105_0152022
1411 Ga0496105_0170500
1412 Ga0496105_0200414
1413 Ga0496105_0227988
1414 Ga0496105_0270266
1415 Ga0496106_0004433
1416 Ga0496106_0008051
1417 Ga0496106_0009986
1418 Ga0496106_0018525
1419 Ga0496106_0033647
1420 Ga0496106_0077538
1421 Ga0496106_0095925
1422 Ga0496106_0125345
1423 Ga0496106_0131781
1424 Ga0496106_0132627
1425 Ga0496106_0388768
1426 Ga0496107_0002015
1427 Ga0496107_0002467
1428 Ga0496107_0007954
1429 Ga0496107_0012972
1430 Ga0496107_0014029
1431 Ga0496107_0050106
1432 Ga0496107_0078049
1433 Ga0496107_0108012
1434 Ga0496107_0268122
1435 Ga0496108_0001510
1436 Ga0496108_0020785
1437 Ga0496108_0035507
1438 Ga0496108_0058831
1439 Ga0496108_0060842
1440 Ga0496108_0062104
1441 Ga0496108_0082221
1442 Ga0496108_0204595
1443 Ga0496108_0284049
1444 Ga0496109_0006555
1445 Ga0496109_0016137
1446 Ga0496109_0020161
1447 Ga0496109_0027779
1448 Ga0496109_0029787
1449 Ga0496109_0031480
1450 Ga0496109_0066101
1451 Ga0496109_0126359
1452 Ga0496109_0280084
1453 Ga0496109_0282356
1454 Ga0496109_0342246
1455 Ga0496109_0404028
1456 Ga0496110_0004353
1457 Ga0496110_0042245
1458 Ga0496110_0046249
1459 Ga0496110_0135425
1460 Ga0496110_0271349
1461 Ga0496110_0422365
1462 Ga0496111_0001954
1463 Ga0496111_0003726
1464 Ga0496111_0014707
1465 Ga0496111_0096277
1466 Ga0496111_0210621
1467 Ga0496111_0250731
1468 Ga0496111_0266046
1469 Ga0496111_0552712
1470 Ga0496112_0001296
1471 Ga0496112_0024061
1472 Ga0496112_0033057
1473 Ga0496112_0137351
1474 Ga0496112_0150312
1475 Ga0496112_0273348
1476 Ga0496112_0340368
1477 Ga0496112_0389835
1478 Ga0496112_0663982
1479 Ga0496113_0013874
1480 Ga0496113_0018058
1481 Ga0496113_0065048
1482 Ga0496113_0122916
1483 Ga0496113_0125063
1484 Ga0496114_0002619
1485 Ga0496114_0008217
1486 Ga0496114_0008976
1487 Ga0496114_0010890
1488 Ga0496114_0020656
1489 Ga0496114_0021982
1490 Ga0496114_0031376
1491 Ga0496114_0043501
1492 Ga0496114_0049651
1493 Ga0496114_0051368
1494 Ga0496114_0053612
1495 Ga0496114_0075009
1496 Ga0496115_0001827
1497 Ga0496115_0015867
1498 Ga0496115_0017905
1499 Ga0496115_0026245
1500 Ga0496115_0039163
1501 Ga0496115_0048682
1502 Ga0496115_0049072
1503 Ga0496115_0081747
1504 Ga0496115_0185534
1505 Ga0496115_0270651
1506 Ga0496115_0554416
1507 Ga0496115_0622999
1508 Ga0496115_0720871
1509 Ga0496126_0089364
1510 Ga0501036_0145122
1511 Ga0501040_0270291
1512 Ga0501067_0000031
1513 Ga0501067_0000179
1514 Ga0501067_0002096
1515 Ga0501067_0141029
1516 Ga0501068_0000010
1517 Ga0501068_0000226
1518 Ga0501069_0000029
1519 Ga0501069_0000032
1520 Ga0501069_0105231
1521 Ga0501070_0008602
1522 Ga0501070_0050447
1523 Ga0501071_0010637
1524 Ga0501071_0310632
1525 Ga0501081_0192568
1526 nmdc:mga05p37_590809_c1
1527 nmdc:mga05p37_62982_c1
1528 nmdc:mga06r32_67730_c1
1529 nmdc:mga08y16_510636_c1
1530 nmdc:mga08y16_82115_c1
1531 nmdc:mga0n895_246130_c1
1532 nmdc:mga0n895_431_c1
1533 nmdc:mga0n895_449_c1
1534 nmdc:mga0n895_50747_c1
1535 nmdc:mga0n895_8056_c1
1536 nmdc:mga0rr50_1670_c1
1537 nmdc:mga0rr50_271459_c1
1538 nmdc:mga0rr50_288330_c1
1539 nmdc:mga0rr50_96285_c1
1540 nmdc:mga08x19_132955_c1
1541 nmdc:mga08x19_20397_c1
1542 nmdc:mga08x19_25380_c1
1543 nmdc:mga08x19_54204_c1
1544 nmdc:mga0a205_195703_c1
1545 nmdc:mga0a205_334814_c1
1546 nmdc:mga0a205_73491_c1
1547 Ga0495601_0052304
1548 Ga0495601_0222122
1549 Ga0495601_0226500
1550 Ga0495601_0385448
1551 Ga0495612_0083488
1552 Ga0495612_0126233
1553 Ga0500635_0012534
1554 Ga0495595_0051108
1555 Ga0495595_0189318
1556 Ga0495619_0216755
1557 Ga0495619_0221963
1558 Ga0500645_054578
1559 Ga0530510_0000745
1560 Ga0530510_0125785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

49

159

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

199

275

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9633 3 103
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9614 2 102
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9607 2 102
4qpj-assembly2.cif.gz_C 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain 0.9591 2 102
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9573 2 103
ID Description Score Start End Superfamily
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9625 2 102 3.40.50.2300
4qpjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9591 2 102 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9532 2 65 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.95 3 65 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9483 2 65 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A358G4E9-F1-model_v4 deleted 0.9737 2 86
AF-A0A2S9GBW9-F1-model_v4 DNA-binding response regulator 0.9631 30 102 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0YG63-F1-model_v4 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(S) and Response Regulator 0.9495 2 105 GO:0000160
GO:0006355
AF-A0A3B9XGK4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9474 2 100 GO:0000155
GO:0016020
AF-A0A2N3AJC3-F1-model_v4 Two-component system response regulator 0.947 2 103 GO:0000160
GO:0005524
GO:0006355
GO:0016887

Map