F480376

General Info

Members Datasets Scaffolds Average Seq Length
777 557 552 300

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0044698|Ga0373927_0044698_74_1183
Length 369
Sequence MIARALAPRLFVIPHCCGRTVNIAGVDLPLPRGQQAFCGGKNRAIEVPIAIPFCNPSRGTAKVNATAHQTPRIARANGIELCYEIFGDADAEPMLLIMGLAAQMIHWDDEFCRQLAARGFRVIRFDNRDIGRSSRMTGGKRLGALELLKLRFLKIPVAAPYTLRDMAEDTVGLMDVLGIKSAHLVGASMGGMIAQEIAISFPQRVRSLTSIMSTTGNPKVPGPTREASAMLMAPPPSTKEEYFERYAQTWKILRAGSFPQDEALDRARAERNFERGLNPTGVGRQLRAVLASGNRKERLASVRAPTLVIHGTVDPLVRPEGGKDTAASIPGAKLLMIEGMGHALPIRMWPQVIDAIDKHAHAASAKAMH

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
90 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
91 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
94 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
95 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906610324
102 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
103 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
104 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
105 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
106 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
107 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
108 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
109 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
110 2922368715
111 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
112 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
113 2922425934
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
118 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
119 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
120 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
121 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
122 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
125 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
126 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
127 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
128 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
131 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
132 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
133 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
134 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
135 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
136 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
137 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
138 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
139 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
140 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
141 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
142 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
143 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
144 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
145 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
146 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
147 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
148 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
149 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
154 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
155 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
156 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
157 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
158 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
159 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
160 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
161 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
162 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
163 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
164 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
165 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
166 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
167 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
168 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
169 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
170 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
171 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
172 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
173 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
174 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
175 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
176 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
177 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
178 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
179 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
180 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
181 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
182 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
183 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
184 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
185 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
188 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
189 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
190 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
191 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
192 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
193 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
194 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
195 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
200 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
201 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
202 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
203 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
204 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
205 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
206 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
207 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
208 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
209 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
210 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
211 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
212 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
213 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
214 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
215 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
216 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
217 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
218 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
219 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
220 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
221 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
229 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
230 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
231 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
232 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
237 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
238 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
239 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
240 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
243 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
244 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
245 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
246 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
247 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
248 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
249 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
250 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
251 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
252 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
253 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
254 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
257 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
261 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
262 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
263 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
264 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
265 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
266 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
267 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
268 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
269 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
270 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
271 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
272 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
273 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
274 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
275 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
276 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
277 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
278 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
279 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
280 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
281 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
282 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
284 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
286 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
288 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
340 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
341 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
342 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
343 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
346 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
347 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
348 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
349 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
350 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
351 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
352 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
353 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
354 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
355 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
356 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
357 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
358 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
359 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
360 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
361 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
362 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
363 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
364 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
365 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
366 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
367 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
368 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
369 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
370 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
371 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
372 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
373 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
374 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
375 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
376 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
377 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
378 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
379 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
380 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
381 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
382 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
383 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
384 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
385 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
388 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
389 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
390 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
391 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
392 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
393 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
394 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
395 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
396 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
397 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
398 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
403 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
406 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
415 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
416 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
417 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
425 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
430 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
431 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
432 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
433 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
434 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
435 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
468 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
469 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
470 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
471 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
472 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
473 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
482 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
483 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
484 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
487 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
488 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
489 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
490 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
491 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
492 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
493 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
494 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
495 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
496 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
497 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
498 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
499 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
500 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
501 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
502 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
503 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
504 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
507 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
508 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
509 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
510 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
511 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
512 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
513 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
514 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
515 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
516 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
517 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
518 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
519 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
520 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
521 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
522 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
523 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
524 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
525 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
526 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
527 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
531 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
532 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
533 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
534 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
535 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
536 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
537 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
538 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
539 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
540 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
541 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
542 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
543 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
544 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
545 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
546 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
549 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
550 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
551 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
552 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
553 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
554 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
555 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
556 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
557 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.5
Metatranscriptomes 0
Isolates 28.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 22.27
Rhizoplane 5.79
Rhizosphere 52.25
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000223 3300003203 Bacteria 25081
2 JGI25160J50197_1002236 3300003354 Bacteria 9086
3 Ga0055543_1003779 3300004625 Bacteria 4317
4 Ga0065165_1001214 3300005262 Bacteria 29682
5 Ga0070658_10005755 3300005327 Bacteria 10053
6 Ga0070658_10029138 3300005327 Bacteria 4434
7 Ga0070676_10068276 3300005328 Bacteria 2128
8 Ga0070676_10129692 3300005328 Bacteria 1593
9 Ga0070683_100007952 3300005329 Bacteria 8995
10 Ga0070683_100196995 3300005329 Bacteria 1913
11 Ga0070670_100037139 3300005331 Bacteria 4191
12 Ga0070670_100131214 3300005331 Bacteria 2164
13 Ga0070677_10002920 3300005333 Bacteria 5491
14 Ga0070682_100127813 3300005337 Bacteria 1716
15 Ga0068868_100021088 3300005338 Bacteria 4905
16 Ga0068868_100118279 3300005338 Bacteria 2160
17 Ga0070660_100085153 3300005339 Bacteria 2485
18 Ga0070660_100094301 3300005339 Bacteria 2365
19 Ga0070660_100118218 3300005339 Bacteria 2114
20 Ga0070689_100250614 3300005340 Bacteria 1461
21 Ga0070661_100004144 3300005344 Bacteria 9996
22 Ga0070668_100098454 3300005347 Bacteria 2314
23 Ga0070668_100104450 3300005347 Bacteria 2248
24 Ga0070669_100037552 3300005353 Bacteria 3514
25 Ga0070669_100182244 3300005353 Bacteria 1643
26 Ga0070675_100008566 3300005354 Bacteria 7941
27 Ga0070671_100191918 3300005355 Bacteria 1731
28 Ga0070674_100000518 3300005356 Bacteria 19349
29 Ga0070674_100003318 3300005356 Bacteria 9011
30 Ga0070674_100058937 3300005356 Bacteria 2671
31 Ga0070673_100064373 3300005364 Bacteria 2921
32 Ga0070659_100033568 3300005366 Bacteria 3986
33 Ga0070659_100227289 3300005366 Bacteria 1541
34 Ga0070667_100007713 3300005367 Bacteria 8920
35 Ga0070709_10013391 3300005434 Bacteria 4610
36 Ga0070709_10027137 3300005434 Bacteria 3403
37 Ga0070709_10039448 3300005434 Bacteria 2897
38 Ga0070714_100007489 3300005435 Bacteria 8495
39 Ga0070714_100022201 3300005435 Bacteria 5202
40 Ga0070713_100001931 3300005436 Bacteria 13391
41 Ga0070710_10000550 3300005437 Bacteria 17724
42 Ga0070710_10011800 3300005437 Bacteria 4327
43 Ga0070710_10012215 3300005437 Bacteria 4258
44 Ga0070711_100073365 3300005439 Bacteria 2418
45 Ga0070711_100239395 3300005439 Bacteria 1418
46 Ga0070663_100015643 3300005455 Bacteria 4905
47 Ga0070663_100028451 3300005455 Bacteria 3805
48 Ga0070678_100003918 3300005456 Bacteria 8367
49 Ga0070678_100141068 3300005456 Bacteria 1928
50 Ga0070678_100162088 3300005456 Bacteria 1813
51 Ga0070662_100352827 3300005457 Bacteria 1205
52 Ga0070662_100437376 3300005457 Bacteria 1084
53 Ga0068867_100004484 3300005459 Bacteria 9810
54 Ga0070679_100037472 3300005530 Bacteria 4818
55 Ga0070679_100134648 3300005530 Bacteria 2452
56 Ga0070684_100002660 3300005535 Bacteria 13192
57 Ga0070684_100037881 3300005535 Bacteria 4139
58 Ga0070684_100185011 3300005535 Bacteria 1894
59 Ga0068853_100130206 3300005539 Bacteria 2252
60 Ga0070672_100000150 3300005543 Bacteria 38126
61 Ga0070672_100026924 3300005543 Bacteria 4285
62 Ga0070686_100163559 3300005544 Bacteria 1569
63 Ga0070693_100053632 3300005547 Bacteria 2316
64 Ga0070665_100028020 3300005548 Bacteria 5674
65 Ga0070665_100095325 3300005548 Bacteria 2980
66 Ga0068855_100215006 3300005563 Bacteria 2158
67 Ga0070664_100020769 3300005564 Bacteria 5409
68 Ga0068857_100063575 3300005577 Bacteria 3281
69 Ga0068857_100175773 3300005577 Bacteria 1948
70 Ga0068854_100001586 3300005578 Bacteria 13835
71 Ga0068854_100033855 3300005578 Bacteria 3564
72 Ga0068856_100002765 3300005614 Bacteria 17962
73 Ga0068856_100288187 3300005614 Bacteria 1659
74 Ga0068852_100004505 3300005616 Bacteria 9855
75 Ga0068852_100012408 3300005616 Bacteria 6469
76 Ga0068852_100015875 3300005616 Bacteria 5857
77 Ga0068852_100343918 3300005616 Bacteria 1455
78 Ga0068864_100125965 3300005618 Bacteria 2296
79 Ga0068864_100280962 3300005618 Bacteria 1554
80 Ga0068864_100517715 3300005618 Bacteria 1150
81 Ga0068861_100007671 3300005719 Bacteria 7406
82 Ga0068870_10064238 3300005840 Bacteria 1982
83 Ga0068863_100019290 3300005841 Bacteria 6522
84 Ga0068863_100354582 3300005841 Bacteria 1429
85 Ga0068858_100006988 3300005842 Bacteria 10963
86 Ga0068860_100064651 3300005843 Bacteria 3475
87 Ga0068860_100090365 3300005843 Bacteria 2917
88 Ga0068862_100080734 3300005844 Bacteria 2821
89 Ga0081455_10004053 3300005937 Bacteria 16599
90 Ga0081538_10050154 3300005981 Bacteria 2524
91 Ga0081540_1007980 3300005983 Bacteria 7455
92 Ga0081540_1019127 3300005983 Bacteria 4176
93 Ga0081539_10000325 3300005985 Bacteria 106431
94 Ga0070717_10009249 3300006028 Bacteria 7406
95 Ga0070717_10010145 3300006028 Bacteria 7093
96 Ga0070717_10044803 3300006028 Bacteria 3615
97 Ga0075365_10011349 3300006038 Bacteria 5235
98 Ga0075365_10068872 3300006038 Bacteria 2378
99 Ga0075363_100003003 3300006048 Bacteria 7055
100 Ga0075364_10019699 3300006051 Bacteria 4237
101 Ga0075364_10041354 3300006051 Bacteria 2993
102 Ga0075364_10125101 3300006051 Bacteria 1723
103 Ga0070715_10000126 3300006163 Bacteria 18112
104 Ga0070716_100005825 3300006173 Bacteria 5985
105 Ga0070712_100012143 3300006175 Bacteria 5474
106 Ga0075362_10055660 3300006177 Bacteria 1779
107 Ga0075367_10043437 3300006178 Bacteria 2632
108 Ga0075366_10089319 3300006195 Bacteria 1845
109 Ga0075370_10165354 3300006353 Bacteria 1299
110 Ga0068871_100019118 3300006358 Bacteria 5226
111 Ga0068865_100097434 3300006881 Bacteria 2147
112 Ga0099824_1006123 3300006942 Bacteria 16665
113 Ga0099822_1000072 3300006943 Bacteria 55118
114 Ga0105240_10003278 3300009093 Bacteria 25307
115 Ga0105240_10017290 3300009093 Bacteria 9725
116 Ga0105240_10058231 3300009093 Bacteria 4824
117 Ga0105240_10593043 3300009093 Bacteria 1221
118 Ga0105245_10015073 3300009098 Bacteria 6735
119 Ga0105245_10047099 3300009098 Bacteria 3854
120 Ga0105245_10082016 3300009098 Bacteria 2949
121 Ga0105247_10087830 3300009101 Bacteria 1969
122 Ga0105243_10096912 3300009148 Bacteria 2441
123 Ga0105241_10016146 3300009174 Bacteria 5473
124 Ga0105241_10383282 3300009174 Bacteria 1229
125 Ga0105248_10025180 3300009177 Bacteria 6614
126 Ga0105248_10397254 3300009177 Bacteria 1552
127 Ga0105237_10001694 3300009545 Bacteria 28555
128 Ga0105237_10004554 3300009545 Bacteria 16018
129 Ga0105237_10053262 3300009545 Bacteria 4059
130 Ga0105237_10206221 3300009545 Bacteria 1966
131 Ga0105237_10399960 3300009545 Bacteria 1378
132 Ga0105238_10004287 3300009551 Bacteria 14157
133 Ga0105238_10004463 3300009551 Bacteria 13870
134 Ga0105238_10028572 3300009551 Bacteria 5682
135 Ga0105238_10104419 3300009551 Bacteria 2814
136 Ga0105238_10314419 3300009551 Bacteria 1551
137 Ga0105249_10001498 3300009553 Bacteria 20478
138 Ga0099796_10083171 3300010159 Bacteria 1177
139 Ga0105239_10011538 3300010375 Bacteria 9855
140 Ga0105239_10065020 3300010375 Bacteria 4005
141 Ga0105239_10199765 3300010375 Bacteria 2240
142 Ga0105239_10361602 3300010375 Bacteria 1639
143 Ga0157373_10078674 3300013100 Bacteria 2325
144 Ga0157370_10153088 3300013104 Bacteria 2145
145 Ga0157369_10214476 3300013105 Bacteria 2017
146 Ga0157374_10082425 3300013296 Bacteria 3054
147 Ga0157374_10097214 3300013296 Bacteria 2817
148 Ga0157378_10310267 3300013297 Bacteria 1530
149 Ga0163162_10020520 3300013306 Bacteria 6492
150 Ga0163162_10384563 3300013306 Bacteria 1537
151 Ga0157372_10109670 3300013307 Bacteria 3161
152 Ga0157375_10020672 3300013308 Bacteria 6019
153 Ga0157375_10269324 3300013308 Bacteria 1865
154 Ga0157375_10570368 3300013308 Bacteria 1292
155 Ga0163163_10126799 3300014325 Bacteria 2590
156 Ga0157380_10001208 3300014326 Bacteria 16721
157 Ga0157380_10204433 3300014326 Bacteria 1755
158 Ga0157377_10039056 3300014745 Bacteria 2624
159 Ga0157379_10009787 3300014968 Bacteria 8353
160 Ga0157379_10013513 3300014968 Bacteria 7154
161 Ga0157379_10036695 3300014968 Bacteria 4370
162 Ga0157379_10197101 3300014968 Bacteria 1820
163 Ga0157379_10528526 3300014968 Bacteria 1096
164 Ga0157376_10079936 3300014969 Bacteria 2804
165 Ga0163161_10017129 3300017792 Bacteria 5069
166 Ga0213873_10002543 3300021358 Bacteria 3171
167 Ga0213876_10006112 3300021384 Bacteria 6578
168 Ga0213876_10067134 3300021384 Bacteria 1894
169 Ga0209148_1000347 3300025254 Bacteria 60370
170 Ga0209233_1003464 3300025261 Bacteria 5557
171 Ga0209233_1005147 3300025261 Bacteria 4371
172 Ga0209455_1002483 3300025272 Bacteria 7091
173 Ga0209758_1003203 3300025297 Bacteria 15275
174 Ga0209256_1014792 3300025299 Bacteria 2776
175 Ga0207426_1000270 3300025302 Bacteria 108404
176 Ga0207656_10023712 3300025321 Bacteria 2474
177 Ga0207656_10155796 3300025321 Bacteria 1084
178 Ga0207682_10000759 3300025893 Bacteria 14883
179 Ga0207692_10008557 3300025898 Bacteria 4240
180 Ga0207692_10014334 3300025898 Bacteria 3461
181 Ga0207692_10021439 3300025898 Bacteria 2956
182 Ga0207710_10062762 3300025900 Bacteria 1689
183 Ga0207688_10044077 3300025901 Bacteria 2486
184 Ga0207688_10064671 3300025901 Bacteria 2066
185 Ga0207647_10119596 3300025904 Bacteria 1553
186 Ga0207685_10108092 3300025905 Bacteria 1201
187 Ga0207699_10014226 3300025906 Bacteria 4095
188 Ga0207699_10049577 3300025906 Bacteria 2472
189 Ga0207645_10023994 3300025907 Bacteria 3959
190 Ga0207645_10044376 3300025907 Bacteria 2845
191 Ga0207643_10067337 3300025908 Bacteria 2055
192 Ga0207643_10207298 3300025908 Bacteria 1195
193 Ga0207705_10052653 3300025909 Bacteria 2931
194 Ga0207705_10072358 3300025909 Bacteria 2500
195 Ga0207705_10092128 3300025909 Bacteria 2220
196 Ga0207654_10045215 3300025911 Bacteria 2505
197 Ga0207654_10049589 3300025911 Bacteria 2409
198 Ga0207654_10099332 3300025911 Bacteria 1790
199 Ga0207695_10000008 3300025913 Bacteria 1058268
200 Ga0207695_10008824 3300025913 Bacteria 12554
201 Ga0207695_10124795 3300025913 Bacteria 2538
202 Ga0207695_10322858 3300025913 Bacteria 1433
203 Ga0207671_10007506 3300025914 Bacteria 9457
204 Ga0207671_10010103 3300025914 Bacteria 7824
205 Ga0207671_10066695 3300025914 Bacteria 2679
206 Ga0207671_10154511 3300025914 Bacteria 1774
207 Ga0207693_10000683 3300025915 Bacteria 30507
208 Ga0207663_10001947 3300025916 Bacteria 9768
209 Ga0207663_10042784 3300025916 Bacteria 2770
210 Ga0207663_10045486 3300025916 Bacteria 2700
211 Ga0207660_10101298 3300025917 Bacteria 2151
212 Ga0207662_10066120 3300025918 Bacteria 2178
213 Ga0207657_10004384 3300025919 Bacteria 14939
214 Ga0207657_10026159 3300025919 Bacteria 5368
215 Ga0207657_10030571 3300025919 Bacteria 4887
216 Ga0207657_10141002 3300025919 Bacteria 1969
217 Ga0207649_10113007 3300025920 Bacteria 1818
218 Ga0207652_10068746 3300025921 Bacteria 3074
219 Ga0207681_10006914 3300025923 Bacteria 6960
220 Ga0207681_10010182 3300025923 Bacteria 5757
221 Ga0207694_10012939 3300025924 Bacteria 6285
222 Ga0207694_10014250 3300025924 Bacteria 5996
223 Ga0207694_10024599 3300025924 Bacteria 4574
224 Ga0207694_10143346 3300025924 Bacteria 1922
225 Ga0207650_10002442 3300025925 Bacteria 12942
226 Ga0207650_10165995 3300025925 Bacteria 1752
227 Ga0207659_10000135 3300025926 Bacteria 43365
228 Ga0207659_10012550 3300025926 Bacteria 5395
229 Ga0207687_10192296 3300025927 Bacteria 1589
230 Ga0207664_10291567 3300025929 Bacteria 1434
231 Ga0207644_10020254 3300025931 Bacteria 4521
232 Ga0207644_10454550 3300025931 Bacteria 1052
233 Ga0207690_10054941 3300025932 Bacteria 2680
234 Ga0207706_10002883 3300025933 Bacteria 16654
235 Ga0207706_10110757 3300025933 Bacteria 2415
236 Ga0207706_10116533 3300025933 Bacteria 2349
237 Ga0207706_10472640 3300025933 Bacteria 1083
238 Ga0207669_10012119 3300025937 Bacteria 4227
239 Ga0207704_10031670 3300025938 Bacteria 2982
240 Ga0207704_10066234 3300025938 Bacteria 2266
241 Ga0207665_10000339 3300025939 Bacteria 32422
242 Ga0207691_10002113 3300025940 Bacteria 19425
243 Ga0207691_10025132 3300025940 Bacteria 5595
244 Ga0207691_10364215 3300025940 Bacteria 1236
245 Ga0207711_10032396 3300025941 Bacteria 4419
246 Ga0207661_10036834 3300025944 Bacteria 3821
247 Ga0207661_10088109 3300025944 Bacteria 2579
248 Ga0207661_10190172 3300025944 Bacteria 1799
249 Ga0207679_10003707 3300025945 Bacteria 9470
250 Ga0207667_10215284 3300025949 Bacteria 1969
251 Ga0207651_10000647 3300025960 Bacteria 14772
252 Ga0207712_10017129 3300025961 Bacteria 4701
253 Ga0207658_10014926 3300025986 Bacteria 5324
254 Ga0207658_10058472 3300025986 Bacteria 2869
255 Ga0207677_10005607 3300026023 Bacteria 6819
256 Ga0207703_10005700 3300026035 Bacteria 9988
257 Ga0207703_10151611 3300026035 Bacteria 2022
258 Ga0207639_10406187 3300026041 Bacteria 1228
259 Ga0207678_10016124 3300026067 Bacteria 6562
260 Ga0207678_10040249 3300026067 Bacteria 4055
261 Ga0207678_10086017 3300026067 Bacteria 2687
262 Ga0207708_10087740 3300026075 Bacteria 2396
263 Ga0207702_10200973 3300026078 Bacteria 1847
264 Ga0207702_10497536 3300026078 Bacteria 1188
265 Ga0207648_10002879 3300026089 Bacteria 18217
266 Ga0207648_10036193 3300026089 Bacteria 4348
267 Ga0207648_10489998 3300026089 Bacteria 1124
268 Ga0207676_10040495 3300026095 Bacteria 3571
269 Ga0207676_10155254 3300026095 Bacteria 1976
270 Ga0207676_10158341 3300026095 Bacteria 1959
271 Ga0207674_10078524 3300026116 Bacteria 3306
272 Ga0207674_10139575 3300026116 Bacteria 2384
273 Ga0207674_10303432 3300026116 Bacteria 1546
274 Ga0207698_10004390 3300026142 Bacteria 8592
275 Ga0207698_10059392 3300026142 Bacteria 2969
276 Ga0207698_10305421 3300026142 Bacteria 1483
277 Ga0209389_1000001 3300027296 Bacteria 463799
278 Ga0209589_1000011 3300027357 Bacteria 236981
279 Ga0209489_100012 3300027361 Bacteria 236981
280 Ga0209489_102213 3300027361 Bacteria 39761
281 Ga0209700_100007 3300027363 Bacteria 454608
282 Ga0209700_100019 3300027363 Bacteria 236981
283 Ga0268266_10060289 3300028379 Bacteria 3271
284 Ga0268264_10337985 3300028381 Bacteria 1429
285 Ga0268264_10342113 3300028381 Bacteria 1421
286 Ga0307511_10114407 3300030521 Bacteria 1700
287 Ga0265339_10053306 3300031249 Bacteria 2200
288 Ga0307508_10000015 3300031616 Bacteria 210182
289 Ga0265342_10007168 3300031712 Bacteria 8206
290 Ga0307410_10005624 3300031852 Bacteria 6661
291 Ga0307410_10210576 3300031852 Bacteria 1489
292 Ga0307406_10003804 3300031901 Bacteria 8218
293 Ga0307407_10031383 3300031903 Bacteria 2877
294 Ga0307412_10435276 3300031911 Bacteria 1076
295 Ga0307416_100002779 3300032002 Bacteria 10165
296 Ga0307416_100003421 3300032002 Bacteria 9318
297 Ga0307411_10039581 3300032005 Bacteria 2983
298 Ga0307415_100104199 3300032126 Bacteria 2089
299 Ga0307507_10006824 3300033179 Bacteria 17074
300 Ga0307510_10037374 3300033180 Bacteria 5387
301 Ga0307510_10055134 3300033180 Bacteria 4154
302 Ga0307510_10096620 3300033180 Bacteria 2769
303 Ga0315911_1000002 3300033442 Bacteria 926833
304 Ga0316215_1002146 3300033544 Bacteria 1864
305 Ga0373945_0107247 3300035116 Bacteria 1099
306 Ga0373953_0035797 3300035117 Bacteria 1952
307 Ga0373957_0013071 3300035120 Bacteria 2809
308 Ga0373957_0077728 3300035120 Bacteria 1306
309 Ga0373955_0072253 3300035172 Bacteria 1932
310 Ga0373962_0008156 3300035242 Bacteria 2573
311 Ga0316574_0000847 3300035398 Bacteria 13411
312 Ga0373924_0033008 3300035410 Bacteria 2087
313 Ga0373931_0011120 3300035691 Bacteria 4340
314 Ga0373931_0132514 3300035691 Bacteria 1436
315 Ga0373935_0055887 3300035692 Bacteria 2515
316 Ga0373927_0027113 3300035695 Bacteria 3743
317 Ga0373927_0044698 3300035695 Bacteria 2865
318 Ga0373947_0007716 3300035725 Bacteria 6220
319 Ga0373937_0100979 3300036401 Bacteria 2677
320 Ga0373925_0022318 3300037068 Bacteria 4617
321 Ga0373925_0072696 3300037068 Bacteria 2602
322 Ga0395900_0201794 3300037418 Bacteria 2012
323 Ga0395898_0105086 3300037466 Bacteria 2708
324 Ga0436364_1074833 3300037853 Bacteria 5387
325 Ga0395901_0410324 3300038443 Bacteria 1391
326 Ga0237816_02524 3300039145 Bacteria 1394
327 Ga0436365_0496646 3300039437 Bacteria 6540
328 Ga0436365_1276870 3300039437 Bacteria 8067
329 Ga0436363_1359162 3300039450 Bacteria 2778
330 Ga0436362_0966777 3300039453 Bacteria 3926
331 Ga0466969_0042525 3300044656 Bacteria 2268
332 Ga0466972_0000134 3300044658 Bacteria 61802
333 Ga0466965_0032173 3300044683 Bacteria 2562
334 Ga0466966_0061017 3300044684 Bacteria 2379
335 Ga0466963_0179628 3300044694 Bacteria 1477
336 Ga0466957_0059293 3300044842 Bacteria 2346
337 Ga0466960_0037434 3300044901 Bacteria 2276
338 Ga0466959_0033350 3300045049 Bacteria 3808
339 Ga0466967_0184717 3300045976 Bacteria 1968
340 Ga0466967_0377309 3300045976 Bacteria 1376
341 Ga0495592_0024435 3300046454 Bacteria 4594
342 Ga0495592_0190651 3300046454 Bacteria 1390
343 Ga0495603_0025442 3300046455 Bacteria 3580
344 Ga0495603_0028282 3300046455 Bacteria 3381
345 Ga0495629_0007286 3300046459 Bacteria 8148
346 Ga0495638_0047278 3300046460 Bacteria 2698
347 Ga0495651_0004240 3300046462 Bacteria 10992
348 Ga0495651_0098201 3300046462 Bacteria 2186
349 Ga0495651_0100648 3300046462 Bacteria 2152
350 Ga0495653_0064213 3300046463 Bacteria 2767
351 Ga0495664_0015208 3300046477 Bacteria 4372
352 Ga0495664_0055337 3300046477 Bacteria 2361
353 Ga0495608_0030206 3300046511 Bacteria 3671
354 Ga0495618_0057476 3300046514 Bacteria 2463
355 Ga0495618_0096450 3300046514 Bacteria 1891
356 Ga0495628_0055591 3300046516 Bacteria 3117
357 Ga0495628_0235997 3300046516 Bacteria 1369
358 Ga0495630_0052973 3300046517 Bacteria 3038
359 Ga0495643_0008377 3300046522 Bacteria 6554
360 Ga0495644_0063291 3300046523 Bacteria 1390
361 Ga0495648_0004316 3300046524 Bacteria 12181
362 Ga0495648_0075860 3300046524 Bacteria 1932
363 Ga0495652_0000938 3300046529 Bacteria 33434
364 Ga0495652_0025055 3300046529 Bacteria 5279
365 Ga0495640_0007993 3300046533 Bacteria 8313
366 Ga0495640_0036648 3300046533 Bacteria 3464
367 Ga0495640_0135972 3300046533 Bacteria 1587
368 Ga0495587_0051821 3300046536 Bacteria 2424
369 Ga0495645_0041434 3300046543 Bacteria 3358
370 Ga0495645_0052596 3300046543 Bacteria 2962
371 Ga0495645_0156327 3300046543 Bacteria 1579
372 Ga0495622_0051205 3300046557 Bacteria 1915
373 Ga0495622_0127491 3300046557 Bacteria 1160
374 Ga0495667_0031082 3300046559 Bacteria 3585
375 Ga0495667_0031460 3300046559 Bacteria 3562
376 Ga0495634_0080979 3300046642 Bacteria 2124
377 Ga0495635_0005160 3300046663 Bacteria 9092
378 Ga0495635_0111434 3300046663 Bacteria 1869
379 Ga0495657_0008941 3300046675 Bacteria 7622
380 Ga0495657_0018176 3300046675 Bacteria 5093
381 Ga0495599_0047674 3300046678 Bacteria 2685
382 Ga0495599_0171615 3300046678 Bacteria 1338
383 Ga0495646_0053536 3300046680 Bacteria 2433
384 Ga0495646_0065458 3300046680 Bacteria 2152
385 Ga0495658_0031727 3300046683 Bacteria 2879
386 Ga0495613_0218574 3300046689 Bacteria 1338
387 Ga0495624_0017354 3300046690 Bacteria 4834
388 Ga0495649_0105856 3300046694 Bacteria 1493
389 Ga0495600_0050226 3300046809 Bacteria 2721
390 Ga0495600_0061677 3300046809 Bacteria 2449
391 Ga0495600_0256848 3300046809 Bacteria 1110
392 Ga0495581_0136633 3300047315 Bacteria 1429
393 Ga0495604_0003325 3300047317 Bacteria 12811
394 Ga0495604_0033572 3300047317 Bacteria 4061
395 Ga0495674_0036465 3300047319 Bacteria 4425
396 Ga0495674_0079109 3300047319 Bacteria 2824
397 Ga0495674_0422590 3300047319 Bacteria 1074
398 Ga0495672_0174664 3300047320 Bacteria 1092
399 Ga0495680_0007102 3300047322 Bacteria 10313
400 Ga0495675_0011426 3300047444 Bacteria 5574
401 Ga0495684_0024756 3300047471 Bacteria 4616
402 Ga0495684_0052157 3300047471 Bacteria 3121
403 Ga0495686_0041367 3300047472 Bacteria 2935
404 Ga0495602_0016046 3300048088 Bacteria 7539
405 Ga0495602_0053918 3300048088 Bacteria 3556
406 Ga0495614_0007563 3300048089 Bacteria 4835
407 Ga0496100_0028657 3300048903 Bacteria 3436
408 Ga0496100_0128972 3300048903 Bacteria 1779
409 Ga0496101_0004214 3300048904 Bacteria 9009
410 Ga0496101_0058748 3300048904 Bacteria 2786
411 Ga0496101_0061665 3300048904 Bacteria 2724
412 Ga0496102_0006143 3300048905 Bacteria 10237
413 Ga0496102_0072396 3300048905 Bacteria 3167
414 Ga0496102_0097001 3300048905 Bacteria 2734
415 Ga0496102_0119146 3300048905 Bacteria 2464
416 Ga0496102_0132063 3300048905 Bacteria 2338
417 Ga0496103_0062146 3300048906 Bacteria 2324
418 Ga0496104_0018203 3300048907 Bacteria 6407
419 Ga0496104_0428269 3300048907 Bacteria 1235
420 Ga0496105_0005595 3300048908 Bacteria 9552
421 Ga0496105_0092877 3300048908 Bacteria 2491
422 Ga0496105_0213215 3300048908 Bacteria 1573
423 Ga0496106_0048620 3300048909 Bacteria 3194
424 Ga0496106_0050208 3300048909 Bacteria 3144
425 Ga0496106_0057918 3300048909 Bacteria 2931
426 Ga0496107_0002113 3300048910 Bacteria 12728
427 Ga0496107_0007328 3300048910 Bacteria 7605
428 Ga0496107_0046023 3300048910 Bacteria 3140
429 Ga0496107_0109796 3300048910 Bacteria 2026
430 Ga0496108_0071294 3300048911 Bacteria 2931
431 Ga0496108_0348436 3300048911 Bacteria 1292
432 Ga0496108_0447246 3300048911 Bacteria 1129
433 Ga0496109_0063257 3300048912 Bacteria 3384
434 Ga0496109_0438307 3300048912 Bacteria 1234
435 Ga0496110_0205416 3300048913 Bacteria 1790
436 Ga0496111_0033737 3300048914 Bacteria 3652
437 Ga0496112_0000044 3300048915 Bacteria 86865
438 Ga0496112_0015095 3300048915 Bacteria 7195
439 Ga0496112_0018080 3300048915 Bacteria 6633
440 Ga0496112_0139350 3300048915 Bacteria 2395
441 Ga0496113_0051531 3300048916 Bacteria 3072
442 Ga0496114_0072007 3300048917 Bacteria 2906
443 Ga0496114_0075757 3300048917 Bacteria 2834
444 Ga0496114_0156020 3300048917 Bacteria 1982
445 Ga0496114_0320533 3300048917 Bacteria 1369
446 Ga0496115_0004269 3300048918 Bacteria 10342
447 Ga0496115_0067760 3300048918 Bacteria 2888
448 Ga0496115_0175726 3300048918 Bacteria 1771
449 Ga0496115_0255204 3300048918 Bacteria 1443
450 Ga0496115_0321083 3300048918 Bacteria 1266
451 Ga0496117_0067801 3300048920 Bacteria 2412
452 Ga0496117_0118927 3300048920 Bacteria 1628
453 Ga0496118_0003016 3300048921 Bacteria 21744
454 Ga0496118_0119224 3300048921 Bacteria 1726
455 Ga0496118_0188289 3300048921 Bacteria 1237
456 Ga0496120_0010703 3300048923 Bacteria 6367
457 Ga0496121_0000041 3300048924 Bacteria 346686
458 Ga0496121_0011806 3300048924 Bacteria 9625
459 Ga0496121_0071824 3300048924 Bacteria 2782
460 Ga0496122_0071759 3300048925 Bacteria 2466
461 Ga0496124_0006721 3300048927 Bacteria 12444
462 Ga0496125_0000712 3300048928 Bacteria 54983
463 Ga0496125_0104374 3300048928 Bacteria 2076
464 Ga0496126_0032037 3300048929 Bacteria 4958
465 Ga0496126_0049685 3300048929 Bacteria 3827
466 Ga0496126_0053820 3300048929 Bacteria 3649
467 Ga0496126_0070101 3300048929 Bacteria 3124
468 Ga0496126_0208115 3300048929 Bacteria 1648
469 Ga0496126_0232309 3300048929 Bacteria 1545
470 Ga0496126_0369665 3300048929 Bacteria 1169
471 Ga0495682_0078011 3300049460 Bacteria 1191
472 Ga0501031_0000652 3300049568 Bacteria 20544
473 Ga0501032_0002299 3300049569 Bacteria 14998
474 Ga0501032_0036945 3300049569 Bacteria 3333
475 Ga0501033_0000091 3300049570 Bacteria 85666
476 Ga0501034_0000039 3300049571 Bacteria 237357
477 Ga0501034_0636407 3300049571 Bacteria 969
478 Ga0501036_0000052 3300049572 Bacteria 74795
479 Ga0501037_0000025 3300049573 Bacteria 143276
480 Ga0501038_0002924 3300049574 Bacteria 15925
481 Ga0501038_0211707 3300049574 Bacteria 1550
482 Ga0501039_0000719 3300049575 Bacteria 23853
483 Ga0501043_0000928 3300049579 Bacteria 25941
484 Ga0501046_0000231 3300049580 Bacteria 57655
485 Ga0501046_0075551 3300049580 Bacteria 2612
486 Ga0501047_0000457 3300049581 Bacteria 45136
487 Ga0501047_0024108 3300049581 Bacteria 5844
488 Ga0501048_0000218 3300049582 Bacteria 37734
489 Ga0501067_0003111 3300049583 Bacteria 9160
490 Ga0501067_0021251 3300049583 Bacteria 3591
491 Ga0501068_0001352 3300049584 Bacteria 12996
492 Ga0501070_0002829 3300049586 Bacteria 15142
493 Ga0501071_0026801 3300049587 Bacteria 4049
494 Ga0501072_0004469 3300049588 Bacteria 10621
495 Ga0501073_0000877 3300049589 Bacteria 21517
496 Ga0501074_0000273 3300049590 Bacteria 29590
497 Ga0501079_0011695 3300049741 Bacteria 6704
498 Ga0501080_0000124 3300049742 Bacteria 54519
499 Ga0501083_0000785 3300049744 Bacteria 20828
500 Ga0501035_0000052 3300049822 Bacteria 143038
501 Ga0501035_0135984 3300049822 Bacteria 2140
502 Ga0501044_0000217 3300049823 Bacteria 73242
503 Ga0501044_0100080 3300049823 Bacteria 2917
504 Ga0501045_0010874 3300049824 Bacteria 6378
505 nmdc:mga00v17_143506_c1 3300050491 Bacteria 1532
506 nmdc:mga0yw44_198777_c1 3300050492 Bacteria 1324
507 nmdc:mga0yw44_35390_c1 3300050492 Bacteria 2934
508 nmdc:mga0k408_45179_c1 3300050493 Bacteria 2541
509 nmdc:mga07m45_51757_c1 3300050496 Bacteria 2317
510 nmdc:mga0sz30_48771_c1 3300050516 Bacteria 1793
511 Ga0495601_0199096 3300053077 Bacteria 1309
512 Ga0500635_0017688 3300053080 Bacteria 2140
513 Ga0500635_0020322 3300053080 Bacteria 2033
514 Ga0495595_0151629 3300053084 Bacteria 1141
515 Ga0495619_0019088 3300053085 Bacteria 4356
516 Ga0495619_0181079 3300053085 Bacteria 1458
517 Ga0500643_000069 3300053087 Bacteria 116366
518 Ga0500644_0003960 3300053088 Bacteria 3686
519 Ga0500566_0000608 3300053094 Bacteria 20128
520 Ga0500566_0032348 3300053094 Bacteria 3050
521 Ga0500566_0043837 3300053094 Bacteria 2577
522 Ga0500650_0055084 3300053098 Bacteria 1852
523 Ga0500554_000716 3300053102 Bacteria 6725
524 Ga0500555_009231 3300053103 Bacteria 2820
525 Ga0500556_0004962 3300053104 Bacteria 3765
526 Ga0500557_000003 3300053105 Bacteria 228429
527 Ga0500569_014459 3300053109 Bacteria 1954
528 Ga0500595_000200 3300053119 Bacteria 40977
529 Ga0500595_009172 3300053119 Bacteria 4005
530 Ga0500642_0000051 3300053130 Bacteria 77123
531 Ga0500642_0011959 3300053130 Bacteria 3128
532 Ga0500568_0010968 3300053139 Bacteria 4224
533 Ga0500568_0017137 3300053139 Bacteria 3204
534 Ga0500577_0033509 3300053142 Bacteria 1816
535 Ga0500589_035950 3300053147 Bacteria 2313
536 Ga0500603_000240 3300053150 Bacteria 14346
537 Ga0500603_067225 3300053150 Bacteria 1014
538 Ga0500604_0023161 3300053151 Bacteria 1770
539 Ga0500622_0008815 3300053156 Bacteria 5614
540 Ga0500638_000785 3300053162 Bacteria 8718
541 Ga0500636_0000166 3300053177 Bacteria 34574
542 Ga0500637_0000144 3300053178 Bacteria 26094
543 Ga0500576_028192 3300053725 Bacteria 2559
544 Ga0500625_003024 3300053729 Bacteria 6512
545 Ga0500609_002156 3300053731 Bacteria 2819
546 Ga0500552_000771 3300053733 Bacteria 2987
547 Ga0500596_001440 3300053735 Bacteria 4811
548 Ga0500599_000151 3300053736 Bacteria 6301
549 Ga0501084_0000683 3300054114 Bacteria 25896
550 Ga0501082_0007986 3300060353 Bacteria 9137
551 Ga0466962_0045345 3300061719 Bacteria 2102
552 Ga0466962_0065872 3300061719 Bacteria 1730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10314419 Ga0105238_103144192 247
2 3300010375 Ga0105239_10199765 Ga0105239_101997653 265
3 3300025933 Ga0207706_10116533 Ga0207706_101165332 265
4 3300025908 Ga0207643_10207298 Ga0207643_102072982 266
5 3300047315 Ga0495581_0136633 Ga0495581_0136633_269_1150 271
6 3300035116 Ga0373945_0107247 Ga0373945_0107247_108_998 278
7 iso_pu_bacteria 8016539877 8016547006 278
8 3300003354 JGI25160J50197_1002236 JGI25160J50197_10022364 281
9 3300004625 Ga0055543_1003779 Ga0055543_10037794 281
10 3300005262 Ga0065165_1001214 Ga0065165_10012145 281
11 3300005327 Ga0070658_10029138 Ga0070658_100291383 281
12 3300005339 Ga0070660_100085153 Ga0070660_1000851533 281
13 3300005347 Ga0070668_100104450 Ga0070668_1001044503 281
14 3300005455 Ga0070663_100028451 Ga0070663_1000284514 281
15 3300005844 Ga0068862_100080734 Ga0068862_1000807342 281
16 3300005983 Ga0081540_1007980 Ga0081540_10079803 281
17 3300006038 Ga0075365_10068872 Ga0075365_100688723 281
18 3300006048 Ga0075363_100003003 Ga0075363_1000030032 281
19 3300006051 Ga0075364_10019699 Ga0075364_100196992 281
20 3300006051 Ga0075364_10125101 Ga0075364_101251012 281
21 3300006178 Ga0075367_10043437 Ga0075367_100434373 281
22 3300006195 Ga0075366_10089319 Ga0075366_100893192 281
23 3300006353 Ga0075370_10165354 Ga0075370_101653542 281
24 3300009148 Ga0105243_10096912 Ga0105243_100969122 281
25 3300013297 Ga0157378_10310267 Ga0157378_103102671 281
26 3300025261 Ga0209233_1005147 Ga0209233_10051474 281
27 3300025299 Ga0209256_1014792 Ga0209256_10147923 281
28 3300025302 Ga0207426_1000270 Ga0207426_100027036 281
29 3300025901 Ga0207688_10044077 Ga0207688_100440772 281
30 3300025909 Ga0207705_10052653 Ga0207705_100526533 281
31 3300025914 Ga0207671_10066695 Ga0207671_100666952 281
32 3300025919 Ga0207657_10026159 Ga0207657_100261594 281
33 3300025920 Ga0207649_10113007 Ga0207649_101130072 281
34 3300025931 Ga0207644_10454550 Ga0207644_104545501 281
35 3300025949 Ga0207667_10215284 Ga0207667_102152843 281
36 3300026067 Ga0207678_10040249 Ga0207678_100402492 281
37 3300026078 Ga0207702_10497536 Ga0207702_104975361 281
38 3300033180 Ga0307510_10037374 Ga0307510_100373744 281
39 3300033180 Ga0307510_10096620 Ga0307510_100966203 281
40 3300044683 Ga0466965_0032173 Ga0466965_0032173_226_1140 281
41 3300044901 Ga0466960_0037434 Ga0466960_0037434_361_1275 281
42 3300046460 Ga0495638_0047278 Ga0495638_0047278_1127_2041 281
43 3300046522 Ga0495643_0008377 Ga0495643_0008377_3794_4708 281
44 3300046524 Ga0495648_0075860 Ga0495648_0075860_742_1656 281
45 3300046694 Ga0495649_0105856 Ga0495649_0105856_284_1198 281
46 3300048089 Ga0495614_0007563 Ga0495614_0007563_1527_2441 281
47 3300048905 Ga0496102_0119146 Ga0496102_0119146_443_1357 281
48 3300048908 Ga0496105_0213215 Ga0496105_0213215_508_1422 281
49 3300048915 Ga0496112_0015095 Ga0496112_0015095_3276_4190 281
50 3300048917 Ga0496114_0320533 Ga0496114_0320533_370_1284 281
51 3300048920 Ga0496117_0118927 Ga0496117_0118927_679_1593 281
52 3300049460 Ga0495682_0078011 Ga0495682_0078011_48_962 281
53 3300050491 nmdc:mga00v17_143506_c1 nmdc:mga00v17_143506_c1_474_1388 281
54 3300050492 nmdc:mga0yw44_198777_c1 nmdc:mga0yw44_198777_c1_255_1169 281
55 3300050493 nmdc:mga0k408_45179_c1 nmdc:mga0k408_45179_c1_175_1089 281
56 3300050496 nmdc:mga07m45_51757_c1 nmdc:mga07m45_51757_c1_577_1491 281
57 3300050516 nmdc:mga0sz30_48771_c1 nmdc:mga0sz30_48771_c1_734_1648 281
58 3300053080 Ga0500635_0020322 Ga0500635_0020322_1001_1915 281
59 3300053087 Ga0500643_000069 Ga0500643_000069_37325_38239 281
60 3300053103 Ga0500555_009231 Ga0500555_009231_1243_2157 281
61 3300053104 Ga0500556_0004962 Ga0500556_0004962_664_1578 281
62 3300053105 Ga0500557_000003 Ga0500557_000003_103901_104854 281
63 3300053130 Ga0500642_0011959 Ga0500642_0011959_900_1814 281
64 3300053139 Ga0500568_0017137 Ga0500568_0017137_1538_2452 281
65 3300053156 Ga0500622_0008815 Ga0500622_0008815_3169_4083 281
66 3300053177 Ga0500636_0000166 Ga0500636_0000166_24617_25531 281
67 3300053729 Ga0500625_003024 Ga0500625_003024_3048_4028 281
68 3300053736 Ga0500599_000151 Ga0500599_000151_4771_5685 281
69 3300005983 Ga0081540_1019127 Ga0081540_10191274 282
70 3300033180 Ga0307510_10055134 Ga0307510_100551343 282
71 3300046455 Ga0495603_0025442 Ga0495603_0025442_2231_3145 282
72 3300047319 Ga0495674_0422590 Ga0495674_0422590_73_987 282
73 3300053080 Ga0500635_0017688 Ga0500635_0017688_454_1368 282
74 3300053147 Ga0500589_035950 Ga0500589_035950_737_1651 282
75 3300053150 Ga0500603_000240 Ga0500603_000240_12553_13467 282
76 3300053151 Ga0500604_0023161 Ga0500604_0023161_505_1419 282
77 3300025254 Ga0209148_1000347 Ga0209148_100034723 283
78 3300025272 Ga0209455_1002483 Ga0209455_10024836 283
79 3300025297 Ga0209758_1003203 Ga0209758_100320311 283
80 3300027296 Ga0209389_1000001 Ga0209389_100000167 283
81 3300027361 Ga0209489_102213 Ga0209489_10221333 283
82 3300027363 Ga0209700_100007 Ga0209700_100007337 283
83 3300044658 Ga0466972_0000134 Ga0466972_0000134_24280_25200 283
84 3300046454 Ga0495592_0024435 Ga0495592_0024435_2097_3038 283
85 3300046462 Ga0495651_0004240 Ga0495651_0004240_4455_5396 283
86 3300046463 Ga0495653_0064213 Ga0495653_0064213_1327_2268 283
87 3300046477 Ga0495664_0015208 Ga0495664_0015208_3222_4163 283
88 3300046477 Ga0495664_0055337 Ga0495664_0055337_436_1353 283
89 3300046511 Ga0495608_0030206 Ga0495608_0030206_2101_3042 283
90 3300046514 Ga0495618_0096450 Ga0495618_0096450_280_1293 283
91 3300046516 Ga0495628_0055591 Ga0495628_0055591_1208_2149 283
92 3300046529 Ga0495652_0000938 Ga0495652_0000938_2126_3067 283
93 3300046529 Ga0495652_0025055 Ga0495652_0025055_2349_3362 283
94 3300046533 Ga0495640_0007993 Ga0495640_0007993_3538_4551 283
95 3300046533 Ga0495640_0036648 Ga0495640_0036648_968_1909 283
96 3300046543 Ga0495645_0052596 Ga0495645_0052596_891_1832 283
97 3300046559 Ga0495667_0031082 Ga0495667_0031082_1837_2778 283
98 3300046642 Ga0495634_0080979 Ga0495634_0080979_756_1697 283
99 3300046663 Ga0495635_0005160 Ga0495635_0005160_1554_2567 283
100 3300046675 Ga0495657_0008941 Ga0495657_0008941_1307_2248 283
101 3300046675 Ga0495657_0018176 Ga0495657_0018176_3990_5003 283
102 3300046678 Ga0495599_0047674 Ga0495599_0047674_1003_1944 283
103 3300046680 Ga0495646_0065458 Ga0495646_0065458_113_1054 283
104 3300046690 Ga0495624_0017354 Ga0495624_0017354_101_1114 283
105 3300046809 Ga0495600_0050226 Ga0495600_0050226_481_1422 283
106 3300046809 Ga0495600_0061677 Ga0495600_0061677_162_1175 283
107 3300047317 Ga0495604_0003325 Ga0495604_0003325_9892_10833 283
108 3300047317 Ga0495604_0033572 Ga0495604_0033572_2309_3322 283
109 3300047319 Ga0495674_0079109 Ga0495674_0079109_691_1632 283
110 3300047322 Ga0495680_0007102 Ga0495680_0007102_4912_5853 283
111 3300047444 Ga0495675_0011426 Ga0495675_0011426_3994_4935 283
112 3300047471 Ga0495684_0052157 Ga0495684_0052157_1589_2530 283
113 3300048088 Ga0495602_0016046 Ga0495602_0016046_2655_3596 283
114 3300048088 Ga0495602_0053918 Ga0495602_0053918_906_1919 283
115 3300048903 Ga0496100_0128972 Ga0496100_0128972_750_1763 283
116 3300048908 Ga0496105_0005595 Ga0496105_0005595_4355_5368 283
117 3300048921 Ga0496118_0188289 Ga0496118_0188289_37_1050 283
118 3300048923 Ga0496120_0010703 Ga0496120_0010703_4999_6012 283
119 3300048928 Ga0496125_0104374 Ga0496125_0104374_512_1525 283
120 3300050492 nmdc:mga0yw44_35390_c1 nmdc:mga0yw44_35390_c1_523_1464 283
121 3300053077 Ga0495601_0199096 Ga0495601_0199096_100_1017 283
122 3300053098 Ga0500650_0055084 Ga0500650_0055084_249_1190 283
123 3300053109 Ga0500569_014459 Ga0500569_014459_910_1851 283
124 3300053142 Ga0500577_0033509 Ga0500577_0033509_615_1556 283
125 3300053731 Ga0500609_002156 Ga0500609_002156_382_1323 283
126 3300005530 Ga0070679_100037472 Ga0070679_1000374724 284
127 3300005539 Ga0068853_100130206 Ga0068853_1001302063 284
128 3300025917 Ga0207660_10101298 Ga0207660_101012983 284
129 3300037418 Ga0395900_0201794 Ga0395900_0201794_296_1216 284
130 3300009545 Ga0105237_10206221 Ga0105237_102062211 285
131 3300035692 Ga0373935_0055887 Ga0373935_0055887_1379_2290 285
132 3300035695 Ga0373927_0027113 Ga0373927_0027113_455_1366 285
133 3300046454 Ga0495592_0190651 Ga0495592_0190651_406_1317 285
134 3300046557 Ga0495622_0051205 Ga0495622_0051205_363_1274 285
135 3300046678 Ga0495599_0171615 Ga0495599_0171615_276_1187 285
136 3300048920 Ga0496117_0067801 Ga0496117_0067801_1281_2192 285
137 3300048921 Ga0496118_0003016 Ga0496118_0003016_11547_12458 285
138 3300048924 Ga0496121_0000041 Ga0496121_0000041_165866_166777 285
139 3300048927 Ga0496124_0006721 Ga0496124_0006721_5384_6295 285
140 3300048929 Ga0496126_0053820 Ga0496126_0053820_877_1788 285
141 3300053094 Ga0500566_0043837 Ga0500566_0043837_89_1000 285
142 3300053150 Ga0500603_067225 Ga0500603_067225_49_960 285
143 3300053733 Ga0500552_000771 Ga0500552_000771_159_1070 285
144 3300053735 Ga0500596_001440 Ga0500596_001440_3821_4732 285
145 3300048924 Ga0496121_0071824 Ga0496121_0071824_1422_2372 286
146 3300053130 Ga0500642_0000051 Ga0500642_0000051_30734_31753 286
147 3300009545 Ga0105237_10399960 Ga0105237_103999602 287
148 3300049583 Ga0501067_0021251 Ga0501067_0021251_915_1877 287
149 3300025914 Ga0207671_10154511 Ga0207671_101545113 288
150 3300030521 Ga0307511_10114407 Ga0307511_101144071 288
151 3300033179 Ga0307507_10006824 Ga0307507_1000682418 288
152 3300045976 Ga0466967_0184717 Ga0466967_0184717_820_1779 288
153 3300053094 Ga0500566_0000608 Ga0500566_0000608_9215_10252 288
154 3300061719 Ga0466962_0045345 Ga0466962_0045345_28_987 288
155 3300005544 Ga0070686_100163559 Ga0070686_1001635592 290
156 3300025961 Ga0207712_10017129 Ga0207712_100171293 290
157 3300039145 Ga0237816_02524 Ga0237816_02524_480_1373 291
158 3300005434 Ga0070709_10027137 Ga0070709_100271372 293
159 3300005437 Ga0070710_10012215 Ga0070710_100122155 293
160 3300025898 Ga0207692_10021439 Ga0207692_100214393 293
161 3300025916 Ga0207663_10045486 Ga0207663_100454863 293
162 3300009093 Ga0105240_10003278 Ga0105240_1000327816 294
163 3300009098 Ga0105245_10082016 Ga0105245_100820163 294
164 3300009545 Ga0105237_10001694 Ga0105237_1000169421 294
165 3300010375 Ga0105239_10065020 Ga0105239_100650203 294
166 3300013104 Ga0157370_10153088 Ga0157370_101530883 294
167 3300014968 Ga0157379_10197101 Ga0157379_101971012 294
168 3300025911 Ga0207654_10045215 Ga0207654_100452153 294
169 3300025913 Ga0207695_10000008 Ga0207695_10000008868 294
170 3300025914 Ga0207671_10010103 Ga0207671_100101035 294
171 3300026142 Ga0207698_10059392 Ga0207698_100593923 294
172 3300028381 Ga0268264_10337985 Ga0268264_103379852 294
173 3300048925 Ga0496122_0071759 Ga0496122_0071759_977_1867 294
174 3300048929 Ga0496126_0049685 Ga0496126_0049685_1405_2295 294
175 3300048929 Ga0496126_0369665 Ga0496126_0369665_186_1076 294
176 3300049568 Ga0501031_0000652 Ga0501031_0000652_15148_16038 294
177 3300049569 Ga0501032_0002299 Ga0501032_0002299_1029_1919 294
178 3300049569 Ga0501032_0036945 Ga0501032_0036945_736_1626 294
179 3300049570 Ga0501033_0000091 Ga0501033_0000091_18034_18924 294
180 3300049571 Ga0501034_0000039 Ga0501034_0000039_133699_134589 294
181 3300049571 Ga0501034_0636407 Ga0501034_0636407_67_957 294
182 3300049572 Ga0501036_0000052 Ga0501036_0000052_51553_52443 294
183 3300049573 Ga0501037_0000025 Ga0501037_0000025_36267_37157 294
184 3300049574 Ga0501038_0002924 Ga0501038_0002924_13122_14012 294
185 3300049574 Ga0501038_0211707 Ga0501038_0211707_63_953 294
186 3300049575 Ga0501039_0000719 Ga0501039_0000719_3769_4659 294
187 3300049579 Ga0501043_0000928 Ga0501043_0000928_2699_3589 294
188 3300049580 Ga0501046_0000231 Ga0501046_0000231_47374_48264 294
189 3300049581 Ga0501047_0000457 Ga0501047_0000457_13783_14673 294
190 3300049581 Ga0501047_0024108 Ga0501047_0024108_2564_3454 294
191 3300049582 Ga0501048_0000218 Ga0501048_0000218_33958_34848 294
192 3300049583 Ga0501067_0003111 Ga0501067_0003111_3278_4168 294
193 3300049584 Ga0501068_0001352 Ga0501068_0001352_2194_3084 294
194 3300049586 Ga0501070_0002829 Ga0501070_0002829_1889_2779 294
195 3300049587 Ga0501071_0026801 Ga0501071_0026801_2688_3578 294
196 3300049588 Ga0501072_0004469 Ga0501072_0004469_4371_5261 294
197 3300049589 Ga0501073_0000877 Ga0501073_0000877_10612_11502 294
198 3300049590 Ga0501074_0000273 Ga0501074_0000273_25529_26419 294
199 3300049741 Ga0501079_0011695 Ga0501079_0011695_5138_6028 294
200 3300049742 Ga0501080_0000124 Ga0501080_0000124_9852_10742 294
201 3300049744 Ga0501083_0000785 Ga0501083_0000785_857_1747 294
202 3300049822 Ga0501035_0000052 Ga0501035_0000052_66055_66945 294
203 3300049822 Ga0501035_0135984 Ga0501035_0135984_1159_2049 294
204 3300049823 Ga0501044_0000217 Ga0501044_0000217_50000_50890 294
205 3300049823 Ga0501044_0100080 Ga0501044_0100080_1119_2009 294
206 3300049824 Ga0501045_0010874 Ga0501045_0010874_2955_3845 294
207 3300054114 Ga0501084_0000683 Ga0501084_0000683_9867_10757 294
208 3300060353 Ga0501082_0007986 Ga0501082_0007986_4301_5191 294
209 3300048915 Ga0496112_0000044 Ga0496112_0000044_74138_75028 295
210 3300048918 Ga0496115_0175726 Ga0496115_0175726_612_1505 295
211 3300005339 Ga0070660_100118218 Ga0070660_1001182182 296
212 iso_pu_bacteria 8006994254 8007000961 296
213 3300021358 Ga0213873_10002543 Ga0213873_100025431 297
214 3300021384 Ga0213876_10006112 Ga0213876_100061127 297
215 3300039437 Ga0436365_1276870 Ga0436365_1276870_6441_7370 297
216 3300039453 Ga0436362_0966777 Ga0436362_0966777_1689_2618 297
217 iso_pu_bacteria 2507262055 2507507596 298
218 iso_pu_bacteria 2508501009 2508541715 298
219 iso_pu_bacteria 2508501042 2508692743 298
220 iso_pu_bacteria 2511231028 2511397091 298
221 iso_pu_bacteria 2513237092 2513621797 298
222 iso_pu_bacteria 2513237094 2513636760 298
223 iso_pu_bacteria 2513237095 2513647581 298
224 iso_pu_bacteria 2513237101 2513697094 298
225 iso_pu_bacteria 2513237102 2513701382 298
226 iso_pu_bacteria 2513237139 2513878709 298
227 iso_pu_bacteria 2513237161 2514009363 298
228 iso_pu_bacteria 2515154112 2515626140 298
229 iso_pu_bacteria 2517093001 2517104225 298
230 iso_pu_bacteria 2528768022 2528848913 298
231 iso_pu_bacteria 2617270735 2617346864 298
232 iso_pu_bacteria 2617270741 2617372795 298
233 iso_pu_bacteria 2721755755 2723843626 298
234 iso_pu_bacteria 2791355196 2793060941 298
235 iso_pu_bacteria 2791355199 2793083853 298
236 iso_pu_bacteria 2802429603 2805921358 298
237 iso_pu_bacteria 2816332527 2818236618 298
238 iso_pu_bacteria 2824600985 2824605198 298
239 iso_pu_bacteria 2824609381 2824615517 298
240 iso_pu_bacteria 2824617872 2824620486 298
241 iso_pu_bacteria 2824626560 2824628466 298
242 iso_pu_bacteria 2824635225 2824637166 298
243 iso_pu_bacteria 2824644064 2824645911 298
244 iso_pu_bacteria 2824653114 2824656404 298
245 iso_pu_bacteria 2824661429 2824666194 298
246 iso_pu_bacteria 2824671348 2824673704 298
247 iso_pu_bacteria 2824679649 2824681761 298
248 iso_pu_bacteria 2824687955 2824690671 298
249 iso_pu_bacteria 2824704595 2824709824 298
250 iso_pu_bacteria 2824714736 2824716578 298
251 iso_pu_bacteria 2824723954 2824725559 298
252 iso_pu_bacteria 2824732956 2824736080 298
253 iso_pu_bacteria 2824746037 2824748798 298
254 iso_pu_bacteria 2824753945 2824756048 298
255 iso_pu_bacteria 2824763712 2824767586 298
256 iso_pu_bacteria 2824773399 2824775059 298
257 iso_pu_bacteria 2838122688 2838129286 298
258 iso_pu_bacteria 2841941048 2841948058 298
259 iso_pu_bacteria 2841949485 2841953545 298
260 iso_pu_bacteria 2841957949 2841962857 298
261 iso_pu_bacteria 2841966195 2841973050 298
262 iso_pu_bacteria 2841974524 2841978273 298
263 iso_pu_bacteria 2841983080 2841990492 298
264 iso_pu_bacteria 2842038055 2842040716 298
265 iso_pu_bacteria 2842045827 2842046338 298
266 iso_pu_bacteria 2847930680 2847937387 298
267 iso_pu_bacteria 2847939898 2847947812 298
268 iso_pu_bacteria 2849076700 2849078330 298
269 iso_pu_bacteria 2857509624 2857512710 298
270 iso_pu_bacteria 2874590934 2874598712 298
271 iso_pu_bacteria 2874604998 2874607162 298
272 iso_pu_bacteria 2874612657 2874614505 298
273 iso_pu_bacteria 2874620515 2874628144 298
274 iso_pu_bacteria 2874628541 2874634940 298
275 iso_pu_bacteria 2874645413 2874652167 298
276 iso_pu_bacteria 2876771140 2876778751 298
277 iso_pu_bacteria 2876818435 2876824354 298
278 iso_pu_bacteria 2879074833 2879082544 298
279 iso_pu_bacteria 2879083081 2879086688 298
280 iso_pu_bacteria 2879099564 2879107777 298
281 iso_pu_bacteria 2879110137 2879114049 298
282 iso_pu_bacteria 2879127579 2879131461 298
283 iso_pu_bacteria 2879142872 2879147907 298
284 iso_pu_bacteria 2881364244 2881371396 298
285 iso_pu_bacteria 2881665667 2881666650 298
286 iso_pu_bacteria 2885366525 2885370031 298
287 iso_pu_bacteria 2885409591 2885415667 298
288 iso_pu_bacteria 2888378607 2888385518 298
289 iso_pu_bacteria 2888388044 2888392712 298
290 iso_pu_bacteria 2888419890 2888425650 298
291 iso_pu_bacteria 2889033259 2889037948 298
292 iso_pu_bacteria 2904666416 2904674238 298
293 iso_pu_bacteria 2904711408 2904711907 298
294 iso_pu_bacteria 2906643746 2906647358 298
295 iso_pu_bacteria 2908775508 2908781239 298
296 iso_pu_bacteria 2922361189 2922361886 298
297 iso_pu_bacteria 2922368715 2922372338 298
298 iso_pu_bacteria 2922386360 2922386881 298
299 iso_pu_bacteria 2922393267 2922397012 298
300 iso_pu_bacteria 2929615660 2929621091 298
301 iso_pu_bacteria 2929624759 2929626078 298
302 iso_pu_bacteria 2932784394 2932785048 298
303 iso_pu_bacteria 2932794094 2932795087 298
304 iso_pu_bacteria 2932801729 2932805615 298
305 iso_pu_bacteria 2932809354 2932810076 298
306 iso_pu_bacteria 2932818245 2932821650 298
307 iso_pu_bacteria 2932828146 2932828884 298
308 iso_pu_bacteria 2933577622 2933583039 298
309 iso_pu_bacteria 2935608549 2935609896 298
310 iso_pu_bacteria 2935616580 2935619696 298
311 iso_pu_bacteria 2935638405 2935638676 298
312 iso_pu_bacteria 2935648319 2935652074 298
313 iso_pu_bacteria 2935656913 2935659953 298
314 iso_pu_bacteria 2935665750 2935666472 298
315 iso_pu_bacteria 2935675223 2935676485 298
316 iso_pu_bacteria 2935684952 2935690999 298
317 iso_pu_bacteria 2935694250 2935694567 298
318 iso_pu_bacteria 2935703347 2935703682 298
319 iso_pu_bacteria 2935713505 2935718380 298
320 iso_pu_bacteria 2935722832 2935727640 298
321 iso_pu_bacteria 2935732158 2935736343 298
322 iso_pu_bacteria 2935741537 2935745723 298
323 iso_pu_bacteria 2935750917 2935756104 298
324 iso_pu_bacteria 2935760218 2935760636 298
325 iso_pu_bacteria 2935769743 2935776055 298
326 iso_pu_bacteria 2935777560 2935783487 298
327 iso_pu_bacteria 2935785616 2935791932 298
328 iso_pu_bacteria 2935793552 2935800258 298
329 iso_pu_bacteria 2935801545 2935801820 298
330 iso_pu_bacteria 2935810662 2935814765 298
331 iso_pu_bacteria 2935819856 2935823056 298
332 iso_pu_bacteria 2935827899 2935828170 298
333 iso_pu_bacteria 2935837841 2935842375 298
334 iso_pu_bacteria 2935847175 2935848638 298
335 iso_pu_bacteria 2935855204 2935857989 298
336 iso_pu_bacteria 2935864058 2935867893 298
337 iso_pu_bacteria 2935873716 2935874083 298
338 iso_pu_bacteria 2935883170 2935885815 298
339 iso_pu_bacteria 2935908558 2935909556 298
340 iso_pu_bacteria 2935916978 2935917281 298
341 iso_pu_bacteria 2935926038 2935927037 298
342 iso_pu_bacteria 2935934488 2935937119 298
343 iso_pu_bacteria 2935942939 2935944578 298
344 iso_pu_bacteria 2935951376 2935953015 298
345 iso_pu_bacteria 2935967501 2935969855 298
346 iso_pu_bacteria 2935975950 2935976452 298
347 iso_pu_bacteria 2935984226 2935987098 298
348 iso_pu_bacteria 2935992306 2935992992 298
349 iso_pu_bacteria 2936002035 2936002904 298
350 iso_pu_bacteria 2936011229 2936014369 298
351 iso_pu_bacteria 2936019824 2936023791 298
352 iso_pu_bacteria 2936028420 2936031434 298
353 iso_pu_bacteria 2936037263 2936040592 298
354 iso_pu_bacteria 2936046547 2936049475 298
355 iso_pu_bacteria 2936055302 2936062225 298
356 iso_pu_bacteria 2940556831 2940561921 298
357 iso_pu_bacteria 2941531003 2941531276 298
358 iso_pu_bacteria 2941538514 2941542424 298
359 iso_pu_bacteria 3005483717 3005485468 298
360 iso_pu_bacteria 3005506211 3005508373 298
361 iso_pu_bacteria 3005587118 3005588127 298
362 iso_pu_bacteria 8006964411 8006968821 298
363 iso_pu_bacteria 8006984368 8006984500 298
364 iso_pu_bacteria 8016522445 8016528618 298
365 iso_pu_bacteria 8016530956 8016533788 298
366 iso_pu_bacteria 8016548790 8016555105 298
367 iso_pu_bacteria 8016557553 8016563470 298
368 iso_pu_bacteria 8016566248 8016572124 298
369 iso_pu_bacteria 8016575299 8016576322 298
370 iso_pu_bacteria 8016595262 8016601217 298
371 iso_pu_bacteria 8016603502 8016609221 298
372 iso_pu_bacteria 8016613128 8016615682 298
373 iso_pu_bacteria 8016622563 8016625543 298
374 iso_pu_bacteria 8016630954 8016639102 298
375 iso_pu_bacteria 8017057580 8017064996 298
376 iso_pu_bacteria 8019530166 8019533564 298
377 iso_pu_bacteria 8019538911 8019546106 298
378 iso_pu_bacteria 8019547302 8019552600 298
379 iso_pu_bacteria 8019576017 8019584374 298
380 iso_pu_bacteria 8019586578 8019592145 298
381 iso_pu_bacteria 8019597564 8019599136 298
382 iso_pu_bacteria 8019619141 8019619882 298
383 iso_pu_bacteria 8019629233 8019633235 298
384 iso_pu_bacteria 8019638758 8019646664 298
385 iso_pu_bacteria 8019659431 8019661104 298
386 iso_pu_bacteria 8019668869 8019670662 298
387 iso_pu_bacteria 8019678201 8019685569 298
388 iso_pu_bacteria 8019687851 8019691138 298
389 iso_pu_bacteria 8055742211 8055745046 298
390 iso_pu_bacteria 8056673599 8056677483 298
391 3300005327 Ga0070658_10005755 Ga0070658_100057553 299
392 3300005328 Ga0070676_10068276 Ga0070676_100682763 299
393 3300005328 Ga0070676_10129692 Ga0070676_101296922 299
394 3300005329 Ga0070683_100007952 Ga0070683_1000079523 299
395 3300005331 Ga0070670_100037139 Ga0070670_1000371392 299
396 3300005333 Ga0070677_10002920 Ga0070677_100029202 299
397 3300005338 Ga0068868_100021088 Ga0068868_1000210882 299
398 3300005338 Ga0068868_100118279 Ga0068868_1001182792 299
399 3300005339 Ga0070660_100094301 Ga0070660_1000943012 299
400 3300005340 Ga0070689_100250614 Ga0070689_1002506142 299
401 3300005344 Ga0070661_100004144 Ga0070661_1000041444 299
402 3300005353 Ga0070669_100037552 Ga0070669_1000375523 299
403 3300005353 Ga0070669_100182244 Ga0070669_1001822442 299
404 3300005354 Ga0070675_100008566 Ga0070675_1000085667 299
405 3300005355 Ga0070671_100191918 Ga0070671_1001919182 299
406 3300005356 Ga0070674_100000518 Ga0070674_10000051815 299
407 3300005356 Ga0070674_100003318 Ga0070674_1000033187 299
408 3300005364 Ga0070673_100064373 Ga0070673_1000643732 299
409 3300005366 Ga0070659_100033568 Ga0070659_1000335684 299
410 3300005367 Ga0070667_100007713 Ga0070667_1000077136 299
411 3300005456 Ga0070678_100003918 Ga0070678_1000039185 299
412 3300005456 Ga0070678_100162088 Ga0070678_1001620881 299
413 3300005457 Ga0070662_100437376 Ga0070662_1004373761 299
414 3300005459 Ga0068867_100004484 Ga0068867_10000448410 299
415 3300005535 Ga0070684_100002660 Ga0070684_1000026607 299
416 3300005535 Ga0070684_100185011 Ga0070684_1001850112 299
417 3300005543 Ga0070672_100000150 Ga0070672_10000015025 299
418 3300005543 Ga0070672_100026924 Ga0070672_1000269244 299
419 3300005547 Ga0070693_100053632 Ga0070693_1000536322 299
420 3300005548 Ga0070665_100095325 Ga0070665_1000953253 299
421 3300005564 Ga0070664_100020769 Ga0070664_1000207695 299
422 3300005577 Ga0068857_100175773 Ga0068857_1001757732 299
423 3300005578 Ga0068854_100001586 Ga0068854_1000015866 299
424 3300005614 Ga0068856_100002765 Ga0068856_10000276511 299
425 3300005616 Ga0068852_100012408 Ga0068852_1000124084 299
426 3300005616 Ga0068852_100015875 Ga0068852_1000158756 299
427 3300005618 Ga0068864_100125965 Ga0068864_1001259652 299
428 3300005618 Ga0068864_100280962 Ga0068864_1002809622 299
429 3300005719 Ga0068861_100007671 Ga0068861_1000076717 299
430 3300005840 Ga0068870_10064238 Ga0068870_100642382 299
431 3300005841 Ga0068863_100019290 Ga0068863_1000192903 299
432 3300005841 Ga0068863_100354582 Ga0068863_1003545822 299
433 3300005842 Ga0068858_100006988 Ga0068858_1000069884 299
434 3300005843 Ga0068860_100064651 Ga0068860_1000646513 299
435 3300005843 Ga0068860_100090365 Ga0068860_1000903653 299
436 3300006358 Ga0068871_100019118 Ga0068871_1000191185 299
437 3300009093 Ga0105240_10593043 Ga0105240_105930431 299
438 3300009174 Ga0105241_10383282 Ga0105241_103832821 299
439 3300009177 Ga0105248_10025180 Ga0105248_100251804 299
440 3300009177 Ga0105248_10397254 Ga0105248_103972542 299
441 3300009551 Ga0105238_10004287 Ga0105238_100042873 299
442 3300009553 Ga0105249_10001498 Ga0105249_1000149816 299
443 3300013296 Ga0157374_10097214 Ga0157374_100972143 299
444 3300013306 Ga0163162_10020520 Ga0163162_100205204 299
445 3300013307 Ga0157372_10109670 Ga0157372_101096703 299
446 3300013308 Ga0157375_10020672 Ga0157375_100206725 299
447 3300013308 Ga0157375_10269324 Ga0157375_102693242 299
448 3300014326 Ga0157380_10001208 Ga0157380_1000120816 299
449 3300014326 Ga0157380_10204433 Ga0157380_102044332 299
450 3300014968 Ga0157379_10009787 Ga0157379_100097877 299
451 3300014968 Ga0157379_10013513 Ga0157379_100135134 299
452 3300014969 Ga0157376_10079936 Ga0157376_100799363 299
453 3300017792 Ga0163161_10017129 Ga0163161_100171292 299
454 3300021384 Ga0213876_10067134 Ga0213876_100671342 299
455 3300025321 Ga0207656_10023712 Ga0207656_100237123 299
456 3300025321 Ga0207656_10155796 Ga0207656_101557961 299
457 3300025893 Ga0207682_10000759 Ga0207682_100007597 299
458 3300025901 Ga0207688_10064671 Ga0207688_100646712 299
459 3300025907 Ga0207645_10023994 Ga0207645_100239944 299
460 3300025907 Ga0207645_10044376 Ga0207645_100443762 299
461 3300025908 Ga0207643_10067337 Ga0207643_100673372 299
462 3300025909 Ga0207705_10072358 Ga0207705_100723583 299
463 3300025913 Ga0207695_10322858 Ga0207695_103228582 299
464 3300025918 Ga0207662_10066120 Ga0207662_100661203 299
465 3300025919 Ga0207657_10030571 Ga0207657_100305714 299
466 3300025919 Ga0207657_10141002 Ga0207657_101410022 299
467 3300025923 Ga0207681_10006914 Ga0207681_100069144 299
468 3300025923 Ga0207681_10010182 Ga0207681_100101825 299
469 3300025924 Ga0207694_10012939 Ga0207694_100129392 299
470 3300025925 Ga0207650_10002442 Ga0207650_1000244210 299
471 3300025926 Ga0207659_10000135 Ga0207659_1000013534 299
472 3300025926 Ga0207659_10012550 Ga0207659_100125503 299
473 3300025927 Ga0207687_10192296 Ga0207687_101922962 299
474 3300025931 Ga0207644_10020254 Ga0207644_100202542 299
475 3300025932 Ga0207690_10054941 Ga0207690_100549413 299
476 3300025933 Ga0207706_10002883 Ga0207706_1000288315 299
477 3300025933 Ga0207706_10110757 Ga0207706_101107572 299
478 3300025937 Ga0207669_10012119 Ga0207669_100121193 299
479 3300025940 Ga0207691_10002113 Ga0207691_100021136 299
480 3300025940 Ga0207691_10025132 Ga0207691_100251323 299
481 3300025940 Ga0207691_10364215 Ga0207691_103642152 299
482 3300025941 Ga0207711_10032396 Ga0207711_100323963 299
483 3300025944 Ga0207661_10036834 Ga0207661_100368343 299
484 3300025945 Ga0207679_10003707 Ga0207679_100037073 299
485 3300025960 Ga0207651_10000647 Ga0207651_100006477 299
486 3300025986 Ga0207658_10014926 Ga0207658_100149262 299
487 3300025986 Ga0207658_10058472 Ga0207658_100584722 299
488 3300026023 Ga0207677_10005607 Ga0207677_100056077 299
489 3300026035 Ga0207703_10005700 Ga0207703_100057005 299
490 3300026035 Ga0207703_10151611 Ga0207703_101516112 299
491 3300026067 Ga0207678_10016124 Ga0207678_100161245 299
492 3300026078 Ga0207702_10200973 Ga0207702_102009731 299
493 3300026089 Ga0207648_10002879 Ga0207648_1000287916 299
494 3300026089 Ga0207648_10036193 Ga0207648_100361933 299
495 3300026089 Ga0207648_10489998 Ga0207648_104899982 299
496 3300026095 Ga0207676_10040495 Ga0207676_100404952 299
497 3300026095 Ga0207676_10155254 Ga0207676_101552541 299
498 3300026116 Ga0207674_10139575 Ga0207674_101395752 299
499 3300026116 Ga0207674_10303432 Ga0207674_103034322 299
500 3300026142 Ga0207698_10004390 Ga0207698_100043909 299
501 3300028379 Ga0268266_10060289 Ga0268266_100602892 299
502 3300028381 Ga0268264_10342113 Ga0268264_103421132 299
503 3300031249 Ga0265339_10053306 Ga0265339_100533063 299
504 3300031852 Ga0307410_10005624 Ga0307410_100056243 299
505 3300031852 Ga0307410_10210576 Ga0307410_102105762 299
506 3300031901 Ga0307406_10003804 Ga0307406_100038046 299
507 3300031903 Ga0307407_10031383 Ga0307407_100313834 299
508 3300031911 Ga0307412_10435276 Ga0307412_104352762 299
509 3300032002 Ga0307416_100003421 Ga0307416_1000034214 299
510 3300032005 Ga0307411_10039581 Ga0307411_100395814 299
511 3300035120 Ga0373957_0077728 Ga0373957_0077728_74_973 299
512 3300035172 Ga0373955_0072253 Ga0373955_0072253_701_1600 299
513 3300035242 Ga0373962_0008156 Ga0373962_0008156_1068_1967 299
514 3300035691 Ga0373931_0011120 Ga0373931_0011120_2502_3401 299
515 3300037068 Ga0373925_0072696 Ga0373925_0072696_786_1685 299
516 3300039437 Ga0436365_0496646 Ga0436365_0496646_2156_3055 299
517 3300046459 Ga0495629_0007286 Ga0495629_0007286_3889_4788 299
518 3300046543 Ga0495645_0156327 Ga0495645_0156327_43_942 299
519 3300046663 Ga0495635_0111434 Ga0495635_0111434_310_1209 299
520 3300046683 Ga0495658_0031727 Ga0495658_0031727_1962_2861 299
521 3300046689 Ga0495613_0218574 Ga0495613_0218574_42_941 299
522 3300047471 Ga0495684_0024756 Ga0495684_0024756_1642_2541 299
523 3300048907 Ga0496104_0428269 Ga0496104_0428269_285_1184 299
524 3300048909 Ga0496106_0048620 Ga0496106_0048620_666_1565 299
525 3300048910 Ga0496107_0109796 Ga0496107_0109796_826_1725 299
526 3300048911 Ga0496108_0348436 Ga0496108_0348436_230_1129 299
527 3300048917 Ga0496114_0156020 Ga0496114_0156020_69_968 299
528 3300053084 Ga0495595_0151629 Ga0495595_0151629_139_1038 299
529 3300053085 Ga0495619_0019088 Ga0495619_0019088_3221_4120 299
530 iso_pu_bacteria 2643221651 2644291325 299
531 3300035398 Ga0316574_0000847 Ga0316574_0000847_8179_9084 300
532 iso_pu_bacteria 2508501128 2509152987 300
533 iso_pu_bacteria 2513237096 2513654154 300
534 iso_pu_bacteria 2513237098 2513674841 300
535 iso_pu_bacteria 2513237104 2513721226 300
536 iso_pu_bacteria 2513237137 2513856909 300
537 iso_pu_bacteria 2513237145 2513918494 300
538 iso_pu_bacteria 2517572143 2517891271 300
539 iso_pu_bacteria 2524023205 2524436213 300
540 iso_pu_bacteria 2524023210 2524468220 300
541 iso_pu_bacteria 2744054633 2745080831 300
542 iso_pu_bacteria 2791355197 2793066634 300
543 iso_pu_bacteria 2844315083 2844320094 300
544 iso_pu_bacteria 2876761206 2876768154 300
545 iso_pu_bacteria 2885374607 2885376582 300
546 iso_pu_bacteria 2903727486 2903730232 300
547 iso_pu_bacteria 2903748898 2903757683 300
548 iso_pu_bacteria 2904690495 2904694201 300
549 iso_pu_bacteria 2904699407 2904701194 300
550 iso_pu_bacteria 2906602504 2906609919 300
551 iso_pu_bacteria 2906610324 2906616455 300
552 iso_pu_bacteria 2906626472 2906627660 300
553 iso_pu_bacteria 2906635258 2906640011 300
554 iso_pu_bacteria 2906660503 2906662951 300
555 iso_pu_bacteria 2908739725 2908741609 300
556 iso_pu_bacteria 2908756301 2908759227 300
557 iso_pu_bacteria 2922425934 2922431529 300
558 iso_pu_bacteria 2935959822 2935962783 300
559 iso_pu_bacteria 3005474847 3005481323 300
560 iso_pu_bacteria 3005710791 3005715872 300
561 iso_pu_bacteria 3005718088 3005723229 300
562 iso_pu_bacteria 8006926726 8006930103 300
563 iso_pu_bacteria 8016583857 8016594428 300
564 iso_pu_bacteria 8019555841 8019565257 300
565 iso_pu_bacteria 8019565922 8019575361 300
566 3300005366 Ga0070659_100227289 Ga0070659_1002272892 301
567 3300005563 Ga0068855_100215006 Ga0068855_1002150063 301
568 3300013100 Ga0157373_10078674 Ga0157373_100786742 301
569 3300025909 Ga0207705_10092128 Ga0207705_100921281 301
570 3300025919 Ga0207657_10004384 Ga0207657_100043849 301
571 3300025933 Ga0207706_10472640 Ga0207706_104726401 301
572 3300038443 Ga0395901_0410324 Ga0395901_0410324_465_1376 301
573 3300045976 Ga0466967_0377309 Ga0466967_0377309_86_997 301
574 3300048928 Ga0496125_0000712 Ga0496125_0000712_18091_19071 301
575 3300053088 Ga0500644_0003960 Ga0500644_0003960_2452_3363 301
576 3300005331 Ga0070670_100131214 Ga0070670_1001312142 302
577 3300005337 Ga0070682_100127813 Ga0070682_1001278132 302
578 3300005347 Ga0070668_100098454 Ga0070668_1000984542 302
579 3300005356 Ga0070674_100058937 Ga0070674_1000589372 302
580 3300005456 Ga0070678_100141068 Ga0070678_1001410683 302
581 3300005457 Ga0070662_100352827 Ga0070662_1003528271 302
582 3300009093 Ga0105240_10058231 Ga0105240_100582314 302
583 3300025911 Ga0207654_10049589 Ga0207654_100495893 302
584 3300025914 Ga0207671_10007506 Ga0207671_100075067 302
585 3300025924 Ga0207694_10143346 Ga0207694_101433462 302
586 3300025925 Ga0207650_10165995 Ga0207650_101659952 302
587 3300025938 Ga0207704_10031670 Ga0207704_100316703 302
588 3300026041 Ga0207639_10406187 Ga0207639_104061871 302
589 3300026075 Ga0207708_10087740 Ga0207708_100877402 302
590 3300046523 Ga0495644_0063291 Ga0495644_0063291_456_1370 302
591 3300047472 Ga0495686_0041367 Ga0495686_0041367_1615_2532 302
592 3300048905 Ga0496102_0132063 Ga0496102_0132063_21_935 302
593 3300053085 Ga0495619_0181079 Ga0495619_0181079_141_1058 302
594 iso_pu_bacteria 2524023228 2524533524 302
595 iso_pu_bacteria 2667528175 2671123801 302
596 iso_pu_bacteria 2728368998 2728749968 302
597 iso_pu_bacteria 2935630451 2935636168 302
598 iso_pu_bacteria 2941507105 2941512799 302
599 iso_pu_bacteria 2941515067 2941520634 302
600 iso_pu_bacteria 2941523033 2941528648 302
601 iso_pu_bacteria 8006933436 8006939387 302
602 iso_pu_bacteria 8006973647 8006979042 302
603 iso_pu_bacteria 8056689827 8056690725 302
604 3300005329 Ga0070683_100196995 Ga0070683_1001969952 303
605 3300005455 Ga0070663_100015643 Ga0070663_1000156433 303
606 3300005616 Ga0068852_100343918 Ga0068852_1003439182 303
607 3300005618 Ga0068864_100517715 Ga0068864_1005177151 303
608 3300006881 Ga0068865_100097434 Ga0068865_1000974341 303
609 3300009098 Ga0105245_10015073 Ga0105245_100150731 303
610 3300009101 Ga0105247_10087830 Ga0105247_100878302 303
611 3300010375 Ga0105239_10361602 Ga0105239_103616021 303
612 3300013296 Ga0157374_10082425 Ga0157374_100824252 303
613 3300013306 Ga0163162_10384563 Ga0163162_103845632 303
614 3300013308 Ga0157375_10570368 Ga0157375_105703681 303
615 3300014325 Ga0163163_10126799 Ga0163163_101267993 303
616 3300014745 Ga0157377_10039056 Ga0157377_100390562 303
617 3300025900 Ga0207710_10062762 Ga0207710_100627622 303
618 3300025929 Ga0207664_10291567 Ga0207664_102915672 303
619 3300025938 Ga0207704_10066234 Ga0207704_100662342 303
620 3300025944 Ga0207661_10190172 Ga0207661_101901722 303
621 3300026067 Ga0207678_10086017 Ga0207678_100860173 303
622 3300026095 Ga0207676_10158341 Ga0207676_101583413 303
623 3300026142 Ga0207698_10305421 Ga0207698_103054212 303
624 3300048903 Ga0496100_0028657 Ga0496100_0028657_75_992 303
625 3300048904 Ga0496101_0004214 Ga0496101_0004214_5575_6492 303
626 3300048905 Ga0496102_0006143 Ga0496102_0006143_3910_4827 303
627 3300048906 Ga0496103_0062146 Ga0496103_0062146_584_1501 303
628 3300048908 Ga0496105_0092877 Ga0496105_0092877_506_1423 303
629 3300048909 Ga0496106_0057918 Ga0496106_0057918_1067_1984 303
630 3300048910 Ga0496107_0002113 Ga0496107_0002113_11320_12237 303
631 3300048911 Ga0496108_0071294 Ga0496108_0071294_971_1888 303
632 3300048912 Ga0496109_0063257 Ga0496109_0063257_2248_3165 303
633 3300048914 Ga0496111_0033737 Ga0496111_0033737_2216_3133 303
634 3300048916 Ga0496113_0051531 Ga0496113_0051531_37_954 303
635 3300048917 Ga0496114_0075757 Ga0496114_0075757_767_1684 303
636 3300048918 Ga0496115_0004269 Ga0496115_0004269_2622_3539 303
637 3300049580 Ga0501046_0075551 Ga0501046_0075551_976_1893 303
638 iso_pu_bacteria 3005710791 3005715674 303
639 3300005530 Ga0070679_100134648 Ga0070679_1001346482 304
640 3300005535 Ga0070684_100037881 Ga0070684_1000378811 304
641 3300005577 Ga0068857_100063575 Ga0068857_1000635752 304
642 3300005578 Ga0068854_100033855 Ga0068854_1000338554 304
643 3300005614 Ga0068856_100288187 Ga0068856_1002881872 304
644 3300005616 Ga0068852_100004505 Ga0068852_1000045058 304
645 3300005937 Ga0081455_10004053 Ga0081455_100040534 304
646 3300005981 Ga0081538_10050154 Ga0081538_100501542 304
647 3300006028 Ga0070717_10009249 Ga0070717_100092492 304
648 3300006038 Ga0075365_10011349 Ga0075365_100113495 304
649 3300006051 Ga0075364_10041354 Ga0075364_100413541 304
650 3300006177 Ga0075362_10055660 Ga0075362_100556601 304
651 3300006942 Ga0099824_1006123 Ga0099824_10061235 304
652 3300006943 Ga0099822_1000072 Ga0099822_10000728 304
653 3300009093 Ga0105240_10017290 Ga0105240_100172903 304
654 3300009098 Ga0105245_10047099 Ga0105245_100470994 304
655 3300009174 Ga0105241_10016146 Ga0105241_100161463 304
656 3300009545 Ga0105237_10004554 Ga0105237_100045547 304
657 3300009545 Ga0105237_10053262 Ga0105237_100532623 304
658 3300009551 Ga0105238_10004463 Ga0105238_100044639 304
659 3300009551 Ga0105238_10028572 Ga0105238_100285725 304
660 3300010375 Ga0105239_10011538 Ga0105239_100115383 304
661 3300013105 Ga0157369_10214476 Ga0157369_102144763 304
662 3300014968 Ga0157379_10036695 Ga0157379_100366951 304
663 3300025261 Ga0209233_1003464 Ga0209233_10034646 304
664 3300025904 Ga0207647_10119596 Ga0207647_101195961 304
665 3300025911 Ga0207654_10099332 Ga0207654_100993323 304
666 3300025913 Ga0207695_10008824 Ga0207695_100088247 304
667 3300025913 Ga0207695_10124795 Ga0207695_101247953 304
668 3300025921 Ga0207652_10068746 Ga0207652_100687463 304
669 3300025924 Ga0207694_10014250 Ga0207694_100142505 304
670 3300025924 Ga0207694_10024599 Ga0207694_100245993 304
671 3300025944 Ga0207661_10088109 Ga0207661_100881091 304
672 3300026116 Ga0207674_10078524 Ga0207674_100785243 304
673 3300027357 Ga0209589_1000011 Ga0209589_1000011152 304
674 3300027361 Ga0209489_100012 Ga0209489_100012152 304
675 3300027363 Ga0209700_100019 Ga0209700_100019152 304
676 3300031616 Ga0307508_10000015 Ga0307508_10000015171 304
677 3300033442 Ga0315911_1000002 Ga0315911_100000266 304
678 3300033544 Ga0316215_1002146 Ga0316215_10021462 304
679 3300037466 Ga0395898_0105086 Ga0395898_0105086_1564_2484 304
680 3300039450 Ga0436363_1359162 Ga0436363_1359162_333_1253 304
681 3300044694 Ga0466963_0179628 Ga0466963_0179628_13_969 304
682 3300044842 Ga0466957_0059293 Ga0466957_0059293_1141_2061 304
683 3300045049 Ga0466959_0033350 Ga0466959_0033350_603_1523 304
684 3300046524 Ga0495648_0004316 Ga0495648_0004316_2251_3171 304
685 3300047320 Ga0495672_0174664 Ga0495672_0174664_92_1012 304
686 3300048921 Ga0496118_0119224 Ga0496118_0119224_621_1565 304
687 3300048924 Ga0496121_0011806 Ga0496121_0011806_6177_7097 304
688 3300048929 Ga0496126_0232309 Ga0496126_0232309_524_1444 304
689 3300053094 Ga0500566_0032348 Ga0500566_0032348_310_1230 304
690 3300053102 Ga0500554_000716 Ga0500554_000716_3215_4135 304
691 3300053119 Ga0500595_000200 Ga0500595_000200_23980_24900 304
692 3300053119 Ga0500595_009172 Ga0500595_009172_158_1078 304
693 3300053139 Ga0500568_0010968 Ga0500568_0010968_2102_3022 304
694 3300053162 Ga0500638_000785 Ga0500638_000785_5325_6245 304
695 3300053178 Ga0500637_0000144 Ga0500637_0000144_14264_15184 304
696 3300061719 Ga0466962_0065872 Ga0466962_0065872_73_993 304
697 3300005434 Ga0070709_10039448 Ga0070709_100394481 305
698 3300005435 Ga0070714_100007489 Ga0070714_1000074892 305
699 3300005436 Ga0070713_100001931 Ga0070713_1000019314 305
700 3300005437 Ga0070710_10000550 Ga0070710_1000055011 305
701 3300005439 Ga0070711_100239395 Ga0070711_1002393951 305
702 3300005548 Ga0070665_100028020 Ga0070665_1000280205 305
703 3300006028 Ga0070717_10010145 Ga0070717_100101451 305
704 3300006163 Ga0070715_10000126 Ga0070715_1000012613 305
705 3300006173 Ga0070716_100005825 Ga0070716_1000058253 305
706 3300006175 Ga0070712_100012143 Ga0070712_1000121433 305
707 3300010159 Ga0099796_10083171 Ga0099796_100831711 305
708 3300014968 Ga0157379_10528526 Ga0157379_105285261 305
709 3300025898 Ga0207692_10014334 Ga0207692_100143342 305
710 3300025905 Ga0207685_10108092 Ga0207685_101080921 305
711 3300025906 Ga0207699_10049577 Ga0207699_100495773 305
712 3300025915 Ga0207693_10000683 Ga0207693_1000068318 305
713 3300025916 Ga0207663_10001947 Ga0207663_100019474 305
714 3300025939 Ga0207665_10000339 Ga0207665_1000033910 305
715 3300031712 Ga0265342_10007168 Ga0265342_100071681 305
716 3300032002 Ga0307416_100002779 Ga0307416_1000027797 305
717 3300032126 Ga0307415_100104199 Ga0307415_1001041992 305
718 3300035117 Ga0373953_0035797 Ga0373953_0035797_723_1646 305
719 3300035120 Ga0373957_0013071 Ga0373957_0013071_797_1720 305
720 3300035410 Ga0373924_0033008 Ga0373924_0033008_938_1861 305
721 3300035691 Ga0373931_0132514 Ga0373931_0132514_474_1397 305
722 3300036401 Ga0373937_0100979 Ga0373937_0100979_1057_1980 305
723 3300037068 Ga0373925_0022318 Ga0373925_0022318_1626_2549 305
724 3300037853 Ga0436364_1074833 Ga0436364_1074833_3219_4148 305
725 3300044656 Ga0466969_0042525 Ga0466969_0042525_1117_2055 305
726 3300044684 Ga0466966_0061017 Ga0466966_0061017_573_1532 305
727 3300046462 Ga0495651_0100648 Ga0495651_0100648_187_1110 305
728 3300046514 Ga0495618_0057476 Ga0495618_0057476_1323_2246 305
729 3300046516 Ga0495628_0235997 Ga0495628_0235997_77_1000 305
730 3300046517 Ga0495630_0052973 Ga0495630_0052973_1847_2770 305
731 3300046533 Ga0495640_0135972 Ga0495640_0135972_609_1532 305
732 3300046536 Ga0495587_0051821 Ga0495587_0051821_119_1042 305
733 3300046543 Ga0495645_0041434 Ga0495645_0041434_1713_2636 305
734 3300046557 Ga0495622_0127491 Ga0495622_0127491_192_1115 305
735 3300046559 Ga0495667_0031460 Ga0495667_0031460_781_1704 305
736 3300046680 Ga0495646_0053536 Ga0495646_0053536_49_972 305
737 3300046809 Ga0495600_0256848 Ga0495600_0256848_119_1042 305
738 3300047319 Ga0495674_0036465 Ga0495674_0036465_1702_2625 305
739 3300048904 Ga0496101_0058748 Ga0496101_0058748_721_1644 305
740 3300048904 Ga0496101_0061665 Ga0496101_0061665_715_1638 305
741 3300048905 Ga0496102_0072396 Ga0496102_0072396_443_1366 305
742 3300048905 Ga0496102_0097001 Ga0496102_0097001_223_1146 305
743 3300048907 Ga0496104_0018203 Ga0496104_0018203_3616_4539 305
744 3300048909 Ga0496106_0050208 Ga0496106_0050208_296_1219 305
745 3300048910 Ga0496107_0007328 Ga0496107_0007328_4692_5615 305
746 3300048910 Ga0496107_0046023 Ga0496107_0046023_868_1791 305
747 3300048911 Ga0496108_0447246 Ga0496108_0447246_31_954 305
748 3300048912 Ga0496109_0438307 Ga0496109_0438307_234_1157 305
749 3300048913 Ga0496110_0205416 Ga0496110_0205416_172_1095 305
750 3300048915 Ga0496112_0018080 Ga0496112_0018080_1340_2263 305
751 3300048915 Ga0496112_0139350 Ga0496112_0139350_1210_2133 305
752 3300048917 Ga0496114_0072007 Ga0496114_0072007_227_1150 305
753 3300048918 Ga0496115_0067760 Ga0496115_0067760_694_1617 305
754 3300048918 Ga0496115_0255204 Ga0496115_0255204_60_983 305
755 3300048918 Ga0496115_0321083 Ga0496115_0321083_263_1186 305
756 3300048929 Ga0496126_0032037 Ga0496126_0032037_1495_2418 305
757 3300048929 Ga0496126_0070101 Ga0496126_0070101_1303_2226 305
758 3300048929 Ga0496126_0208115 Ga0496126_0208115_622_1545 305
759 iso_pu_bacteria 8016511872 8016520582 305
760 3300009551 Ga0105238_10104419 Ga0105238_101044193 306
761 3300005434 Ga0070709_10013391 Ga0070709_100133911 307
762 3300005435 Ga0070714_100022201 Ga0070714_1000222016 307
763 3300005437 Ga0070710_10011800 Ga0070710_100118003 307
764 3300005439 Ga0070711_100073365 Ga0070711_1000733651 307
765 3300006028 Ga0070717_10044803 Ga0070717_100448033 307
766 3300025898 Ga0207692_10008557 Ga0207692_100085573 307
767 3300025906 Ga0207699_10014226 Ga0207699_100142261 307
768 3300025916 Ga0207663_10042784 Ga0207663_100427841 307
769 3300046462 Ga0495651_0098201 Ga0495651_0098201_127_1173 307
770 iso_pu_bacteria 3005594810 3005600380 307
771 iso_pu_bacteria 8056967851 8056975000 307
772 3300053725 Ga0500576_028192 Ga0500576_028192_1317_2372 308
773 3300003203 JGI25406J46586_10000223 JGI25406J46586_100002234 311
774 3300005985 Ga0081539_10000325 Ga0081539_1000032565 311
775 3300035695 Ga0373927_0044698 Ga0373927_0044698_74_1183 311
776 3300035725 Ga0373947_0007716 Ga0373947_0007716_22_1131 311
777 3300046455 Ga0495603_0028282 Ga0495603_0028282_900_2009 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08386

Abhydrolase_4

TAP-like protein

287

359

0.86

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

92

346

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

92

346

0.71

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

95

355

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ie6-assembly2.cif.gz_C-2 crystal structure of a lactonase mutant in complex with substrate b 0.9515 111 154
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8825 16 309
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8761 14 157
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8761 16 309
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8746 16 309
ID Description Score Start End Superfamily
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9479 18 307 3.40.50.1820
af_Q4CQ95_18_306_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9455 23 304 3.40.50.1820
af_A4HXH8_39_324_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9432 23 299 3.40.50.1820
af_P96935_7_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9322 18 307 3.40.50.1820
af_A4I3N6_52_340_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9233 23 303 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A431JT55-F1-model_v4 Alpha/beta hydrolase 0.9714 10 304 GO:0004806
GO:0046503
AF-A0A3S0BND3-F1-model_v4 Alpha/beta fold hydrolase 0.9677 13 286 GO:0004806
GO:0046503
AF-A0A1G0IAP8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.96 14 310 GO:0004806
GO:0046503
AF-A0A431JT55-F1-model_v4 Alpha/beta hydrolase 0.9586 10 304 GO:0004806
GO:0046503
AF-A0A7I8MJP8-F1-model_v4 Carboxyl esterase, a/b hydrolase 0.956 16 307 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.24 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map