F480376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 557 | 552 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0044698|Ga0373927_0044698_74_1183 |
| Length | 369 |
| Sequence | MIARALAPRLFVIPHCCGRTVNIAGVDLPLPRGQQAFCGGKNRAIEVPIAIPFCNPSRGTAKVNATAHQTPRIARANGIELCYEIFGDADAEPMLLIMGLAAQMIHWDDEFCRQLAARGFRVIRFDNRDIGRSSRMTGGKRLGALELLKLRFLKIPVAAPYTLRDMAEDTVGLMDVLGIKSAHLVGASMGGMIAQEIAISFPQRVRSLTSIMSTTGNPKVPGPTREASAMLMAPPPSTKEEYFERYAQTWKILRAGSFPQDEALDRARAERNFERGLNPTGVGRQLRAVLASGNRKERLASVRAPTLVIHGTVDPLVRPEGGKDTAASIPGAKLLMIEGMGHALPIRMWPQVIDAIDKHAHAASAKAMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 67 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 68 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 69 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 70 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 71 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 72 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 73 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 74 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 75 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 76 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 77 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 78 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 79 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 80 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 81 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 82 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 83 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 84 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 85 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 86 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 87 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 88 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 89 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 90 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 91 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 92 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 93 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 94 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 95 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 98 | 2904699407 | |||
| 99 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 100 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 101 | 2906610324 | |||
| 102 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 103 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 104 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 105 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 106 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 107 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 108 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 109 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 110 | 2922368715 | |||
| 111 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 112 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 113 | 2922425934 | |||
| 114 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 115 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 116 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 117 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 118 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 119 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 120 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 121 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 122 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 123 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 124 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 125 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 126 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 127 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 128 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 129 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 130 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 131 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 132 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 133 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 134 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 135 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 136 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 137 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 138 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 139 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 140 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 141 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 142 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 143 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 144 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 145 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 146 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 147 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 148 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 149 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 150 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 151 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 152 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 153 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 154 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 155 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 156 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 157 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 158 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 159 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 160 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 161 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 162 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 163 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 164 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 165 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 166 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 167 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 168 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 169 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 170 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 171 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 172 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 173 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 174 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 175 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 176 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 177 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 178 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 179 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 180 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 181 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 182 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 183 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 184 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 185 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 186 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 187 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 188 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 189 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 192 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 196 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 198 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 216 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 217 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 219 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 221 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 224 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 226 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 227 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 228 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 229 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 230 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 231 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 232 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 233 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 234 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 235 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 236 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 237 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 238 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 239 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 240 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 242 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 243 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 244 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 247 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 248 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 249 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 250 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 251 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 252 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 253 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 254 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 255 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 265 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 281 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 282 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 287 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 340 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 342 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 343 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 346 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 347 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 348 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 349 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 350 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 351 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 352 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 353 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 354 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 355 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 356 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 357 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 358 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 359 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 360 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 361 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 362 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 363 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 364 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 365 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 366 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 367 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 368 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 369 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 370 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 371 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 372 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 373 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 374 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 375 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 376 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 377 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 378 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 379 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 380 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 381 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 382 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 383 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 384 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 385 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 386 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 387 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 388 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 389 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 390 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 433 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 434 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 435 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 436 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 437 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 438 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 442 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 443 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 444 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 445 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 446 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 447 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 448 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 449 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 450 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 451 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 452 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 453 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 454 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 481 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 482 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 483 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 484 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 485 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 490 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 494 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 497 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 499 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 501 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 502 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 503 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 506 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 509 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 510 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 511 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 513 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 515 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 518 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 519 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 520 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 521 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 522 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 523 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 524 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 525 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 526 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 527 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 528 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 529 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 530 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 531 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 532 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 533 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 534 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 535 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 536 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 537 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 538 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 539 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 540 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 541 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 542 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 543 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 544 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 545 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 546 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 547 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 548 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 549 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 550 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 551 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 552 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 553 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 554 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 555 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 556 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 557 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.5 |
| Metatranscriptomes | 0 |
| Isolates | 28.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.72 |
| Nodule | 22.27 |
| Rhizoplane | 5.79 |
| Rhizosphere | 52.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000223 | 3300003203 | Bacteria | 25081 |
| 2 | JGI25160J50197_1002236 | 3300003354 | Bacteria | 9086 |
| 3 | Ga0055543_1003779 | 3300004625 | Bacteria | 4317 |
| 4 | Ga0065165_1001214 | 3300005262 | Bacteria | 29682 |
| 5 | Ga0070658_10005755 | 3300005327 | Bacteria | 10053 |
| 6 | Ga0070658_10029138 | 3300005327 | Bacteria | 4434 |
| 7 | Ga0070676_10068276 | 3300005328 | Bacteria | 2128 |
| 8 | Ga0070676_10129692 | 3300005328 | Bacteria | 1593 |
| 9 | Ga0070683_100007952 | 3300005329 | Bacteria | 8995 |
| 10 | Ga0070683_100196995 | 3300005329 | Bacteria | 1913 |
| 11 | Ga0070670_100037139 | 3300005331 | Bacteria | 4191 |
| 12 | Ga0070670_100131214 | 3300005331 | Bacteria | 2164 |
| 13 | Ga0070677_10002920 | 3300005333 | Bacteria | 5491 |
| 14 | Ga0070682_100127813 | 3300005337 | Bacteria | 1716 |
| 15 | Ga0068868_100021088 | 3300005338 | Bacteria | 4905 |
| 16 | Ga0068868_100118279 | 3300005338 | Bacteria | 2160 |
| 17 | Ga0070660_100085153 | 3300005339 | Bacteria | 2485 |
| 18 | Ga0070660_100094301 | 3300005339 | Bacteria | 2365 |
| 19 | Ga0070660_100118218 | 3300005339 | Bacteria | 2114 |
| 20 | Ga0070689_100250614 | 3300005340 | Bacteria | 1461 |
| 21 | Ga0070661_100004144 | 3300005344 | Bacteria | 9996 |
| 22 | Ga0070668_100098454 | 3300005347 | Bacteria | 2314 |
| 23 | Ga0070668_100104450 | 3300005347 | Bacteria | 2248 |
| 24 | Ga0070669_100037552 | 3300005353 | Bacteria | 3514 |
| 25 | Ga0070669_100182244 | 3300005353 | Bacteria | 1643 |
| 26 | Ga0070675_100008566 | 3300005354 | Bacteria | 7941 |
| 27 | Ga0070671_100191918 | 3300005355 | Bacteria | 1731 |
| 28 | Ga0070674_100000518 | 3300005356 | Bacteria | 19349 |
| 29 | Ga0070674_100003318 | 3300005356 | Bacteria | 9011 |
| 30 | Ga0070674_100058937 | 3300005356 | Bacteria | 2671 |
| 31 | Ga0070673_100064373 | 3300005364 | Bacteria | 2921 |
| 32 | Ga0070659_100033568 | 3300005366 | Bacteria | 3986 |
| 33 | Ga0070659_100227289 | 3300005366 | Bacteria | 1541 |
| 34 | Ga0070667_100007713 | 3300005367 | Bacteria | 8920 |
| 35 | Ga0070709_10013391 | 3300005434 | Bacteria | 4610 |
| 36 | Ga0070709_10027137 | 3300005434 | Bacteria | 3403 |
| 37 | Ga0070709_10039448 | 3300005434 | Bacteria | 2897 |
| 38 | Ga0070714_100007489 | 3300005435 | Bacteria | 8495 |
| 39 | Ga0070714_100022201 | 3300005435 | Bacteria | 5202 |
| 40 | Ga0070713_100001931 | 3300005436 | Bacteria | 13391 |
| 41 | Ga0070710_10000550 | 3300005437 | Bacteria | 17724 |
| 42 | Ga0070710_10011800 | 3300005437 | Bacteria | 4327 |
| 43 | Ga0070710_10012215 | 3300005437 | Bacteria | 4258 |
| 44 | Ga0070711_100073365 | 3300005439 | Bacteria | 2418 |
| 45 | Ga0070711_100239395 | 3300005439 | Bacteria | 1418 |
| 46 | Ga0070663_100015643 | 3300005455 | Bacteria | 4905 |
| 47 | Ga0070663_100028451 | 3300005455 | Bacteria | 3805 |
| 48 | Ga0070678_100003918 | 3300005456 | Bacteria | 8367 |
| 49 | Ga0070678_100141068 | 3300005456 | Bacteria | 1928 |
| 50 | Ga0070678_100162088 | 3300005456 | Bacteria | 1813 |
| 51 | Ga0070662_100352827 | 3300005457 | Bacteria | 1205 |
| 52 | Ga0070662_100437376 | 3300005457 | Bacteria | 1084 |
| 53 | Ga0068867_100004484 | 3300005459 | Bacteria | 9810 |
| 54 | Ga0070679_100037472 | 3300005530 | Bacteria | 4818 |
| 55 | Ga0070679_100134648 | 3300005530 | Bacteria | 2452 |
| 56 | Ga0070684_100002660 | 3300005535 | Bacteria | 13192 |
| 57 | Ga0070684_100037881 | 3300005535 | Bacteria | 4139 |
| 58 | Ga0070684_100185011 | 3300005535 | Bacteria | 1894 |
| 59 | Ga0068853_100130206 | 3300005539 | Bacteria | 2252 |
| 60 | Ga0070672_100000150 | 3300005543 | Bacteria | 38126 |
| 61 | Ga0070672_100026924 | 3300005543 | Bacteria | 4285 |
| 62 | Ga0070686_100163559 | 3300005544 | Bacteria | 1569 |
| 63 | Ga0070693_100053632 | 3300005547 | Bacteria | 2316 |
| 64 | Ga0070665_100028020 | 3300005548 | Bacteria | 5674 |
| 65 | Ga0070665_100095325 | 3300005548 | Bacteria | 2980 |
| 66 | Ga0068855_100215006 | 3300005563 | Bacteria | 2158 |
| 67 | Ga0070664_100020769 | 3300005564 | Bacteria | 5409 |
| 68 | Ga0068857_100063575 | 3300005577 | Bacteria | 3281 |
| 69 | Ga0068857_100175773 | 3300005577 | Bacteria | 1948 |
| 70 | Ga0068854_100001586 | 3300005578 | Bacteria | 13835 |
| 71 | Ga0068854_100033855 | 3300005578 | Bacteria | 3564 |
| 72 | Ga0068856_100002765 | 3300005614 | Bacteria | 17962 |
| 73 | Ga0068856_100288187 | 3300005614 | Bacteria | 1659 |
| 74 | Ga0068852_100004505 | 3300005616 | Bacteria | 9855 |
| 75 | Ga0068852_100012408 | 3300005616 | Bacteria | 6469 |
| 76 | Ga0068852_100015875 | 3300005616 | Bacteria | 5857 |
| 77 | Ga0068852_100343918 | 3300005616 | Bacteria | 1455 |
| 78 | Ga0068864_100125965 | 3300005618 | Bacteria | 2296 |
| 79 | Ga0068864_100280962 | 3300005618 | Bacteria | 1554 |
| 80 | Ga0068864_100517715 | 3300005618 | Bacteria | 1150 |
| 81 | Ga0068861_100007671 | 3300005719 | Bacteria | 7406 |
| 82 | Ga0068870_10064238 | 3300005840 | Bacteria | 1982 |
| 83 | Ga0068863_100019290 | 3300005841 | Bacteria | 6522 |
| 84 | Ga0068863_100354582 | 3300005841 | Bacteria | 1429 |
| 85 | Ga0068858_100006988 | 3300005842 | Bacteria | 10963 |
| 86 | Ga0068860_100064651 | 3300005843 | Bacteria | 3475 |
| 87 | Ga0068860_100090365 | 3300005843 | Bacteria | 2917 |
| 88 | Ga0068862_100080734 | 3300005844 | Bacteria | 2821 |
| 89 | Ga0081455_10004053 | 3300005937 | Bacteria | 16599 |
| 90 | Ga0081538_10050154 | 3300005981 | Bacteria | 2524 |
| 91 | Ga0081540_1007980 | 3300005983 | Bacteria | 7455 |
| 92 | Ga0081540_1019127 | 3300005983 | Bacteria | 4176 |
| 93 | Ga0081539_10000325 | 3300005985 | Bacteria | 106431 |
| 94 | Ga0070717_10009249 | 3300006028 | Bacteria | 7406 |
| 95 | Ga0070717_10010145 | 3300006028 | Bacteria | 7093 |
| 96 | Ga0070717_10044803 | 3300006028 | Bacteria | 3615 |
| 97 | Ga0075365_10011349 | 3300006038 | Bacteria | 5235 |
| 98 | Ga0075365_10068872 | 3300006038 | Bacteria | 2378 |
| 99 | Ga0075363_100003003 | 3300006048 | Bacteria | 7055 |
| 100 | Ga0075364_10019699 | 3300006051 | Bacteria | 4237 |
| 101 | Ga0075364_10041354 | 3300006051 | Bacteria | 2993 |
| 102 | Ga0075364_10125101 | 3300006051 | Bacteria | 1723 |
| 103 | Ga0070715_10000126 | 3300006163 | Bacteria | 18112 |
| 104 | Ga0070716_100005825 | 3300006173 | Bacteria | 5985 |
| 105 | Ga0070712_100012143 | 3300006175 | Bacteria | 5474 |
| 106 | Ga0075362_10055660 | 3300006177 | Bacteria | 1779 |
| 107 | Ga0075367_10043437 | 3300006178 | Bacteria | 2632 |
| 108 | Ga0075366_10089319 | 3300006195 | Bacteria | 1845 |
| 109 | Ga0075370_10165354 | 3300006353 | Bacteria | 1299 |
| 110 | Ga0068871_100019118 | 3300006358 | Bacteria | 5226 |
| 111 | Ga0068865_100097434 | 3300006881 | Bacteria | 2147 |
| 112 | Ga0099824_1006123 | 3300006942 | Bacteria | 16665 |
| 113 | Ga0099822_1000072 | 3300006943 | Bacteria | 55118 |
| 114 | Ga0105240_10003278 | 3300009093 | Bacteria | 25307 |
| 115 | Ga0105240_10017290 | 3300009093 | Bacteria | 9725 |
| 116 | Ga0105240_10058231 | 3300009093 | Bacteria | 4824 |
| 117 | Ga0105240_10593043 | 3300009093 | Bacteria | 1221 |
| 118 | Ga0105245_10015073 | 3300009098 | Bacteria | 6735 |
| 119 | Ga0105245_10047099 | 3300009098 | Bacteria | 3854 |
| 120 | Ga0105245_10082016 | 3300009098 | Bacteria | 2949 |
| 121 | Ga0105247_10087830 | 3300009101 | Bacteria | 1969 |
| 122 | Ga0105243_10096912 | 3300009148 | Bacteria | 2441 |
| 123 | Ga0105241_10016146 | 3300009174 | Bacteria | 5473 |
| 124 | Ga0105241_10383282 | 3300009174 | Bacteria | 1229 |
| 125 | Ga0105248_10025180 | 3300009177 | Bacteria | 6614 |
| 126 | Ga0105248_10397254 | 3300009177 | Bacteria | 1552 |
| 127 | Ga0105237_10001694 | 3300009545 | Bacteria | 28555 |
| 128 | Ga0105237_10004554 | 3300009545 | Bacteria | 16018 |
| 129 | Ga0105237_10053262 | 3300009545 | Bacteria | 4059 |
| 130 | Ga0105237_10206221 | 3300009545 | Bacteria | 1966 |
| 131 | Ga0105237_10399960 | 3300009545 | Bacteria | 1378 |
| 132 | Ga0105238_10004287 | 3300009551 | Bacteria | 14157 |
| 133 | Ga0105238_10004463 | 3300009551 | Bacteria | 13870 |
| 134 | Ga0105238_10028572 | 3300009551 | Bacteria | 5682 |
| 135 | Ga0105238_10104419 | 3300009551 | Bacteria | 2814 |
| 136 | Ga0105238_10314419 | 3300009551 | Bacteria | 1551 |
| 137 | Ga0105249_10001498 | 3300009553 | Bacteria | 20478 |
| 138 | Ga0099796_10083171 | 3300010159 | Bacteria | 1177 |
| 139 | Ga0105239_10011538 | 3300010375 | Bacteria | 9855 |
| 140 | Ga0105239_10065020 | 3300010375 | Bacteria | 4005 |
| 141 | Ga0105239_10199765 | 3300010375 | Bacteria | 2240 |
| 142 | Ga0105239_10361602 | 3300010375 | Bacteria | 1639 |
| 143 | Ga0157373_10078674 | 3300013100 | Bacteria | 2325 |
| 144 | Ga0157370_10153088 | 3300013104 | Bacteria | 2145 |
| 145 | Ga0157369_10214476 | 3300013105 | Bacteria | 2017 |
| 146 | Ga0157374_10082425 | 3300013296 | Bacteria | 3054 |
| 147 | Ga0157374_10097214 | 3300013296 | Bacteria | 2817 |
| 148 | Ga0157378_10310267 | 3300013297 | Bacteria | 1530 |
| 149 | Ga0163162_10020520 | 3300013306 | Bacteria | 6492 |
| 150 | Ga0163162_10384563 | 3300013306 | Bacteria | 1537 |
| 151 | Ga0157372_10109670 | 3300013307 | Bacteria | 3161 |
| 152 | Ga0157375_10020672 | 3300013308 | Bacteria | 6019 |
| 153 | Ga0157375_10269324 | 3300013308 | Bacteria | 1865 |
| 154 | Ga0157375_10570368 | 3300013308 | Bacteria | 1292 |
| 155 | Ga0163163_10126799 | 3300014325 | Bacteria | 2590 |
| 156 | Ga0157380_10001208 | 3300014326 | Bacteria | 16721 |
| 157 | Ga0157380_10204433 | 3300014326 | Bacteria | 1755 |
| 158 | Ga0157377_10039056 | 3300014745 | Bacteria | 2624 |
| 159 | Ga0157379_10009787 | 3300014968 | Bacteria | 8353 |
| 160 | Ga0157379_10013513 | 3300014968 | Bacteria | 7154 |
| 161 | Ga0157379_10036695 | 3300014968 | Bacteria | 4370 |
| 162 | Ga0157379_10197101 | 3300014968 | Bacteria | 1820 |
| 163 | Ga0157379_10528526 | 3300014968 | Bacteria | 1096 |
| 164 | Ga0157376_10079936 | 3300014969 | Bacteria | 2804 |
| 165 | Ga0163161_10017129 | 3300017792 | Bacteria | 5069 |
| 166 | Ga0213873_10002543 | 3300021358 | Bacteria | 3171 |
| 167 | Ga0213876_10006112 | 3300021384 | Bacteria | 6578 |
| 168 | Ga0213876_10067134 | 3300021384 | Bacteria | 1894 |
| 169 | Ga0209148_1000347 | 3300025254 | Bacteria | 60370 |
| 170 | Ga0209233_1003464 | 3300025261 | Bacteria | 5557 |
| 171 | Ga0209233_1005147 | 3300025261 | Bacteria | 4371 |
| 172 | Ga0209455_1002483 | 3300025272 | Bacteria | 7091 |
| 173 | Ga0209758_1003203 | 3300025297 | Bacteria | 15275 |
| 174 | Ga0209256_1014792 | 3300025299 | Bacteria | 2776 |
| 175 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 176 | Ga0207656_10023712 | 3300025321 | Bacteria | 2474 |
| 177 | Ga0207656_10155796 | 3300025321 | Bacteria | 1084 |
| 178 | Ga0207682_10000759 | 3300025893 | Bacteria | 14883 |
| 179 | Ga0207692_10008557 | 3300025898 | Bacteria | 4240 |
| 180 | Ga0207692_10014334 | 3300025898 | Bacteria | 3461 |
| 181 | Ga0207692_10021439 | 3300025898 | Bacteria | 2956 |
| 182 | Ga0207710_10062762 | 3300025900 | Bacteria | 1689 |
| 183 | Ga0207688_10044077 | 3300025901 | Bacteria | 2486 |
| 184 | Ga0207688_10064671 | 3300025901 | Bacteria | 2066 |
| 185 | Ga0207647_10119596 | 3300025904 | Bacteria | 1553 |
| 186 | Ga0207685_10108092 | 3300025905 | Bacteria | 1201 |
| 187 | Ga0207699_10014226 | 3300025906 | Bacteria | 4095 |
| 188 | Ga0207699_10049577 | 3300025906 | Bacteria | 2472 |
| 189 | Ga0207645_10023994 | 3300025907 | Bacteria | 3959 |
| 190 | Ga0207645_10044376 | 3300025907 | Bacteria | 2845 |
| 191 | Ga0207643_10067337 | 3300025908 | Bacteria | 2055 |
| 192 | Ga0207643_10207298 | 3300025908 | Bacteria | 1195 |
| 193 | Ga0207705_10052653 | 3300025909 | Bacteria | 2931 |
| 194 | Ga0207705_10072358 | 3300025909 | Bacteria | 2500 |
| 195 | Ga0207705_10092128 | 3300025909 | Bacteria | 2220 |
| 196 | Ga0207654_10045215 | 3300025911 | Bacteria | 2505 |
| 197 | Ga0207654_10049589 | 3300025911 | Bacteria | 2409 |
| 198 | Ga0207654_10099332 | 3300025911 | Bacteria | 1790 |
| 199 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 200 | Ga0207695_10008824 | 3300025913 | Bacteria | 12554 |
| 201 | Ga0207695_10124795 | 3300025913 | Bacteria | 2538 |
| 202 | Ga0207695_10322858 | 3300025913 | Bacteria | 1433 |
| 203 | Ga0207671_10007506 | 3300025914 | Bacteria | 9457 |
| 204 | Ga0207671_10010103 | 3300025914 | Bacteria | 7824 |
| 205 | Ga0207671_10066695 | 3300025914 | Bacteria | 2679 |
| 206 | Ga0207671_10154511 | 3300025914 | Bacteria | 1774 |
| 207 | Ga0207693_10000683 | 3300025915 | Bacteria | 30507 |
| 208 | Ga0207663_10001947 | 3300025916 | Bacteria | 9768 |
| 209 | Ga0207663_10042784 | 3300025916 | Bacteria | 2770 |
| 210 | Ga0207663_10045486 | 3300025916 | Bacteria | 2700 |
| 211 | Ga0207660_10101298 | 3300025917 | Bacteria | 2151 |
| 212 | Ga0207662_10066120 | 3300025918 | Bacteria | 2178 |
| 213 | Ga0207657_10004384 | 3300025919 | Bacteria | 14939 |
| 214 | Ga0207657_10026159 | 3300025919 | Bacteria | 5368 |
| 215 | Ga0207657_10030571 | 3300025919 | Bacteria | 4887 |
| 216 | Ga0207657_10141002 | 3300025919 | Bacteria | 1969 |
| 217 | Ga0207649_10113007 | 3300025920 | Bacteria | 1818 |
| 218 | Ga0207652_10068746 | 3300025921 | Bacteria | 3074 |
| 219 | Ga0207681_10006914 | 3300025923 | Bacteria | 6960 |
| 220 | Ga0207681_10010182 | 3300025923 | Bacteria | 5757 |
| 221 | Ga0207694_10012939 | 3300025924 | Bacteria | 6285 |
| 222 | Ga0207694_10014250 | 3300025924 | Bacteria | 5996 |
| 223 | Ga0207694_10024599 | 3300025924 | Bacteria | 4574 |
| 224 | Ga0207694_10143346 | 3300025924 | Bacteria | 1922 |
| 225 | Ga0207650_10002442 | 3300025925 | Bacteria | 12942 |
| 226 | Ga0207650_10165995 | 3300025925 | Bacteria | 1752 |
| 227 | Ga0207659_10000135 | 3300025926 | Bacteria | 43365 |
| 228 | Ga0207659_10012550 | 3300025926 | Bacteria | 5395 |
| 229 | Ga0207687_10192296 | 3300025927 | Bacteria | 1589 |
| 230 | Ga0207664_10291567 | 3300025929 | Bacteria | 1434 |
| 231 | Ga0207644_10020254 | 3300025931 | Bacteria | 4521 |
| 232 | Ga0207644_10454550 | 3300025931 | Bacteria | 1052 |
| 233 | Ga0207690_10054941 | 3300025932 | Bacteria | 2680 |
| 234 | Ga0207706_10002883 | 3300025933 | Bacteria | 16654 |
| 235 | Ga0207706_10110757 | 3300025933 | Bacteria | 2415 |
| 236 | Ga0207706_10116533 | 3300025933 | Bacteria | 2349 |
| 237 | Ga0207706_10472640 | 3300025933 | Bacteria | 1083 |
| 238 | Ga0207669_10012119 | 3300025937 | Bacteria | 4227 |
| 239 | Ga0207704_10031670 | 3300025938 | Bacteria | 2982 |
| 240 | Ga0207704_10066234 | 3300025938 | Bacteria | 2266 |
| 241 | Ga0207665_10000339 | 3300025939 | Bacteria | 32422 |
| 242 | Ga0207691_10002113 | 3300025940 | Bacteria | 19425 |
| 243 | Ga0207691_10025132 | 3300025940 | Bacteria | 5595 |
| 244 | Ga0207691_10364215 | 3300025940 | Bacteria | 1236 |
| 245 | Ga0207711_10032396 | 3300025941 | Bacteria | 4419 |
| 246 | Ga0207661_10036834 | 3300025944 | Bacteria | 3821 |
| 247 | Ga0207661_10088109 | 3300025944 | Bacteria | 2579 |
| 248 | Ga0207661_10190172 | 3300025944 | Bacteria | 1799 |
| 249 | Ga0207679_10003707 | 3300025945 | Bacteria | 9470 |
| 250 | Ga0207667_10215284 | 3300025949 | Bacteria | 1969 |
| 251 | Ga0207651_10000647 | 3300025960 | Bacteria | 14772 |
| 252 | Ga0207712_10017129 | 3300025961 | Bacteria | 4701 |
| 253 | Ga0207658_10014926 | 3300025986 | Bacteria | 5324 |
| 254 | Ga0207658_10058472 | 3300025986 | Bacteria | 2869 |
| 255 | Ga0207677_10005607 | 3300026023 | Bacteria | 6819 |
| 256 | Ga0207703_10005700 | 3300026035 | Bacteria | 9988 |
| 257 | Ga0207703_10151611 | 3300026035 | Bacteria | 2022 |
| 258 | Ga0207639_10406187 | 3300026041 | Bacteria | 1228 |
| 259 | Ga0207678_10016124 | 3300026067 | Bacteria | 6562 |
| 260 | Ga0207678_10040249 | 3300026067 | Bacteria | 4055 |
| 261 | Ga0207678_10086017 | 3300026067 | Bacteria | 2687 |
| 262 | Ga0207708_10087740 | 3300026075 | Bacteria | 2396 |
| 263 | Ga0207702_10200973 | 3300026078 | Bacteria | 1847 |
| 264 | Ga0207702_10497536 | 3300026078 | Bacteria | 1188 |
| 265 | Ga0207648_10002879 | 3300026089 | Bacteria | 18217 |
| 266 | Ga0207648_10036193 | 3300026089 | Bacteria | 4348 |
| 267 | Ga0207648_10489998 | 3300026089 | Bacteria | 1124 |
| 268 | Ga0207676_10040495 | 3300026095 | Bacteria | 3571 |
| 269 | Ga0207676_10155254 | 3300026095 | Bacteria | 1976 |
| 270 | Ga0207676_10158341 | 3300026095 | Bacteria | 1959 |
| 271 | Ga0207674_10078524 | 3300026116 | Bacteria | 3306 |
| 272 | Ga0207674_10139575 | 3300026116 | Bacteria | 2384 |
| 273 | Ga0207674_10303432 | 3300026116 | Bacteria | 1546 |
| 274 | Ga0207698_10004390 | 3300026142 | Bacteria | 8592 |
| 275 | Ga0207698_10059392 | 3300026142 | Bacteria | 2969 |
| 276 | Ga0207698_10305421 | 3300026142 | Bacteria | 1483 |
| 277 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 278 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 279 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 280 | Ga0209489_102213 | 3300027361 | Bacteria | 39761 |
| 281 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 282 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 283 | Ga0268266_10060289 | 3300028379 | Bacteria | 3271 |
| 284 | Ga0268264_10337985 | 3300028381 | Bacteria | 1429 |
| 285 | Ga0268264_10342113 | 3300028381 | Bacteria | 1421 |
| 286 | Ga0307511_10114407 | 3300030521 | Bacteria | 1700 |
| 287 | Ga0265339_10053306 | 3300031249 | Bacteria | 2200 |
| 288 | Ga0307508_10000015 | 3300031616 | Bacteria | 210182 |
| 289 | Ga0265342_10007168 | 3300031712 | Bacteria | 8206 |
| 290 | Ga0307410_10005624 | 3300031852 | Bacteria | 6661 |
| 291 | Ga0307410_10210576 | 3300031852 | Bacteria | 1489 |
| 292 | Ga0307406_10003804 | 3300031901 | Bacteria | 8218 |
| 293 | Ga0307407_10031383 | 3300031903 | Bacteria | 2877 |
| 294 | Ga0307412_10435276 | 3300031911 | Bacteria | 1076 |
| 295 | Ga0307416_100002779 | 3300032002 | Bacteria | 10165 |
| 296 | Ga0307416_100003421 | 3300032002 | Bacteria | 9318 |
| 297 | Ga0307411_10039581 | 3300032005 | Bacteria | 2983 |
| 298 | Ga0307415_100104199 | 3300032126 | Bacteria | 2089 |
| 299 | Ga0307507_10006824 | 3300033179 | Bacteria | 17074 |
| 300 | Ga0307510_10037374 | 3300033180 | Bacteria | 5387 |
| 301 | Ga0307510_10055134 | 3300033180 | Bacteria | 4154 |
| 302 | Ga0307510_10096620 | 3300033180 | Bacteria | 2769 |
| 303 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 304 | Ga0316215_1002146 | 3300033544 | Bacteria | 1864 |
| 305 | Ga0373945_0107247 | 3300035116 | Bacteria | 1099 |
| 306 | Ga0373953_0035797 | 3300035117 | Bacteria | 1952 |
| 307 | Ga0373957_0013071 | 3300035120 | Bacteria | 2809 |
| 308 | Ga0373957_0077728 | 3300035120 | Bacteria | 1306 |
| 309 | Ga0373955_0072253 | 3300035172 | Bacteria | 1932 |
| 310 | Ga0373962_0008156 | 3300035242 | Bacteria | 2573 |
| 311 | Ga0316574_0000847 | 3300035398 | Bacteria | 13411 |
| 312 | Ga0373924_0033008 | 3300035410 | Bacteria | 2087 |
| 313 | Ga0373931_0011120 | 3300035691 | Bacteria | 4340 |
| 314 | Ga0373931_0132514 | 3300035691 | Bacteria | 1436 |
| 315 | Ga0373935_0055887 | 3300035692 | Bacteria | 2515 |
| 316 | Ga0373927_0027113 | 3300035695 | Bacteria | 3743 |
| 317 | Ga0373927_0044698 | 3300035695 | Bacteria | 2865 |
| 318 | Ga0373947_0007716 | 3300035725 | Bacteria | 6220 |
| 319 | Ga0373937_0100979 | 3300036401 | Bacteria | 2677 |
| 320 | Ga0373925_0022318 | 3300037068 | Bacteria | 4617 |
| 321 | Ga0373925_0072696 | 3300037068 | Bacteria | 2602 |
| 322 | Ga0395900_0201794 | 3300037418 | Bacteria | 2012 |
| 323 | Ga0395898_0105086 | 3300037466 | Bacteria | 2708 |
| 324 | Ga0436364_1074833 | 3300037853 | Bacteria | 5387 |
| 325 | Ga0395901_0410324 | 3300038443 | Bacteria | 1391 |
| 326 | Ga0237816_02524 | 3300039145 | Bacteria | 1394 |
| 327 | Ga0436365_0496646 | 3300039437 | Bacteria | 6540 |
| 328 | Ga0436365_1276870 | 3300039437 | Bacteria | 8067 |
| 329 | Ga0436363_1359162 | 3300039450 | Bacteria | 2778 |
| 330 | Ga0436362_0966777 | 3300039453 | Bacteria | 3926 |
| 331 | Ga0466969_0042525 | 3300044656 | Bacteria | 2268 |
| 332 | Ga0466972_0000134 | 3300044658 | Bacteria | 61802 |
| 333 | Ga0466965_0032173 | 3300044683 | Bacteria | 2562 |
| 334 | Ga0466966_0061017 | 3300044684 | Bacteria | 2379 |
| 335 | Ga0466963_0179628 | 3300044694 | Bacteria | 1477 |
| 336 | Ga0466957_0059293 | 3300044842 | Bacteria | 2346 |
| 337 | Ga0466960_0037434 | 3300044901 | Bacteria | 2276 |
| 338 | Ga0466959_0033350 | 3300045049 | Bacteria | 3808 |
| 339 | Ga0466967_0184717 | 3300045976 | Bacteria | 1968 |
| 340 | Ga0466967_0377309 | 3300045976 | Bacteria | 1376 |
| 341 | Ga0495592_0024435 | 3300046454 | Bacteria | 4594 |
| 342 | Ga0495592_0190651 | 3300046454 | Bacteria | 1390 |
| 343 | Ga0495603_0025442 | 3300046455 | Bacteria | 3580 |
| 344 | Ga0495603_0028282 | 3300046455 | Bacteria | 3381 |
| 345 | Ga0495629_0007286 | 3300046459 | Bacteria | 8148 |
| 346 | Ga0495638_0047278 | 3300046460 | Bacteria | 2698 |
| 347 | Ga0495651_0004240 | 3300046462 | Bacteria | 10992 |
| 348 | Ga0495651_0098201 | 3300046462 | Bacteria | 2186 |
| 349 | Ga0495651_0100648 | 3300046462 | Bacteria | 2152 |
| 350 | Ga0495653_0064213 | 3300046463 | Bacteria | 2767 |
| 351 | Ga0495664_0015208 | 3300046477 | Bacteria | 4372 |
| 352 | Ga0495664_0055337 | 3300046477 | Bacteria | 2361 |
| 353 | Ga0495608_0030206 | 3300046511 | Bacteria | 3671 |
| 354 | Ga0495618_0057476 | 3300046514 | Bacteria | 2463 |
| 355 | Ga0495618_0096450 | 3300046514 | Bacteria | 1891 |
| 356 | Ga0495628_0055591 | 3300046516 | Bacteria | 3117 |
| 357 | Ga0495628_0235997 | 3300046516 | Bacteria | 1369 |
| 358 | Ga0495630_0052973 | 3300046517 | Bacteria | 3038 |
| 359 | Ga0495643_0008377 | 3300046522 | Bacteria | 6554 |
| 360 | Ga0495644_0063291 | 3300046523 | Bacteria | 1390 |
| 361 | Ga0495648_0004316 | 3300046524 | Bacteria | 12181 |
| 362 | Ga0495648_0075860 | 3300046524 | Bacteria | 1932 |
| 363 | Ga0495652_0000938 | 3300046529 | Bacteria | 33434 |
| 364 | Ga0495652_0025055 | 3300046529 | Bacteria | 5279 |
| 365 | Ga0495640_0007993 | 3300046533 | Bacteria | 8313 |
| 366 | Ga0495640_0036648 | 3300046533 | Bacteria | 3464 |
| 367 | Ga0495640_0135972 | 3300046533 | Bacteria | 1587 |
| 368 | Ga0495587_0051821 | 3300046536 | Bacteria | 2424 |
| 369 | Ga0495645_0041434 | 3300046543 | Bacteria | 3358 |
| 370 | Ga0495645_0052596 | 3300046543 | Bacteria | 2962 |
| 371 | Ga0495645_0156327 | 3300046543 | Bacteria | 1579 |
| 372 | Ga0495622_0051205 | 3300046557 | Bacteria | 1915 |
| 373 | Ga0495622_0127491 | 3300046557 | Bacteria | 1160 |
| 374 | Ga0495667_0031082 | 3300046559 | Bacteria | 3585 |
| 375 | Ga0495667_0031460 | 3300046559 | Bacteria | 3562 |
| 376 | Ga0495634_0080979 | 3300046642 | Bacteria | 2124 |
| 377 | Ga0495635_0005160 | 3300046663 | Bacteria | 9092 |
| 378 | Ga0495635_0111434 | 3300046663 | Bacteria | 1869 |
| 379 | Ga0495657_0008941 | 3300046675 | Bacteria | 7622 |
| 380 | Ga0495657_0018176 | 3300046675 | Bacteria | 5093 |
| 381 | Ga0495599_0047674 | 3300046678 | Bacteria | 2685 |
| 382 | Ga0495599_0171615 | 3300046678 | Bacteria | 1338 |
| 383 | Ga0495646_0053536 | 3300046680 | Bacteria | 2433 |
| 384 | Ga0495646_0065458 | 3300046680 | Bacteria | 2152 |
| 385 | Ga0495658_0031727 | 3300046683 | Bacteria | 2879 |
| 386 | Ga0495613_0218574 | 3300046689 | Bacteria | 1338 |
| 387 | Ga0495624_0017354 | 3300046690 | Bacteria | 4834 |
| 388 | Ga0495649_0105856 | 3300046694 | Bacteria | 1493 |
| 389 | Ga0495600_0050226 | 3300046809 | Bacteria | 2721 |
| 390 | Ga0495600_0061677 | 3300046809 | Bacteria | 2449 |
| 391 | Ga0495600_0256848 | 3300046809 | Bacteria | 1110 |
| 392 | Ga0495581_0136633 | 3300047315 | Bacteria | 1429 |
| 393 | Ga0495604_0003325 | 3300047317 | Bacteria | 12811 |
| 394 | Ga0495604_0033572 | 3300047317 | Bacteria | 4061 |
| 395 | Ga0495674_0036465 | 3300047319 | Bacteria | 4425 |
| 396 | Ga0495674_0079109 | 3300047319 | Bacteria | 2824 |
| 397 | Ga0495674_0422590 | 3300047319 | Bacteria | 1074 |
| 398 | Ga0495672_0174664 | 3300047320 | Bacteria | 1092 |
| 399 | Ga0495680_0007102 | 3300047322 | Bacteria | 10313 |
| 400 | Ga0495675_0011426 | 3300047444 | Bacteria | 5574 |
| 401 | Ga0495684_0024756 | 3300047471 | Bacteria | 4616 |
| 402 | Ga0495684_0052157 | 3300047471 | Bacteria | 3121 |
| 403 | Ga0495686_0041367 | 3300047472 | Bacteria | 2935 |
| 404 | Ga0495602_0016046 | 3300048088 | Bacteria | 7539 |
| 405 | Ga0495602_0053918 | 3300048088 | Bacteria | 3556 |
| 406 | Ga0495614_0007563 | 3300048089 | Bacteria | 4835 |
| 407 | Ga0496100_0028657 | 3300048903 | Bacteria | 3436 |
| 408 | Ga0496100_0128972 | 3300048903 | Bacteria | 1779 |
| 409 | Ga0496101_0004214 | 3300048904 | Bacteria | 9009 |
| 410 | Ga0496101_0058748 | 3300048904 | Bacteria | 2786 |
| 411 | Ga0496101_0061665 | 3300048904 | Bacteria | 2724 |
| 412 | Ga0496102_0006143 | 3300048905 | Bacteria | 10237 |
| 413 | Ga0496102_0072396 | 3300048905 | Bacteria | 3167 |
| 414 | Ga0496102_0097001 | 3300048905 | Bacteria | 2734 |
| 415 | Ga0496102_0119146 | 3300048905 | Bacteria | 2464 |
| 416 | Ga0496102_0132063 | 3300048905 | Bacteria | 2338 |
| 417 | Ga0496103_0062146 | 3300048906 | Bacteria | 2324 |
| 418 | Ga0496104_0018203 | 3300048907 | Bacteria | 6407 |
| 419 | Ga0496104_0428269 | 3300048907 | Bacteria | 1235 |
| 420 | Ga0496105_0005595 | 3300048908 | Bacteria | 9552 |
| 421 | Ga0496105_0092877 | 3300048908 | Bacteria | 2491 |
| 422 | Ga0496105_0213215 | 3300048908 | Bacteria | 1573 |
| 423 | Ga0496106_0048620 | 3300048909 | Bacteria | 3194 |
| 424 | Ga0496106_0050208 | 3300048909 | Bacteria | 3144 |
| 425 | Ga0496106_0057918 | 3300048909 | Bacteria | 2931 |
| 426 | Ga0496107_0002113 | 3300048910 | Bacteria | 12728 |
| 427 | Ga0496107_0007328 | 3300048910 | Bacteria | 7605 |
| 428 | Ga0496107_0046023 | 3300048910 | Bacteria | 3140 |
| 429 | Ga0496107_0109796 | 3300048910 | Bacteria | 2026 |
| 430 | Ga0496108_0071294 | 3300048911 | Bacteria | 2931 |
| 431 | Ga0496108_0348436 | 3300048911 | Bacteria | 1292 |
| 432 | Ga0496108_0447246 | 3300048911 | Bacteria | 1129 |
| 433 | Ga0496109_0063257 | 3300048912 | Bacteria | 3384 |
| 434 | Ga0496109_0438307 | 3300048912 | Bacteria | 1234 |
| 435 | Ga0496110_0205416 | 3300048913 | Bacteria | 1790 |
| 436 | Ga0496111_0033737 | 3300048914 | Bacteria | 3652 |
| 437 | Ga0496112_0000044 | 3300048915 | Bacteria | 86865 |
| 438 | Ga0496112_0015095 | 3300048915 | Bacteria | 7195 |
| 439 | Ga0496112_0018080 | 3300048915 | Bacteria | 6633 |
| 440 | Ga0496112_0139350 | 3300048915 | Bacteria | 2395 |
| 441 | Ga0496113_0051531 | 3300048916 | Bacteria | 3072 |
| 442 | Ga0496114_0072007 | 3300048917 | Bacteria | 2906 |
| 443 | Ga0496114_0075757 | 3300048917 | Bacteria | 2834 |
| 444 | Ga0496114_0156020 | 3300048917 | Bacteria | 1982 |
| 445 | Ga0496114_0320533 | 3300048917 | Bacteria | 1369 |
| 446 | Ga0496115_0004269 | 3300048918 | Bacteria | 10342 |
| 447 | Ga0496115_0067760 | 3300048918 | Bacteria | 2888 |
| 448 | Ga0496115_0175726 | 3300048918 | Bacteria | 1771 |
| 449 | Ga0496115_0255204 | 3300048918 | Bacteria | 1443 |
| 450 | Ga0496115_0321083 | 3300048918 | Bacteria | 1266 |
| 451 | Ga0496117_0067801 | 3300048920 | Bacteria | 2412 |
| 452 | Ga0496117_0118927 | 3300048920 | Bacteria | 1628 |
| 453 | Ga0496118_0003016 | 3300048921 | Bacteria | 21744 |
| 454 | Ga0496118_0119224 | 3300048921 | Bacteria | 1726 |
| 455 | Ga0496118_0188289 | 3300048921 | Bacteria | 1237 |
| 456 | Ga0496120_0010703 | 3300048923 | Bacteria | 6367 |
| 457 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 458 | Ga0496121_0011806 | 3300048924 | Bacteria | 9625 |
| 459 | Ga0496121_0071824 | 3300048924 | Bacteria | 2782 |
| 460 | Ga0496122_0071759 | 3300048925 | Bacteria | 2466 |
| 461 | Ga0496124_0006721 | 3300048927 | Bacteria | 12444 |
| 462 | Ga0496125_0000712 | 3300048928 | Bacteria | 54983 |
| 463 | Ga0496125_0104374 | 3300048928 | Bacteria | 2076 |
| 464 | Ga0496126_0032037 | 3300048929 | Bacteria | 4958 |
| 465 | Ga0496126_0049685 | 3300048929 | Bacteria | 3827 |
| 466 | Ga0496126_0053820 | 3300048929 | Bacteria | 3649 |
| 467 | Ga0496126_0070101 | 3300048929 | Bacteria | 3124 |
| 468 | Ga0496126_0208115 | 3300048929 | Bacteria | 1648 |
| 469 | Ga0496126_0232309 | 3300048929 | Bacteria | 1545 |
| 470 | Ga0496126_0369665 | 3300048929 | Bacteria | 1169 |
| 471 | Ga0495682_0078011 | 3300049460 | Bacteria | 1191 |
| 472 | Ga0501031_0000652 | 3300049568 | Bacteria | 20544 |
| 473 | Ga0501032_0002299 | 3300049569 | Bacteria | 14998 |
| 474 | Ga0501032_0036945 | 3300049569 | Bacteria | 3333 |
| 475 | Ga0501033_0000091 | 3300049570 | Bacteria | 85666 |
| 476 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 477 | Ga0501034_0636407 | 3300049571 | Bacteria | 969 |
| 478 | Ga0501036_0000052 | 3300049572 | Bacteria | 74795 |
| 479 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 480 | Ga0501038_0002924 | 3300049574 | Bacteria | 15925 |
| 481 | Ga0501038_0211707 | 3300049574 | Bacteria | 1550 |
| 482 | Ga0501039_0000719 | 3300049575 | Bacteria | 23853 |
| 483 | Ga0501043_0000928 | 3300049579 | Bacteria | 25941 |
| 484 | Ga0501046_0000231 | 3300049580 | Bacteria | 57655 |
| 485 | Ga0501046_0075551 | 3300049580 | Bacteria | 2612 |
| 486 | Ga0501047_0000457 | 3300049581 | Bacteria | 45136 |
| 487 | Ga0501047_0024108 | 3300049581 | Bacteria | 5844 |
| 488 | Ga0501048_0000218 | 3300049582 | Bacteria | 37734 |
| 489 | Ga0501067_0003111 | 3300049583 | Bacteria | 9160 |
| 490 | Ga0501067_0021251 | 3300049583 | Bacteria | 3591 |
| 491 | Ga0501068_0001352 | 3300049584 | Bacteria | 12996 |
| 492 | Ga0501070_0002829 | 3300049586 | Bacteria | 15142 |
| 493 | Ga0501071_0026801 | 3300049587 | Bacteria | 4049 |
| 494 | Ga0501072_0004469 | 3300049588 | Bacteria | 10621 |
| 495 | Ga0501073_0000877 | 3300049589 | Bacteria | 21517 |
| 496 | Ga0501074_0000273 | 3300049590 | Bacteria | 29590 |
| 497 | Ga0501079_0011695 | 3300049741 | Bacteria | 6704 |
| 498 | Ga0501080_0000124 | 3300049742 | Bacteria | 54519 |
| 499 | Ga0501083_0000785 | 3300049744 | Bacteria | 20828 |
| 500 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 501 | Ga0501035_0135984 | 3300049822 | Bacteria | 2140 |
| 502 | Ga0501044_0000217 | 3300049823 | Bacteria | 73242 |
| 503 | Ga0501044_0100080 | 3300049823 | Bacteria | 2917 |
| 504 | Ga0501045_0010874 | 3300049824 | Bacteria | 6378 |
| 505 | nmdc:mga00v17_143506_c1 | 3300050491 | Bacteria | 1532 |
| 506 | nmdc:mga0yw44_198777_c1 | 3300050492 | Bacteria | 1324 |
| 507 | nmdc:mga0yw44_35390_c1 | 3300050492 | Bacteria | 2934 |
| 508 | nmdc:mga0k408_45179_c1 | 3300050493 | Bacteria | 2541 |
| 509 | nmdc:mga07m45_51757_c1 | 3300050496 | Bacteria | 2317 |
| 510 | nmdc:mga0sz30_48771_c1 | 3300050516 | Bacteria | 1793 |
| 511 | Ga0495601_0199096 | 3300053077 | Bacteria | 1309 |
| 512 | Ga0500635_0017688 | 3300053080 | Bacteria | 2140 |
| 513 | Ga0500635_0020322 | 3300053080 | Bacteria | 2033 |
| 514 | Ga0495595_0151629 | 3300053084 | Bacteria | 1141 |
| 515 | Ga0495619_0019088 | 3300053085 | Bacteria | 4356 |
| 516 | Ga0495619_0181079 | 3300053085 | Bacteria | 1458 |
| 517 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 518 | Ga0500644_0003960 | 3300053088 | Bacteria | 3686 |
| 519 | Ga0500566_0000608 | 3300053094 | Bacteria | 20128 |
| 520 | Ga0500566_0032348 | 3300053094 | Bacteria | 3050 |
| 521 | Ga0500566_0043837 | 3300053094 | Bacteria | 2577 |
| 522 | Ga0500650_0055084 | 3300053098 | Bacteria | 1852 |
| 523 | Ga0500554_000716 | 3300053102 | Bacteria | 6725 |
| 524 | Ga0500555_009231 | 3300053103 | Bacteria | 2820 |
| 525 | Ga0500556_0004962 | 3300053104 | Bacteria | 3765 |
| 526 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 527 | Ga0500569_014459 | 3300053109 | Bacteria | 1954 |
| 528 | Ga0500595_000200 | 3300053119 | Bacteria | 40977 |
| 529 | Ga0500595_009172 | 3300053119 | Bacteria | 4005 |
| 530 | Ga0500642_0000051 | 3300053130 | Bacteria | 77123 |
| 531 | Ga0500642_0011959 | 3300053130 | Bacteria | 3128 |
| 532 | Ga0500568_0010968 | 3300053139 | Bacteria | 4224 |
| 533 | Ga0500568_0017137 | 3300053139 | Bacteria | 3204 |
| 534 | Ga0500577_0033509 | 3300053142 | Bacteria | 1816 |
| 535 | Ga0500589_035950 | 3300053147 | Bacteria | 2313 |
| 536 | Ga0500603_000240 | 3300053150 | Bacteria | 14346 |
| 537 | Ga0500603_067225 | 3300053150 | Bacteria | 1014 |
| 538 | Ga0500604_0023161 | 3300053151 | Bacteria | 1770 |
| 539 | Ga0500622_0008815 | 3300053156 | Bacteria | 5614 |
| 540 | Ga0500638_000785 | 3300053162 | Bacteria | 8718 |
| 541 | Ga0500636_0000166 | 3300053177 | Bacteria | 34574 |
| 542 | Ga0500637_0000144 | 3300053178 | Bacteria | 26094 |
| 543 | Ga0500576_028192 | 3300053725 | Bacteria | 2559 |
| 544 | Ga0500625_003024 | 3300053729 | Bacteria | 6512 |
| 545 | Ga0500609_002156 | 3300053731 | Bacteria | 2819 |
| 546 | Ga0500552_000771 | 3300053733 | Bacteria | 2987 |
| 547 | Ga0500596_001440 | 3300053735 | Bacteria | 4811 |
| 548 | Ga0500599_000151 | 3300053736 | Bacteria | 6301 |
| 549 | Ga0501084_0000683 | 3300054114 | Bacteria | 25896 |
| 550 | Ga0501082_0007986 | 3300060353 | Bacteria | 9137 |
| 551 | Ga0466962_0045345 | 3300061719 | Bacteria | 2102 |
| 552 | Ga0466962_0065872 | 3300061719 | Bacteria | 1730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10314419 | Ga0105238_103144192 | 247 |
| 2 | 3300010375 | Ga0105239_10199765 | Ga0105239_101997653 | 265 |
| 3 | 3300025933 | Ga0207706_10116533 | Ga0207706_101165332 | 265 |
| 4 | 3300025908 | Ga0207643_10207298 | Ga0207643_102072982 | 266 |
| 5 | 3300047315 | Ga0495581_0136633 | Ga0495581_0136633_269_1150 | 271 |
| 6 | 3300035116 | Ga0373945_0107247 | Ga0373945_0107247_108_998 | 278 |
| 7 | iso_pu_bacteria | 8016539877 | 8016547006 | 278 |
| 8 | 3300003354 | JGI25160J50197_1002236 | JGI25160J50197_10022364 | 281 |
| 9 | 3300004625 | Ga0055543_1003779 | Ga0055543_10037794 | 281 |
| 10 | 3300005262 | Ga0065165_1001214 | Ga0065165_10012145 | 281 |
| 11 | 3300005327 | Ga0070658_10029138 | Ga0070658_100291383 | 281 |
| 12 | 3300005339 | Ga0070660_100085153 | Ga0070660_1000851533 | 281 |
| 13 | 3300005347 | Ga0070668_100104450 | Ga0070668_1001044503 | 281 |
| 14 | 3300005455 | Ga0070663_100028451 | Ga0070663_1000284514 | 281 |
| 15 | 3300005844 | Ga0068862_100080734 | Ga0068862_1000807342 | 281 |
| 16 | 3300005983 | Ga0081540_1007980 | Ga0081540_10079803 | 281 |
| 17 | 3300006038 | Ga0075365_10068872 | Ga0075365_100688723 | 281 |
| 18 | 3300006048 | Ga0075363_100003003 | Ga0075363_1000030032 | 281 |
| 19 | 3300006051 | Ga0075364_10019699 | Ga0075364_100196992 | 281 |
| 20 | 3300006051 | Ga0075364_10125101 | Ga0075364_101251012 | 281 |
| 21 | 3300006178 | Ga0075367_10043437 | Ga0075367_100434373 | 281 |
| 22 | 3300006195 | Ga0075366_10089319 | Ga0075366_100893192 | 281 |
| 23 | 3300006353 | Ga0075370_10165354 | Ga0075370_101653542 | 281 |
| 24 | 3300009148 | Ga0105243_10096912 | Ga0105243_100969122 | 281 |
| 25 | 3300013297 | Ga0157378_10310267 | Ga0157378_103102671 | 281 |
| 26 | 3300025261 | Ga0209233_1005147 | Ga0209233_10051474 | 281 |
| 27 | 3300025299 | Ga0209256_1014792 | Ga0209256_10147923 | 281 |
| 28 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027036 | 281 |
| 29 | 3300025901 | Ga0207688_10044077 | Ga0207688_100440772 | 281 |
| 30 | 3300025909 | Ga0207705_10052653 | Ga0207705_100526533 | 281 |
| 31 | 3300025914 | Ga0207671_10066695 | Ga0207671_100666952 | 281 |
| 32 | 3300025919 | Ga0207657_10026159 | Ga0207657_100261594 | 281 |
| 33 | 3300025920 | Ga0207649_10113007 | Ga0207649_101130072 | 281 |
| 34 | 3300025931 | Ga0207644_10454550 | Ga0207644_104545501 | 281 |
| 35 | 3300025949 | Ga0207667_10215284 | Ga0207667_102152843 | 281 |
| 36 | 3300026067 | Ga0207678_10040249 | Ga0207678_100402492 | 281 |
| 37 | 3300026078 | Ga0207702_10497536 | Ga0207702_104975361 | 281 |
| 38 | 3300033180 | Ga0307510_10037374 | Ga0307510_100373744 | 281 |
| 39 | 3300033180 | Ga0307510_10096620 | Ga0307510_100966203 | 281 |
| 40 | 3300044683 | Ga0466965_0032173 | Ga0466965_0032173_226_1140 | 281 |
| 41 | 3300044901 | Ga0466960_0037434 | Ga0466960_0037434_361_1275 | 281 |
| 42 | 3300046460 | Ga0495638_0047278 | Ga0495638_0047278_1127_2041 | 281 |
| 43 | 3300046522 | Ga0495643_0008377 | Ga0495643_0008377_3794_4708 | 281 |
| 44 | 3300046524 | Ga0495648_0075860 | Ga0495648_0075860_742_1656 | 281 |
| 45 | 3300046694 | Ga0495649_0105856 | Ga0495649_0105856_284_1198 | 281 |
| 46 | 3300048089 | Ga0495614_0007563 | Ga0495614_0007563_1527_2441 | 281 |
| 47 | 3300048905 | Ga0496102_0119146 | Ga0496102_0119146_443_1357 | 281 |
| 48 | 3300048908 | Ga0496105_0213215 | Ga0496105_0213215_508_1422 | 281 |
| 49 | 3300048915 | Ga0496112_0015095 | Ga0496112_0015095_3276_4190 | 281 |
| 50 | 3300048917 | Ga0496114_0320533 | Ga0496114_0320533_370_1284 | 281 |
| 51 | 3300048920 | Ga0496117_0118927 | Ga0496117_0118927_679_1593 | 281 |
| 52 | 3300049460 | Ga0495682_0078011 | Ga0495682_0078011_48_962 | 281 |
| 53 | 3300050491 | nmdc:mga00v17_143506_c1 | nmdc:mga00v17_143506_c1_474_1388 | 281 |
| 54 | 3300050492 | nmdc:mga0yw44_198777_c1 | nmdc:mga0yw44_198777_c1_255_1169 | 281 |
| 55 | 3300050493 | nmdc:mga0k408_45179_c1 | nmdc:mga0k408_45179_c1_175_1089 | 281 |
| 56 | 3300050496 | nmdc:mga07m45_51757_c1 | nmdc:mga07m45_51757_c1_577_1491 | 281 |
| 57 | 3300050516 | nmdc:mga0sz30_48771_c1 | nmdc:mga0sz30_48771_c1_734_1648 | 281 |
| 58 | 3300053080 | Ga0500635_0020322 | Ga0500635_0020322_1001_1915 | 281 |
| 59 | 3300053087 | Ga0500643_000069 | Ga0500643_000069_37325_38239 | 281 |
| 60 | 3300053103 | Ga0500555_009231 | Ga0500555_009231_1243_2157 | 281 |
| 61 | 3300053104 | Ga0500556_0004962 | Ga0500556_0004962_664_1578 | 281 |
| 62 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_103901_104854 | 281 |
| 63 | 3300053130 | Ga0500642_0011959 | Ga0500642_0011959_900_1814 | 281 |
| 64 | 3300053139 | Ga0500568_0017137 | Ga0500568_0017137_1538_2452 | 281 |
| 65 | 3300053156 | Ga0500622_0008815 | Ga0500622_0008815_3169_4083 | 281 |
| 66 | 3300053177 | Ga0500636_0000166 | Ga0500636_0000166_24617_25531 | 281 |
| 67 | 3300053729 | Ga0500625_003024 | Ga0500625_003024_3048_4028 | 281 |
| 68 | 3300053736 | Ga0500599_000151 | Ga0500599_000151_4771_5685 | 281 |
| 69 | 3300005983 | Ga0081540_1019127 | Ga0081540_10191274 | 282 |
| 70 | 3300033180 | Ga0307510_10055134 | Ga0307510_100551343 | 282 |
| 71 | 3300046455 | Ga0495603_0025442 | Ga0495603_0025442_2231_3145 | 282 |
| 72 | 3300047319 | Ga0495674_0422590 | Ga0495674_0422590_73_987 | 282 |
| 73 | 3300053080 | Ga0500635_0017688 | Ga0500635_0017688_454_1368 | 282 |
| 74 | 3300053147 | Ga0500589_035950 | Ga0500589_035950_737_1651 | 282 |
| 75 | 3300053150 | Ga0500603_000240 | Ga0500603_000240_12553_13467 | 282 |
| 76 | 3300053151 | Ga0500604_0023161 | Ga0500604_0023161_505_1419 | 282 |
| 77 | 3300025254 | Ga0209148_1000347 | Ga0209148_100034723 | 283 |
| 78 | 3300025272 | Ga0209455_1002483 | Ga0209455_10024836 | 283 |
| 79 | 3300025297 | Ga0209758_1003203 | Ga0209758_100320311 | 283 |
| 80 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000167 | 283 |
| 81 | 3300027361 | Ga0209489_102213 | Ga0209489_10221333 | 283 |
| 82 | 3300027363 | Ga0209700_100007 | Ga0209700_100007337 | 283 |
| 83 | 3300044658 | Ga0466972_0000134 | Ga0466972_0000134_24280_25200 | 283 |
| 84 | 3300046454 | Ga0495592_0024435 | Ga0495592_0024435_2097_3038 | 283 |
| 85 | 3300046462 | Ga0495651_0004240 | Ga0495651_0004240_4455_5396 | 283 |
| 86 | 3300046463 | Ga0495653_0064213 | Ga0495653_0064213_1327_2268 | 283 |
| 87 | 3300046477 | Ga0495664_0015208 | Ga0495664_0015208_3222_4163 | 283 |
| 88 | 3300046477 | Ga0495664_0055337 | Ga0495664_0055337_436_1353 | 283 |
| 89 | 3300046511 | Ga0495608_0030206 | Ga0495608_0030206_2101_3042 | 283 |
| 90 | 3300046514 | Ga0495618_0096450 | Ga0495618_0096450_280_1293 | 283 |
| 91 | 3300046516 | Ga0495628_0055591 | Ga0495628_0055591_1208_2149 | 283 |
| 92 | 3300046529 | Ga0495652_0000938 | Ga0495652_0000938_2126_3067 | 283 |
| 93 | 3300046529 | Ga0495652_0025055 | Ga0495652_0025055_2349_3362 | 283 |
| 94 | 3300046533 | Ga0495640_0007993 | Ga0495640_0007993_3538_4551 | 283 |
| 95 | 3300046533 | Ga0495640_0036648 | Ga0495640_0036648_968_1909 | 283 |
| 96 | 3300046543 | Ga0495645_0052596 | Ga0495645_0052596_891_1832 | 283 |
| 97 | 3300046559 | Ga0495667_0031082 | Ga0495667_0031082_1837_2778 | 283 |
| 98 | 3300046642 | Ga0495634_0080979 | Ga0495634_0080979_756_1697 | 283 |
| 99 | 3300046663 | Ga0495635_0005160 | Ga0495635_0005160_1554_2567 | 283 |
| 100 | 3300046675 | Ga0495657_0008941 | Ga0495657_0008941_1307_2248 | 283 |
| 101 | 3300046675 | Ga0495657_0018176 | Ga0495657_0018176_3990_5003 | 283 |
| 102 | 3300046678 | Ga0495599_0047674 | Ga0495599_0047674_1003_1944 | 283 |
| 103 | 3300046680 | Ga0495646_0065458 | Ga0495646_0065458_113_1054 | 283 |
| 104 | 3300046690 | Ga0495624_0017354 | Ga0495624_0017354_101_1114 | 283 |
| 105 | 3300046809 | Ga0495600_0050226 | Ga0495600_0050226_481_1422 | 283 |
| 106 | 3300046809 | Ga0495600_0061677 | Ga0495600_0061677_162_1175 | 283 |
| 107 | 3300047317 | Ga0495604_0003325 | Ga0495604_0003325_9892_10833 | 283 |
| 108 | 3300047317 | Ga0495604_0033572 | Ga0495604_0033572_2309_3322 | 283 |
| 109 | 3300047319 | Ga0495674_0079109 | Ga0495674_0079109_691_1632 | 283 |
| 110 | 3300047322 | Ga0495680_0007102 | Ga0495680_0007102_4912_5853 | 283 |
| 111 | 3300047444 | Ga0495675_0011426 | Ga0495675_0011426_3994_4935 | 283 |
| 112 | 3300047471 | Ga0495684_0052157 | Ga0495684_0052157_1589_2530 | 283 |
| 113 | 3300048088 | Ga0495602_0016046 | Ga0495602_0016046_2655_3596 | 283 |
| 114 | 3300048088 | Ga0495602_0053918 | Ga0495602_0053918_906_1919 | 283 |
| 115 | 3300048903 | Ga0496100_0128972 | Ga0496100_0128972_750_1763 | 283 |
| 116 | 3300048908 | Ga0496105_0005595 | Ga0496105_0005595_4355_5368 | 283 |
| 117 | 3300048921 | Ga0496118_0188289 | Ga0496118_0188289_37_1050 | 283 |
| 118 | 3300048923 | Ga0496120_0010703 | Ga0496120_0010703_4999_6012 | 283 |
| 119 | 3300048928 | Ga0496125_0104374 | Ga0496125_0104374_512_1525 | 283 |
| 120 | 3300050492 | nmdc:mga0yw44_35390_c1 | nmdc:mga0yw44_35390_c1_523_1464 | 283 |
| 121 | 3300053077 | Ga0495601_0199096 | Ga0495601_0199096_100_1017 | 283 |
| 122 | 3300053098 | Ga0500650_0055084 | Ga0500650_0055084_249_1190 | 283 |
| 123 | 3300053109 | Ga0500569_014459 | Ga0500569_014459_910_1851 | 283 |
| 124 | 3300053142 | Ga0500577_0033509 | Ga0500577_0033509_615_1556 | 283 |
| 125 | 3300053731 | Ga0500609_002156 | Ga0500609_002156_382_1323 | 283 |
| 126 | 3300005530 | Ga0070679_100037472 | Ga0070679_1000374724 | 284 |
| 127 | 3300005539 | Ga0068853_100130206 | Ga0068853_1001302063 | 284 |
| 128 | 3300025917 | Ga0207660_10101298 | Ga0207660_101012983 | 284 |
| 129 | 3300037418 | Ga0395900_0201794 | Ga0395900_0201794_296_1216 | 284 |
| 130 | 3300009545 | Ga0105237_10206221 | Ga0105237_102062211 | 285 |
| 131 | 3300035692 | Ga0373935_0055887 | Ga0373935_0055887_1379_2290 | 285 |
| 132 | 3300035695 | Ga0373927_0027113 | Ga0373927_0027113_455_1366 | 285 |
| 133 | 3300046454 | Ga0495592_0190651 | Ga0495592_0190651_406_1317 | 285 |
| 134 | 3300046557 | Ga0495622_0051205 | Ga0495622_0051205_363_1274 | 285 |
| 135 | 3300046678 | Ga0495599_0171615 | Ga0495599_0171615_276_1187 | 285 |
| 136 | 3300048920 | Ga0496117_0067801 | Ga0496117_0067801_1281_2192 | 285 |
| 137 | 3300048921 | Ga0496118_0003016 | Ga0496118_0003016_11547_12458 | 285 |
| 138 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_165866_166777 | 285 |
| 139 | 3300048927 | Ga0496124_0006721 | Ga0496124_0006721_5384_6295 | 285 |
| 140 | 3300048929 | Ga0496126_0053820 | Ga0496126_0053820_877_1788 | 285 |
| 141 | 3300053094 | Ga0500566_0043837 | Ga0500566_0043837_89_1000 | 285 |
| 142 | 3300053150 | Ga0500603_067225 | Ga0500603_067225_49_960 | 285 |
| 143 | 3300053733 | Ga0500552_000771 | Ga0500552_000771_159_1070 | 285 |
| 144 | 3300053735 | Ga0500596_001440 | Ga0500596_001440_3821_4732 | 285 |
| 145 | 3300048924 | Ga0496121_0071824 | Ga0496121_0071824_1422_2372 | 286 |
| 146 | 3300053130 | Ga0500642_0000051 | Ga0500642_0000051_30734_31753 | 286 |
| 147 | 3300009545 | Ga0105237_10399960 | Ga0105237_103999602 | 287 |
| 148 | 3300049583 | Ga0501067_0021251 | Ga0501067_0021251_915_1877 | 287 |
| 149 | 3300025914 | Ga0207671_10154511 | Ga0207671_101545113 | 288 |
| 150 | 3300030521 | Ga0307511_10114407 | Ga0307511_101144071 | 288 |
| 151 | 3300033179 | Ga0307507_10006824 | Ga0307507_1000682418 | 288 |
| 152 | 3300045976 | Ga0466967_0184717 | Ga0466967_0184717_820_1779 | 288 |
| 153 | 3300053094 | Ga0500566_0000608 | Ga0500566_0000608_9215_10252 | 288 |
| 154 | 3300061719 | Ga0466962_0045345 | Ga0466962_0045345_28_987 | 288 |
| 155 | 3300005544 | Ga0070686_100163559 | Ga0070686_1001635592 | 290 |
| 156 | 3300025961 | Ga0207712_10017129 | Ga0207712_100171293 | 290 |
| 157 | 3300039145 | Ga0237816_02524 | Ga0237816_02524_480_1373 | 291 |
| 158 | 3300005434 | Ga0070709_10027137 | Ga0070709_100271372 | 293 |
| 159 | 3300005437 | Ga0070710_10012215 | Ga0070710_100122155 | 293 |
| 160 | 3300025898 | Ga0207692_10021439 | Ga0207692_100214393 | 293 |
| 161 | 3300025916 | Ga0207663_10045486 | Ga0207663_100454863 | 293 |
| 162 | 3300009093 | Ga0105240_10003278 | Ga0105240_1000327816 | 294 |
| 163 | 3300009098 | Ga0105245_10082016 | Ga0105245_100820163 | 294 |
| 164 | 3300009545 | Ga0105237_10001694 | Ga0105237_1000169421 | 294 |
| 165 | 3300010375 | Ga0105239_10065020 | Ga0105239_100650203 | 294 |
| 166 | 3300013104 | Ga0157370_10153088 | Ga0157370_101530883 | 294 |
| 167 | 3300014968 | Ga0157379_10197101 | Ga0157379_101971012 | 294 |
| 168 | 3300025911 | Ga0207654_10045215 | Ga0207654_100452153 | 294 |
| 169 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008868 | 294 |
| 170 | 3300025914 | Ga0207671_10010103 | Ga0207671_100101035 | 294 |
| 171 | 3300026142 | Ga0207698_10059392 | Ga0207698_100593923 | 294 |
| 172 | 3300028381 | Ga0268264_10337985 | Ga0268264_103379852 | 294 |
| 173 | 3300048925 | Ga0496122_0071759 | Ga0496122_0071759_977_1867 | 294 |
| 174 | 3300048929 | Ga0496126_0049685 | Ga0496126_0049685_1405_2295 | 294 |
| 175 | 3300048929 | Ga0496126_0369665 | Ga0496126_0369665_186_1076 | 294 |
| 176 | 3300049568 | Ga0501031_0000652 | Ga0501031_0000652_15148_16038 | 294 |
| 177 | 3300049569 | Ga0501032_0002299 | Ga0501032_0002299_1029_1919 | 294 |
| 178 | 3300049569 | Ga0501032_0036945 | Ga0501032_0036945_736_1626 | 294 |
| 179 | 3300049570 | Ga0501033_0000091 | Ga0501033_0000091_18034_18924 | 294 |
| 180 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_133699_134589 | 294 |
| 181 | 3300049571 | Ga0501034_0636407 | Ga0501034_0636407_67_957 | 294 |
| 182 | 3300049572 | Ga0501036_0000052 | Ga0501036_0000052_51553_52443 | 294 |
| 183 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_36267_37157 | 294 |
| 184 | 3300049574 | Ga0501038_0002924 | Ga0501038_0002924_13122_14012 | 294 |
| 185 | 3300049574 | Ga0501038_0211707 | Ga0501038_0211707_63_953 | 294 |
| 186 | 3300049575 | Ga0501039_0000719 | Ga0501039_0000719_3769_4659 | 294 |
| 187 | 3300049579 | Ga0501043_0000928 | Ga0501043_0000928_2699_3589 | 294 |
| 188 | 3300049580 | Ga0501046_0000231 | Ga0501046_0000231_47374_48264 | 294 |
| 189 | 3300049581 | Ga0501047_0000457 | Ga0501047_0000457_13783_14673 | 294 |
| 190 | 3300049581 | Ga0501047_0024108 | Ga0501047_0024108_2564_3454 | 294 |
| 191 | 3300049582 | Ga0501048_0000218 | Ga0501048_0000218_33958_34848 | 294 |
| 192 | 3300049583 | Ga0501067_0003111 | Ga0501067_0003111_3278_4168 | 294 |
| 193 | 3300049584 | Ga0501068_0001352 | Ga0501068_0001352_2194_3084 | 294 |
| 194 | 3300049586 | Ga0501070_0002829 | Ga0501070_0002829_1889_2779 | 294 |
| 195 | 3300049587 | Ga0501071_0026801 | Ga0501071_0026801_2688_3578 | 294 |
| 196 | 3300049588 | Ga0501072_0004469 | Ga0501072_0004469_4371_5261 | 294 |
| 197 | 3300049589 | Ga0501073_0000877 | Ga0501073_0000877_10612_11502 | 294 |
| 198 | 3300049590 | Ga0501074_0000273 | Ga0501074_0000273_25529_26419 | 294 |
| 199 | 3300049741 | Ga0501079_0011695 | Ga0501079_0011695_5138_6028 | 294 |
| 200 | 3300049742 | Ga0501080_0000124 | Ga0501080_0000124_9852_10742 | 294 |
| 201 | 3300049744 | Ga0501083_0000785 | Ga0501083_0000785_857_1747 | 294 |
| 202 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_66055_66945 | 294 |
| 203 | 3300049822 | Ga0501035_0135984 | Ga0501035_0135984_1159_2049 | 294 |
| 204 | 3300049823 | Ga0501044_0000217 | Ga0501044_0000217_50000_50890 | 294 |
| 205 | 3300049823 | Ga0501044_0100080 | Ga0501044_0100080_1119_2009 | 294 |
| 206 | 3300049824 | Ga0501045_0010874 | Ga0501045_0010874_2955_3845 | 294 |
| 207 | 3300054114 | Ga0501084_0000683 | Ga0501084_0000683_9867_10757 | 294 |
| 208 | 3300060353 | Ga0501082_0007986 | Ga0501082_0007986_4301_5191 | 294 |
| 209 | 3300048915 | Ga0496112_0000044 | Ga0496112_0000044_74138_75028 | 295 |
| 210 | 3300048918 | Ga0496115_0175726 | Ga0496115_0175726_612_1505 | 295 |
| 211 | 3300005339 | Ga0070660_100118218 | Ga0070660_1001182182 | 296 |
| 212 | iso_pu_bacteria | 8006994254 | 8007000961 | 296 |
| 213 | 3300021358 | Ga0213873_10002543 | Ga0213873_100025431 | 297 |
| 214 | 3300021384 | Ga0213876_10006112 | Ga0213876_100061127 | 297 |
| 215 | 3300039437 | Ga0436365_1276870 | Ga0436365_1276870_6441_7370 | 297 |
| 216 | 3300039453 | Ga0436362_0966777 | Ga0436362_0966777_1689_2618 | 297 |
| 217 | iso_pu_bacteria | 2507262055 | 2507507596 | 298 |
| 218 | iso_pu_bacteria | 2508501009 | 2508541715 | 298 |
| 219 | iso_pu_bacteria | 2508501042 | 2508692743 | 298 |
| 220 | iso_pu_bacteria | 2511231028 | 2511397091 | 298 |
| 221 | iso_pu_bacteria | 2513237092 | 2513621797 | 298 |
| 222 | iso_pu_bacteria | 2513237094 | 2513636760 | 298 |
| 223 | iso_pu_bacteria | 2513237095 | 2513647581 | 298 |
| 224 | iso_pu_bacteria | 2513237101 | 2513697094 | 298 |
| 225 | iso_pu_bacteria | 2513237102 | 2513701382 | 298 |
| 226 | iso_pu_bacteria | 2513237139 | 2513878709 | 298 |
| 227 | iso_pu_bacteria | 2513237161 | 2514009363 | 298 |
| 228 | iso_pu_bacteria | 2515154112 | 2515626140 | 298 |
| 229 | iso_pu_bacteria | 2517093001 | 2517104225 | 298 |
| 230 | iso_pu_bacteria | 2528768022 | 2528848913 | 298 |
| 231 | iso_pu_bacteria | 2617270735 | 2617346864 | 298 |
| 232 | iso_pu_bacteria | 2617270741 | 2617372795 | 298 |
| 233 | iso_pu_bacteria | 2721755755 | 2723843626 | 298 |
| 234 | iso_pu_bacteria | 2791355196 | 2793060941 | 298 |
| 235 | iso_pu_bacteria | 2791355199 | 2793083853 | 298 |
| 236 | iso_pu_bacteria | 2802429603 | 2805921358 | 298 |
| 237 | iso_pu_bacteria | 2816332527 | 2818236618 | 298 |
| 238 | iso_pu_bacteria | 2824600985 | 2824605198 | 298 |
| 239 | iso_pu_bacteria | 2824609381 | 2824615517 | 298 |
| 240 | iso_pu_bacteria | 2824617872 | 2824620486 | 298 |
| 241 | iso_pu_bacteria | 2824626560 | 2824628466 | 298 |
| 242 | iso_pu_bacteria | 2824635225 | 2824637166 | 298 |
| 243 | iso_pu_bacteria | 2824644064 | 2824645911 | 298 |
| 244 | iso_pu_bacteria | 2824653114 | 2824656404 | 298 |
| 245 | iso_pu_bacteria | 2824661429 | 2824666194 | 298 |
| 246 | iso_pu_bacteria | 2824671348 | 2824673704 | 298 |
| 247 | iso_pu_bacteria | 2824679649 | 2824681761 | 298 |
| 248 | iso_pu_bacteria | 2824687955 | 2824690671 | 298 |
| 249 | iso_pu_bacteria | 2824704595 | 2824709824 | 298 |
| 250 | iso_pu_bacteria | 2824714736 | 2824716578 | 298 |
| 251 | iso_pu_bacteria | 2824723954 | 2824725559 | 298 |
| 252 | iso_pu_bacteria | 2824732956 | 2824736080 | 298 |
| 253 | iso_pu_bacteria | 2824746037 | 2824748798 | 298 |
| 254 | iso_pu_bacteria | 2824753945 | 2824756048 | 298 |
| 255 | iso_pu_bacteria | 2824763712 | 2824767586 | 298 |
| 256 | iso_pu_bacteria | 2824773399 | 2824775059 | 298 |
| 257 | iso_pu_bacteria | 2838122688 | 2838129286 | 298 |
| 258 | iso_pu_bacteria | 2841941048 | 2841948058 | 298 |
| 259 | iso_pu_bacteria | 2841949485 | 2841953545 | 298 |
| 260 | iso_pu_bacteria | 2841957949 | 2841962857 | 298 |
| 261 | iso_pu_bacteria | 2841966195 | 2841973050 | 298 |
| 262 | iso_pu_bacteria | 2841974524 | 2841978273 | 298 |
| 263 | iso_pu_bacteria | 2841983080 | 2841990492 | 298 |
| 264 | iso_pu_bacteria | 2842038055 | 2842040716 | 298 |
| 265 | iso_pu_bacteria | 2842045827 | 2842046338 | 298 |
| 266 | iso_pu_bacteria | 2847930680 | 2847937387 | 298 |
| 267 | iso_pu_bacteria | 2847939898 | 2847947812 | 298 |
| 268 | iso_pu_bacteria | 2849076700 | 2849078330 | 298 |
| 269 | iso_pu_bacteria | 2857509624 | 2857512710 | 298 |
| 270 | iso_pu_bacteria | 2874590934 | 2874598712 | 298 |
| 271 | iso_pu_bacteria | 2874604998 | 2874607162 | 298 |
| 272 | iso_pu_bacteria | 2874612657 | 2874614505 | 298 |
| 273 | iso_pu_bacteria | 2874620515 | 2874628144 | 298 |
| 274 | iso_pu_bacteria | 2874628541 | 2874634940 | 298 |
| 275 | iso_pu_bacteria | 2874645413 | 2874652167 | 298 |
| 276 | iso_pu_bacteria | 2876771140 | 2876778751 | 298 |
| 277 | iso_pu_bacteria | 2876818435 | 2876824354 | 298 |
| 278 | iso_pu_bacteria | 2879074833 | 2879082544 | 298 |
| 279 | iso_pu_bacteria | 2879083081 | 2879086688 | 298 |
| 280 | iso_pu_bacteria | 2879099564 | 2879107777 | 298 |
| 281 | iso_pu_bacteria | 2879110137 | 2879114049 | 298 |
| 282 | iso_pu_bacteria | 2879127579 | 2879131461 | 298 |
| 283 | iso_pu_bacteria | 2879142872 | 2879147907 | 298 |
| 284 | iso_pu_bacteria | 2881364244 | 2881371396 | 298 |
| 285 | iso_pu_bacteria | 2881665667 | 2881666650 | 298 |
| 286 | iso_pu_bacteria | 2885366525 | 2885370031 | 298 |
| 287 | iso_pu_bacteria | 2885409591 | 2885415667 | 298 |
| 288 | iso_pu_bacteria | 2888378607 | 2888385518 | 298 |
| 289 | iso_pu_bacteria | 2888388044 | 2888392712 | 298 |
| 290 | iso_pu_bacteria | 2888419890 | 2888425650 | 298 |
| 291 | iso_pu_bacteria | 2889033259 | 2889037948 | 298 |
| 292 | iso_pu_bacteria | 2904666416 | 2904674238 | 298 |
| 293 | iso_pu_bacteria | 2904711408 | 2904711907 | 298 |
| 294 | iso_pu_bacteria | 2906643746 | 2906647358 | 298 |
| 295 | iso_pu_bacteria | 2908775508 | 2908781239 | 298 |
| 296 | iso_pu_bacteria | 2922361189 | 2922361886 | 298 |
| 297 | iso_pu_bacteria | 2922368715 | 2922372338 | 298 |
| 298 | iso_pu_bacteria | 2922386360 | 2922386881 | 298 |
| 299 | iso_pu_bacteria | 2922393267 | 2922397012 | 298 |
| 300 | iso_pu_bacteria | 2929615660 | 2929621091 | 298 |
| 301 | iso_pu_bacteria | 2929624759 | 2929626078 | 298 |
| 302 | iso_pu_bacteria | 2932784394 | 2932785048 | 298 |
| 303 | iso_pu_bacteria | 2932794094 | 2932795087 | 298 |
| 304 | iso_pu_bacteria | 2932801729 | 2932805615 | 298 |
| 305 | iso_pu_bacteria | 2932809354 | 2932810076 | 298 |
| 306 | iso_pu_bacteria | 2932818245 | 2932821650 | 298 |
| 307 | iso_pu_bacteria | 2932828146 | 2932828884 | 298 |
| 308 | iso_pu_bacteria | 2933577622 | 2933583039 | 298 |
| 309 | iso_pu_bacteria | 2935608549 | 2935609896 | 298 |
| 310 | iso_pu_bacteria | 2935616580 | 2935619696 | 298 |
| 311 | iso_pu_bacteria | 2935638405 | 2935638676 | 298 |
| 312 | iso_pu_bacteria | 2935648319 | 2935652074 | 298 |
| 313 | iso_pu_bacteria | 2935656913 | 2935659953 | 298 |
| 314 | iso_pu_bacteria | 2935665750 | 2935666472 | 298 |
| 315 | iso_pu_bacteria | 2935675223 | 2935676485 | 298 |
| 316 | iso_pu_bacteria | 2935684952 | 2935690999 | 298 |
| 317 | iso_pu_bacteria | 2935694250 | 2935694567 | 298 |
| 318 | iso_pu_bacteria | 2935703347 | 2935703682 | 298 |
| 319 | iso_pu_bacteria | 2935713505 | 2935718380 | 298 |
| 320 | iso_pu_bacteria | 2935722832 | 2935727640 | 298 |
| 321 | iso_pu_bacteria | 2935732158 | 2935736343 | 298 |
| 322 | iso_pu_bacteria | 2935741537 | 2935745723 | 298 |
| 323 | iso_pu_bacteria | 2935750917 | 2935756104 | 298 |
| 324 | iso_pu_bacteria | 2935760218 | 2935760636 | 298 |
| 325 | iso_pu_bacteria | 2935769743 | 2935776055 | 298 |
| 326 | iso_pu_bacteria | 2935777560 | 2935783487 | 298 |
| 327 | iso_pu_bacteria | 2935785616 | 2935791932 | 298 |
| 328 | iso_pu_bacteria | 2935793552 | 2935800258 | 298 |
| 329 | iso_pu_bacteria | 2935801545 | 2935801820 | 298 |
| 330 | iso_pu_bacteria | 2935810662 | 2935814765 | 298 |
| 331 | iso_pu_bacteria | 2935819856 | 2935823056 | 298 |
| 332 | iso_pu_bacteria | 2935827899 | 2935828170 | 298 |
| 333 | iso_pu_bacteria | 2935837841 | 2935842375 | 298 |
| 334 | iso_pu_bacteria | 2935847175 | 2935848638 | 298 |
| 335 | iso_pu_bacteria | 2935855204 | 2935857989 | 298 |
| 336 | iso_pu_bacteria | 2935864058 | 2935867893 | 298 |
| 337 | iso_pu_bacteria | 2935873716 | 2935874083 | 298 |
| 338 | iso_pu_bacteria | 2935883170 | 2935885815 | 298 |
| 339 | iso_pu_bacteria | 2935908558 | 2935909556 | 298 |
| 340 | iso_pu_bacteria | 2935916978 | 2935917281 | 298 |
| 341 | iso_pu_bacteria | 2935926038 | 2935927037 | 298 |
| 342 | iso_pu_bacteria | 2935934488 | 2935937119 | 298 |
| 343 | iso_pu_bacteria | 2935942939 | 2935944578 | 298 |
| 344 | iso_pu_bacteria | 2935951376 | 2935953015 | 298 |
| 345 | iso_pu_bacteria | 2935967501 | 2935969855 | 298 |
| 346 | iso_pu_bacteria | 2935975950 | 2935976452 | 298 |
| 347 | iso_pu_bacteria | 2935984226 | 2935987098 | 298 |
| 348 | iso_pu_bacteria | 2935992306 | 2935992992 | 298 |
| 349 | iso_pu_bacteria | 2936002035 | 2936002904 | 298 |
| 350 | iso_pu_bacteria | 2936011229 | 2936014369 | 298 |
| 351 | iso_pu_bacteria | 2936019824 | 2936023791 | 298 |
| 352 | iso_pu_bacteria | 2936028420 | 2936031434 | 298 |
| 353 | iso_pu_bacteria | 2936037263 | 2936040592 | 298 |
| 354 | iso_pu_bacteria | 2936046547 | 2936049475 | 298 |
| 355 | iso_pu_bacteria | 2936055302 | 2936062225 | 298 |
| 356 | iso_pu_bacteria | 2940556831 | 2940561921 | 298 |
| 357 | iso_pu_bacteria | 2941531003 | 2941531276 | 298 |
| 358 | iso_pu_bacteria | 2941538514 | 2941542424 | 298 |
| 359 | iso_pu_bacteria | 3005483717 | 3005485468 | 298 |
| 360 | iso_pu_bacteria | 3005506211 | 3005508373 | 298 |
| 361 | iso_pu_bacteria | 3005587118 | 3005588127 | 298 |
| 362 | iso_pu_bacteria | 8006964411 | 8006968821 | 298 |
| 363 | iso_pu_bacteria | 8006984368 | 8006984500 | 298 |
| 364 | iso_pu_bacteria | 8016522445 | 8016528618 | 298 |
| 365 | iso_pu_bacteria | 8016530956 | 8016533788 | 298 |
| 366 | iso_pu_bacteria | 8016548790 | 8016555105 | 298 |
| 367 | iso_pu_bacteria | 8016557553 | 8016563470 | 298 |
| 368 | iso_pu_bacteria | 8016566248 | 8016572124 | 298 |
| 369 | iso_pu_bacteria | 8016575299 | 8016576322 | 298 |
| 370 | iso_pu_bacteria | 8016595262 | 8016601217 | 298 |
| 371 | iso_pu_bacteria | 8016603502 | 8016609221 | 298 |
| 372 | iso_pu_bacteria | 8016613128 | 8016615682 | 298 |
| 373 | iso_pu_bacteria | 8016622563 | 8016625543 | 298 |
| 374 | iso_pu_bacteria | 8016630954 | 8016639102 | 298 |
| 375 | iso_pu_bacteria | 8017057580 | 8017064996 | 298 |
| 376 | iso_pu_bacteria | 8019530166 | 8019533564 | 298 |
| 377 | iso_pu_bacteria | 8019538911 | 8019546106 | 298 |
| 378 | iso_pu_bacteria | 8019547302 | 8019552600 | 298 |
| 379 | iso_pu_bacteria | 8019576017 | 8019584374 | 298 |
| 380 | iso_pu_bacteria | 8019586578 | 8019592145 | 298 |
| 381 | iso_pu_bacteria | 8019597564 | 8019599136 | 298 |
| 382 | iso_pu_bacteria | 8019619141 | 8019619882 | 298 |
| 383 | iso_pu_bacteria | 8019629233 | 8019633235 | 298 |
| 384 | iso_pu_bacteria | 8019638758 | 8019646664 | 298 |
| 385 | iso_pu_bacteria | 8019659431 | 8019661104 | 298 |
| 386 | iso_pu_bacteria | 8019668869 | 8019670662 | 298 |
| 387 | iso_pu_bacteria | 8019678201 | 8019685569 | 298 |
| 388 | iso_pu_bacteria | 8019687851 | 8019691138 | 298 |
| 389 | iso_pu_bacteria | 8055742211 | 8055745046 | 298 |
| 390 | iso_pu_bacteria | 8056673599 | 8056677483 | 298 |
| 391 | 3300005327 | Ga0070658_10005755 | Ga0070658_100057553 | 299 |
| 392 | 3300005328 | Ga0070676_10068276 | Ga0070676_100682763 | 299 |
| 393 | 3300005328 | Ga0070676_10129692 | Ga0070676_101296922 | 299 |
| 394 | 3300005329 | Ga0070683_100007952 | Ga0070683_1000079523 | 299 |
| 395 | 3300005331 | Ga0070670_100037139 | Ga0070670_1000371392 | 299 |
| 396 | 3300005333 | Ga0070677_10002920 | Ga0070677_100029202 | 299 |
| 397 | 3300005338 | Ga0068868_100021088 | Ga0068868_1000210882 | 299 |
| 398 | 3300005338 | Ga0068868_100118279 | Ga0068868_1001182792 | 299 |
| 399 | 3300005339 | Ga0070660_100094301 | Ga0070660_1000943012 | 299 |
| 400 | 3300005340 | Ga0070689_100250614 | Ga0070689_1002506142 | 299 |
| 401 | 3300005344 | Ga0070661_100004144 | Ga0070661_1000041444 | 299 |
| 402 | 3300005353 | Ga0070669_100037552 | Ga0070669_1000375523 | 299 |
| 403 | 3300005353 | Ga0070669_100182244 | Ga0070669_1001822442 | 299 |
| 404 | 3300005354 | Ga0070675_100008566 | Ga0070675_1000085667 | 299 |
| 405 | 3300005355 | Ga0070671_100191918 | Ga0070671_1001919182 | 299 |
| 406 | 3300005356 | Ga0070674_100000518 | Ga0070674_10000051815 | 299 |
| 407 | 3300005356 | Ga0070674_100003318 | Ga0070674_1000033187 | 299 |
| 408 | 3300005364 | Ga0070673_100064373 | Ga0070673_1000643732 | 299 |
| 409 | 3300005366 | Ga0070659_100033568 | Ga0070659_1000335684 | 299 |
| 410 | 3300005367 | Ga0070667_100007713 | Ga0070667_1000077136 | 299 |
| 411 | 3300005456 | Ga0070678_100003918 | Ga0070678_1000039185 | 299 |
| 412 | 3300005456 | Ga0070678_100162088 | Ga0070678_1001620881 | 299 |
| 413 | 3300005457 | Ga0070662_100437376 | Ga0070662_1004373761 | 299 |
| 414 | 3300005459 | Ga0068867_100004484 | Ga0068867_10000448410 | 299 |
| 415 | 3300005535 | Ga0070684_100002660 | Ga0070684_1000026607 | 299 |
| 416 | 3300005535 | Ga0070684_100185011 | Ga0070684_1001850112 | 299 |
| 417 | 3300005543 | Ga0070672_100000150 | Ga0070672_10000015025 | 299 |
| 418 | 3300005543 | Ga0070672_100026924 | Ga0070672_1000269244 | 299 |
| 419 | 3300005547 | Ga0070693_100053632 | Ga0070693_1000536322 | 299 |
| 420 | 3300005548 | Ga0070665_100095325 | Ga0070665_1000953253 | 299 |
| 421 | 3300005564 | Ga0070664_100020769 | Ga0070664_1000207695 | 299 |
| 422 | 3300005577 | Ga0068857_100175773 | Ga0068857_1001757732 | 299 |
| 423 | 3300005578 | Ga0068854_100001586 | Ga0068854_1000015866 | 299 |
| 424 | 3300005614 | Ga0068856_100002765 | Ga0068856_10000276511 | 299 |
| 425 | 3300005616 | Ga0068852_100012408 | Ga0068852_1000124084 | 299 |
| 426 | 3300005616 | Ga0068852_100015875 | Ga0068852_1000158756 | 299 |
| 427 | 3300005618 | Ga0068864_100125965 | Ga0068864_1001259652 | 299 |
| 428 | 3300005618 | Ga0068864_100280962 | Ga0068864_1002809622 | 299 |
| 429 | 3300005719 | Ga0068861_100007671 | Ga0068861_1000076717 | 299 |
| 430 | 3300005840 | Ga0068870_10064238 | Ga0068870_100642382 | 299 |
| 431 | 3300005841 | Ga0068863_100019290 | Ga0068863_1000192903 | 299 |
| 432 | 3300005841 | Ga0068863_100354582 | Ga0068863_1003545822 | 299 |
| 433 | 3300005842 | Ga0068858_100006988 | Ga0068858_1000069884 | 299 |
| 434 | 3300005843 | Ga0068860_100064651 | Ga0068860_1000646513 | 299 |
| 435 | 3300005843 | Ga0068860_100090365 | Ga0068860_1000903653 | 299 |
| 436 | 3300006358 | Ga0068871_100019118 | Ga0068871_1000191185 | 299 |
| 437 | 3300009093 | Ga0105240_10593043 | Ga0105240_105930431 | 299 |
| 438 | 3300009174 | Ga0105241_10383282 | Ga0105241_103832821 | 299 |
| 439 | 3300009177 | Ga0105248_10025180 | Ga0105248_100251804 | 299 |
| 440 | 3300009177 | Ga0105248_10397254 | Ga0105248_103972542 | 299 |
| 441 | 3300009551 | Ga0105238_10004287 | Ga0105238_100042873 | 299 |
| 442 | 3300009553 | Ga0105249_10001498 | Ga0105249_1000149816 | 299 |
| 443 | 3300013296 | Ga0157374_10097214 | Ga0157374_100972143 | 299 |
| 444 | 3300013306 | Ga0163162_10020520 | Ga0163162_100205204 | 299 |
| 445 | 3300013307 | Ga0157372_10109670 | Ga0157372_101096703 | 299 |
| 446 | 3300013308 | Ga0157375_10020672 | Ga0157375_100206725 | 299 |
| 447 | 3300013308 | Ga0157375_10269324 | Ga0157375_102693242 | 299 |
| 448 | 3300014326 | Ga0157380_10001208 | Ga0157380_1000120816 | 299 |
| 449 | 3300014326 | Ga0157380_10204433 | Ga0157380_102044332 | 299 |
| 450 | 3300014968 | Ga0157379_10009787 | Ga0157379_100097877 | 299 |
| 451 | 3300014968 | Ga0157379_10013513 | Ga0157379_100135134 | 299 |
| 452 | 3300014969 | Ga0157376_10079936 | Ga0157376_100799363 | 299 |
| 453 | 3300017792 | Ga0163161_10017129 | Ga0163161_100171292 | 299 |
| 454 | 3300021384 | Ga0213876_10067134 | Ga0213876_100671342 | 299 |
| 455 | 3300025321 | Ga0207656_10023712 | Ga0207656_100237123 | 299 |
| 456 | 3300025321 | Ga0207656_10155796 | Ga0207656_101557961 | 299 |
| 457 | 3300025893 | Ga0207682_10000759 | Ga0207682_100007597 | 299 |
| 458 | 3300025901 | Ga0207688_10064671 | Ga0207688_100646712 | 299 |
| 459 | 3300025907 | Ga0207645_10023994 | Ga0207645_100239944 | 299 |
| 460 | 3300025907 | Ga0207645_10044376 | Ga0207645_100443762 | 299 |
| 461 | 3300025908 | Ga0207643_10067337 | Ga0207643_100673372 | 299 |
| 462 | 3300025909 | Ga0207705_10072358 | Ga0207705_100723583 | 299 |
| 463 | 3300025913 | Ga0207695_10322858 | Ga0207695_103228582 | 299 |
| 464 | 3300025918 | Ga0207662_10066120 | Ga0207662_100661203 | 299 |
| 465 | 3300025919 | Ga0207657_10030571 | Ga0207657_100305714 | 299 |
| 466 | 3300025919 | Ga0207657_10141002 | Ga0207657_101410022 | 299 |
| 467 | 3300025923 | Ga0207681_10006914 | Ga0207681_100069144 | 299 |
| 468 | 3300025923 | Ga0207681_10010182 | Ga0207681_100101825 | 299 |
| 469 | 3300025924 | Ga0207694_10012939 | Ga0207694_100129392 | 299 |
| 470 | 3300025925 | Ga0207650_10002442 | Ga0207650_1000244210 | 299 |
| 471 | 3300025926 | Ga0207659_10000135 | Ga0207659_1000013534 | 299 |
| 472 | 3300025926 | Ga0207659_10012550 | Ga0207659_100125503 | 299 |
| 473 | 3300025927 | Ga0207687_10192296 | Ga0207687_101922962 | 299 |
| 474 | 3300025931 | Ga0207644_10020254 | Ga0207644_100202542 | 299 |
| 475 | 3300025932 | Ga0207690_10054941 | Ga0207690_100549413 | 299 |
| 476 | 3300025933 | Ga0207706_10002883 | Ga0207706_1000288315 | 299 |
| 477 | 3300025933 | Ga0207706_10110757 | Ga0207706_101107572 | 299 |
| 478 | 3300025937 | Ga0207669_10012119 | Ga0207669_100121193 | 299 |
| 479 | 3300025940 | Ga0207691_10002113 | Ga0207691_100021136 | 299 |
| 480 | 3300025940 | Ga0207691_10025132 | Ga0207691_100251323 | 299 |
| 481 | 3300025940 | Ga0207691_10364215 | Ga0207691_103642152 | 299 |
| 482 | 3300025941 | Ga0207711_10032396 | Ga0207711_100323963 | 299 |
| 483 | 3300025944 | Ga0207661_10036834 | Ga0207661_100368343 | 299 |
| 484 | 3300025945 | Ga0207679_10003707 | Ga0207679_100037073 | 299 |
| 485 | 3300025960 | Ga0207651_10000647 | Ga0207651_100006477 | 299 |
| 486 | 3300025986 | Ga0207658_10014926 | Ga0207658_100149262 | 299 |
| 487 | 3300025986 | Ga0207658_10058472 | Ga0207658_100584722 | 299 |
| 488 | 3300026023 | Ga0207677_10005607 | Ga0207677_100056077 | 299 |
| 489 | 3300026035 | Ga0207703_10005700 | Ga0207703_100057005 | 299 |
| 490 | 3300026035 | Ga0207703_10151611 | Ga0207703_101516112 | 299 |
| 491 | 3300026067 | Ga0207678_10016124 | Ga0207678_100161245 | 299 |
| 492 | 3300026078 | Ga0207702_10200973 | Ga0207702_102009731 | 299 |
| 493 | 3300026089 | Ga0207648_10002879 | Ga0207648_1000287916 | 299 |
| 494 | 3300026089 | Ga0207648_10036193 | Ga0207648_100361933 | 299 |
| 495 | 3300026089 | Ga0207648_10489998 | Ga0207648_104899982 | 299 |
| 496 | 3300026095 | Ga0207676_10040495 | Ga0207676_100404952 | 299 |
| 497 | 3300026095 | Ga0207676_10155254 | Ga0207676_101552541 | 299 |
| 498 | 3300026116 | Ga0207674_10139575 | Ga0207674_101395752 | 299 |
| 499 | 3300026116 | Ga0207674_10303432 | Ga0207674_103034322 | 299 |
| 500 | 3300026142 | Ga0207698_10004390 | Ga0207698_100043909 | 299 |
| 501 | 3300028379 | Ga0268266_10060289 | Ga0268266_100602892 | 299 |
| 502 | 3300028381 | Ga0268264_10342113 | Ga0268264_103421132 | 299 |
| 503 | 3300031249 | Ga0265339_10053306 | Ga0265339_100533063 | 299 |
| 504 | 3300031852 | Ga0307410_10005624 | Ga0307410_100056243 | 299 |
| 505 | 3300031852 | Ga0307410_10210576 | Ga0307410_102105762 | 299 |
| 506 | 3300031901 | Ga0307406_10003804 | Ga0307406_100038046 | 299 |
| 507 | 3300031903 | Ga0307407_10031383 | Ga0307407_100313834 | 299 |
| 508 | 3300031911 | Ga0307412_10435276 | Ga0307412_104352762 | 299 |
| 509 | 3300032002 | Ga0307416_100003421 | Ga0307416_1000034214 | 299 |
| 510 | 3300032005 | Ga0307411_10039581 | Ga0307411_100395814 | 299 |
| 511 | 3300035120 | Ga0373957_0077728 | Ga0373957_0077728_74_973 | 299 |
| 512 | 3300035172 | Ga0373955_0072253 | Ga0373955_0072253_701_1600 | 299 |
| 513 | 3300035242 | Ga0373962_0008156 | Ga0373962_0008156_1068_1967 | 299 |
| 514 | 3300035691 | Ga0373931_0011120 | Ga0373931_0011120_2502_3401 | 299 |
| 515 | 3300037068 | Ga0373925_0072696 | Ga0373925_0072696_786_1685 | 299 |
| 516 | 3300039437 | Ga0436365_0496646 | Ga0436365_0496646_2156_3055 | 299 |
| 517 | 3300046459 | Ga0495629_0007286 | Ga0495629_0007286_3889_4788 | 299 |
| 518 | 3300046543 | Ga0495645_0156327 | Ga0495645_0156327_43_942 | 299 |
| 519 | 3300046663 | Ga0495635_0111434 | Ga0495635_0111434_310_1209 | 299 |
| 520 | 3300046683 | Ga0495658_0031727 | Ga0495658_0031727_1962_2861 | 299 |
| 521 | 3300046689 | Ga0495613_0218574 | Ga0495613_0218574_42_941 | 299 |
| 522 | 3300047471 | Ga0495684_0024756 | Ga0495684_0024756_1642_2541 | 299 |
| 523 | 3300048907 | Ga0496104_0428269 | Ga0496104_0428269_285_1184 | 299 |
| 524 | 3300048909 | Ga0496106_0048620 | Ga0496106_0048620_666_1565 | 299 |
| 525 | 3300048910 | Ga0496107_0109796 | Ga0496107_0109796_826_1725 | 299 |
| 526 | 3300048911 | Ga0496108_0348436 | Ga0496108_0348436_230_1129 | 299 |
| 527 | 3300048917 | Ga0496114_0156020 | Ga0496114_0156020_69_968 | 299 |
| 528 | 3300053084 | Ga0495595_0151629 | Ga0495595_0151629_139_1038 | 299 |
| 529 | 3300053085 | Ga0495619_0019088 | Ga0495619_0019088_3221_4120 | 299 |
| 530 | iso_pu_bacteria | 2643221651 | 2644291325 | 299 |
| 531 | 3300035398 | Ga0316574_0000847 | Ga0316574_0000847_8179_9084 | 300 |
| 532 | iso_pu_bacteria | 2508501128 | 2509152987 | 300 |
| 533 | iso_pu_bacteria | 2513237096 | 2513654154 | 300 |
| 534 | iso_pu_bacteria | 2513237098 | 2513674841 | 300 |
| 535 | iso_pu_bacteria | 2513237104 | 2513721226 | 300 |
| 536 | iso_pu_bacteria | 2513237137 | 2513856909 | 300 |
| 537 | iso_pu_bacteria | 2513237145 | 2513918494 | 300 |
| 538 | iso_pu_bacteria | 2517572143 | 2517891271 | 300 |
| 539 | iso_pu_bacteria | 2524023205 | 2524436213 | 300 |
| 540 | iso_pu_bacteria | 2524023210 | 2524468220 | 300 |
| 541 | iso_pu_bacteria | 2744054633 | 2745080831 | 300 |
| 542 | iso_pu_bacteria | 2791355197 | 2793066634 | 300 |
| 543 | iso_pu_bacteria | 2844315083 | 2844320094 | 300 |
| 544 | iso_pu_bacteria | 2876761206 | 2876768154 | 300 |
| 545 | iso_pu_bacteria | 2885374607 | 2885376582 | 300 |
| 546 | iso_pu_bacteria | 2903727486 | 2903730232 | 300 |
| 547 | iso_pu_bacteria | 2903748898 | 2903757683 | 300 |
| 548 | iso_pu_bacteria | 2904690495 | 2904694201 | 300 |
| 549 | iso_pu_bacteria | 2904699407 | 2904701194 | 300 |
| 550 | iso_pu_bacteria | 2906602504 | 2906609919 | 300 |
| 551 | iso_pu_bacteria | 2906610324 | 2906616455 | 300 |
| 552 | iso_pu_bacteria | 2906626472 | 2906627660 | 300 |
| 553 | iso_pu_bacteria | 2906635258 | 2906640011 | 300 |
| 554 | iso_pu_bacteria | 2906660503 | 2906662951 | 300 |
| 555 | iso_pu_bacteria | 2908739725 | 2908741609 | 300 |
| 556 | iso_pu_bacteria | 2908756301 | 2908759227 | 300 |
| 557 | iso_pu_bacteria | 2922425934 | 2922431529 | 300 |
| 558 | iso_pu_bacteria | 2935959822 | 2935962783 | 300 |
| 559 | iso_pu_bacteria | 3005474847 | 3005481323 | 300 |
| 560 | iso_pu_bacteria | 3005710791 | 3005715872 | 300 |
| 561 | iso_pu_bacteria | 3005718088 | 3005723229 | 300 |
| 562 | iso_pu_bacteria | 8006926726 | 8006930103 | 300 |
| 563 | iso_pu_bacteria | 8016583857 | 8016594428 | 300 |
| 564 | iso_pu_bacteria | 8019555841 | 8019565257 | 300 |
| 565 | iso_pu_bacteria | 8019565922 | 8019575361 | 300 |
| 566 | 3300005366 | Ga0070659_100227289 | Ga0070659_1002272892 | 301 |
| 567 | 3300005563 | Ga0068855_100215006 | Ga0068855_1002150063 | 301 |
| 568 | 3300013100 | Ga0157373_10078674 | Ga0157373_100786742 | 301 |
| 569 | 3300025909 | Ga0207705_10092128 | Ga0207705_100921281 | 301 |
| 570 | 3300025919 | Ga0207657_10004384 | Ga0207657_100043849 | 301 |
| 571 | 3300025933 | Ga0207706_10472640 | Ga0207706_104726401 | 301 |
| 572 | 3300038443 | Ga0395901_0410324 | Ga0395901_0410324_465_1376 | 301 |
| 573 | 3300045976 | Ga0466967_0377309 | Ga0466967_0377309_86_997 | 301 |
| 574 | 3300048928 | Ga0496125_0000712 | Ga0496125_0000712_18091_19071 | 301 |
| 575 | 3300053088 | Ga0500644_0003960 | Ga0500644_0003960_2452_3363 | 301 |
| 576 | 3300005331 | Ga0070670_100131214 | Ga0070670_1001312142 | 302 |
| 577 | 3300005337 | Ga0070682_100127813 | Ga0070682_1001278132 | 302 |
| 578 | 3300005347 | Ga0070668_100098454 | Ga0070668_1000984542 | 302 |
| 579 | 3300005356 | Ga0070674_100058937 | Ga0070674_1000589372 | 302 |
| 580 | 3300005456 | Ga0070678_100141068 | Ga0070678_1001410683 | 302 |
| 581 | 3300005457 | Ga0070662_100352827 | Ga0070662_1003528271 | 302 |
| 582 | 3300009093 | Ga0105240_10058231 | Ga0105240_100582314 | 302 |
| 583 | 3300025911 | Ga0207654_10049589 | Ga0207654_100495893 | 302 |
| 584 | 3300025914 | Ga0207671_10007506 | Ga0207671_100075067 | 302 |
| 585 | 3300025924 | Ga0207694_10143346 | Ga0207694_101433462 | 302 |
| 586 | 3300025925 | Ga0207650_10165995 | Ga0207650_101659952 | 302 |
| 587 | 3300025938 | Ga0207704_10031670 | Ga0207704_100316703 | 302 |
| 588 | 3300026041 | Ga0207639_10406187 | Ga0207639_104061871 | 302 |
| 589 | 3300026075 | Ga0207708_10087740 | Ga0207708_100877402 | 302 |
| 590 | 3300046523 | Ga0495644_0063291 | Ga0495644_0063291_456_1370 | 302 |
| 591 | 3300047472 | Ga0495686_0041367 | Ga0495686_0041367_1615_2532 | 302 |
| 592 | 3300048905 | Ga0496102_0132063 | Ga0496102_0132063_21_935 | 302 |
| 593 | 3300053085 | Ga0495619_0181079 | Ga0495619_0181079_141_1058 | 302 |
| 594 | iso_pu_bacteria | 2524023228 | 2524533524 | 302 |
| 595 | iso_pu_bacteria | 2667528175 | 2671123801 | 302 |
| 596 | iso_pu_bacteria | 2728368998 | 2728749968 | 302 |
| 597 | iso_pu_bacteria | 2935630451 | 2935636168 | 302 |
| 598 | iso_pu_bacteria | 2941507105 | 2941512799 | 302 |
| 599 | iso_pu_bacteria | 2941515067 | 2941520634 | 302 |
| 600 | iso_pu_bacteria | 2941523033 | 2941528648 | 302 |
| 601 | iso_pu_bacteria | 8006933436 | 8006939387 | 302 |
| 602 | iso_pu_bacteria | 8006973647 | 8006979042 | 302 |
| 603 | iso_pu_bacteria | 8056689827 | 8056690725 | 302 |
| 604 | 3300005329 | Ga0070683_100196995 | Ga0070683_1001969952 | 303 |
| 605 | 3300005455 | Ga0070663_100015643 | Ga0070663_1000156433 | 303 |
| 606 | 3300005616 | Ga0068852_100343918 | Ga0068852_1003439182 | 303 |
| 607 | 3300005618 | Ga0068864_100517715 | Ga0068864_1005177151 | 303 |
| 608 | 3300006881 | Ga0068865_100097434 | Ga0068865_1000974341 | 303 |
| 609 | 3300009098 | Ga0105245_10015073 | Ga0105245_100150731 | 303 |
| 610 | 3300009101 | Ga0105247_10087830 | Ga0105247_100878302 | 303 |
| 611 | 3300010375 | Ga0105239_10361602 | Ga0105239_103616021 | 303 |
| 612 | 3300013296 | Ga0157374_10082425 | Ga0157374_100824252 | 303 |
| 613 | 3300013306 | Ga0163162_10384563 | Ga0163162_103845632 | 303 |
| 614 | 3300013308 | Ga0157375_10570368 | Ga0157375_105703681 | 303 |
| 615 | 3300014325 | Ga0163163_10126799 | Ga0163163_101267993 | 303 |
| 616 | 3300014745 | Ga0157377_10039056 | Ga0157377_100390562 | 303 |
| 617 | 3300025900 | Ga0207710_10062762 | Ga0207710_100627622 | 303 |
| 618 | 3300025929 | Ga0207664_10291567 | Ga0207664_102915672 | 303 |
| 619 | 3300025938 | Ga0207704_10066234 | Ga0207704_100662342 | 303 |
| 620 | 3300025944 | Ga0207661_10190172 | Ga0207661_101901722 | 303 |
| 621 | 3300026067 | Ga0207678_10086017 | Ga0207678_100860173 | 303 |
| 622 | 3300026095 | Ga0207676_10158341 | Ga0207676_101583413 | 303 |
| 623 | 3300026142 | Ga0207698_10305421 | Ga0207698_103054212 | 303 |
| 624 | 3300048903 | Ga0496100_0028657 | Ga0496100_0028657_75_992 | 303 |
| 625 | 3300048904 | Ga0496101_0004214 | Ga0496101_0004214_5575_6492 | 303 |
| 626 | 3300048905 | Ga0496102_0006143 | Ga0496102_0006143_3910_4827 | 303 |
| 627 | 3300048906 | Ga0496103_0062146 | Ga0496103_0062146_584_1501 | 303 |
| 628 | 3300048908 | Ga0496105_0092877 | Ga0496105_0092877_506_1423 | 303 |
| 629 | 3300048909 | Ga0496106_0057918 | Ga0496106_0057918_1067_1984 | 303 |
| 630 | 3300048910 | Ga0496107_0002113 | Ga0496107_0002113_11320_12237 | 303 |
| 631 | 3300048911 | Ga0496108_0071294 | Ga0496108_0071294_971_1888 | 303 |
| 632 | 3300048912 | Ga0496109_0063257 | Ga0496109_0063257_2248_3165 | 303 |
| 633 | 3300048914 | Ga0496111_0033737 | Ga0496111_0033737_2216_3133 | 303 |
| 634 | 3300048916 | Ga0496113_0051531 | Ga0496113_0051531_37_954 | 303 |
| 635 | 3300048917 | Ga0496114_0075757 | Ga0496114_0075757_767_1684 | 303 |
| 636 | 3300048918 | Ga0496115_0004269 | Ga0496115_0004269_2622_3539 | 303 |
| 637 | 3300049580 | Ga0501046_0075551 | Ga0501046_0075551_976_1893 | 303 |
| 638 | iso_pu_bacteria | 3005710791 | 3005715674 | 303 |
| 639 | 3300005530 | Ga0070679_100134648 | Ga0070679_1001346482 | 304 |
| 640 | 3300005535 | Ga0070684_100037881 | Ga0070684_1000378811 | 304 |
| 641 | 3300005577 | Ga0068857_100063575 | Ga0068857_1000635752 | 304 |
| 642 | 3300005578 | Ga0068854_100033855 | Ga0068854_1000338554 | 304 |
| 643 | 3300005614 | Ga0068856_100288187 | Ga0068856_1002881872 | 304 |
| 644 | 3300005616 | Ga0068852_100004505 | Ga0068852_1000045058 | 304 |
| 645 | 3300005937 | Ga0081455_10004053 | Ga0081455_100040534 | 304 |
| 646 | 3300005981 | Ga0081538_10050154 | Ga0081538_100501542 | 304 |
| 647 | 3300006028 | Ga0070717_10009249 | Ga0070717_100092492 | 304 |
| 648 | 3300006038 | Ga0075365_10011349 | Ga0075365_100113495 | 304 |
| 649 | 3300006051 | Ga0075364_10041354 | Ga0075364_100413541 | 304 |
| 650 | 3300006177 | Ga0075362_10055660 | Ga0075362_100556601 | 304 |
| 651 | 3300006942 | Ga0099824_1006123 | Ga0099824_10061235 | 304 |
| 652 | 3300006943 | Ga0099822_1000072 | Ga0099822_10000728 | 304 |
| 653 | 3300009093 | Ga0105240_10017290 | Ga0105240_100172903 | 304 |
| 654 | 3300009098 | Ga0105245_10047099 | Ga0105245_100470994 | 304 |
| 655 | 3300009174 | Ga0105241_10016146 | Ga0105241_100161463 | 304 |
| 656 | 3300009545 | Ga0105237_10004554 | Ga0105237_100045547 | 304 |
| 657 | 3300009545 | Ga0105237_10053262 | Ga0105237_100532623 | 304 |
| 658 | 3300009551 | Ga0105238_10004463 | Ga0105238_100044639 | 304 |
| 659 | 3300009551 | Ga0105238_10028572 | Ga0105238_100285725 | 304 |
| 660 | 3300010375 | Ga0105239_10011538 | Ga0105239_100115383 | 304 |
| 661 | 3300013105 | Ga0157369_10214476 | Ga0157369_102144763 | 304 |
| 662 | 3300014968 | Ga0157379_10036695 | Ga0157379_100366951 | 304 |
| 663 | 3300025261 | Ga0209233_1003464 | Ga0209233_10034646 | 304 |
| 664 | 3300025904 | Ga0207647_10119596 | Ga0207647_101195961 | 304 |
| 665 | 3300025911 | Ga0207654_10099332 | Ga0207654_100993323 | 304 |
| 666 | 3300025913 | Ga0207695_10008824 | Ga0207695_100088247 | 304 |
| 667 | 3300025913 | Ga0207695_10124795 | Ga0207695_101247953 | 304 |
| 668 | 3300025921 | Ga0207652_10068746 | Ga0207652_100687463 | 304 |
| 669 | 3300025924 | Ga0207694_10014250 | Ga0207694_100142505 | 304 |
| 670 | 3300025924 | Ga0207694_10024599 | Ga0207694_100245993 | 304 |
| 671 | 3300025944 | Ga0207661_10088109 | Ga0207661_100881091 | 304 |
| 672 | 3300026116 | Ga0207674_10078524 | Ga0207674_100785243 | 304 |
| 673 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011152 | 304 |
| 674 | 3300027361 | Ga0209489_100012 | Ga0209489_100012152 | 304 |
| 675 | 3300027363 | Ga0209700_100019 | Ga0209700_100019152 | 304 |
| 676 | 3300031616 | Ga0307508_10000015 | Ga0307508_10000015171 | 304 |
| 677 | 3300033442 | Ga0315911_1000002 | Ga0315911_100000266 | 304 |
| 678 | 3300033544 | Ga0316215_1002146 | Ga0316215_10021462 | 304 |
| 679 | 3300037466 | Ga0395898_0105086 | Ga0395898_0105086_1564_2484 | 304 |
| 680 | 3300039450 | Ga0436363_1359162 | Ga0436363_1359162_333_1253 | 304 |
| 681 | 3300044694 | Ga0466963_0179628 | Ga0466963_0179628_13_969 | 304 |
| 682 | 3300044842 | Ga0466957_0059293 | Ga0466957_0059293_1141_2061 | 304 |
| 683 | 3300045049 | Ga0466959_0033350 | Ga0466959_0033350_603_1523 | 304 |
| 684 | 3300046524 | Ga0495648_0004316 | Ga0495648_0004316_2251_3171 | 304 |
| 685 | 3300047320 | Ga0495672_0174664 | Ga0495672_0174664_92_1012 | 304 |
| 686 | 3300048921 | Ga0496118_0119224 | Ga0496118_0119224_621_1565 | 304 |
| 687 | 3300048924 | Ga0496121_0011806 | Ga0496121_0011806_6177_7097 | 304 |
| 688 | 3300048929 | Ga0496126_0232309 | Ga0496126_0232309_524_1444 | 304 |
| 689 | 3300053094 | Ga0500566_0032348 | Ga0500566_0032348_310_1230 | 304 |
| 690 | 3300053102 | Ga0500554_000716 | Ga0500554_000716_3215_4135 | 304 |
| 691 | 3300053119 | Ga0500595_000200 | Ga0500595_000200_23980_24900 | 304 |
| 692 | 3300053119 | Ga0500595_009172 | Ga0500595_009172_158_1078 | 304 |
| 693 | 3300053139 | Ga0500568_0010968 | Ga0500568_0010968_2102_3022 | 304 |
| 694 | 3300053162 | Ga0500638_000785 | Ga0500638_000785_5325_6245 | 304 |
| 695 | 3300053178 | Ga0500637_0000144 | Ga0500637_0000144_14264_15184 | 304 |
| 696 | 3300061719 | Ga0466962_0065872 | Ga0466962_0065872_73_993 | 304 |
| 697 | 3300005434 | Ga0070709_10039448 | Ga0070709_100394481 | 305 |
| 698 | 3300005435 | Ga0070714_100007489 | Ga0070714_1000074892 | 305 |
| 699 | 3300005436 | Ga0070713_100001931 | Ga0070713_1000019314 | 305 |
| 700 | 3300005437 | Ga0070710_10000550 | Ga0070710_1000055011 | 305 |
| 701 | 3300005439 | Ga0070711_100239395 | Ga0070711_1002393951 | 305 |
| 702 | 3300005548 | Ga0070665_100028020 | Ga0070665_1000280205 | 305 |
| 703 | 3300006028 | Ga0070717_10010145 | Ga0070717_100101451 | 305 |
| 704 | 3300006163 | Ga0070715_10000126 | Ga0070715_1000012613 | 305 |
| 705 | 3300006173 | Ga0070716_100005825 | Ga0070716_1000058253 | 305 |
| 706 | 3300006175 | Ga0070712_100012143 | Ga0070712_1000121433 | 305 |
| 707 | 3300010159 | Ga0099796_10083171 | Ga0099796_100831711 | 305 |
| 708 | 3300014968 | Ga0157379_10528526 | Ga0157379_105285261 | 305 |
| 709 | 3300025898 | Ga0207692_10014334 | Ga0207692_100143342 | 305 |
| 710 | 3300025905 | Ga0207685_10108092 | Ga0207685_101080921 | 305 |
| 711 | 3300025906 | Ga0207699_10049577 | Ga0207699_100495773 | 305 |
| 712 | 3300025915 | Ga0207693_10000683 | Ga0207693_1000068318 | 305 |
| 713 | 3300025916 | Ga0207663_10001947 | Ga0207663_100019474 | 305 |
| 714 | 3300025939 | Ga0207665_10000339 | Ga0207665_1000033910 | 305 |
| 715 | 3300031712 | Ga0265342_10007168 | Ga0265342_100071681 | 305 |
| 716 | 3300032002 | Ga0307416_100002779 | Ga0307416_1000027797 | 305 |
| 717 | 3300032126 | Ga0307415_100104199 | Ga0307415_1001041992 | 305 |
| 718 | 3300035117 | Ga0373953_0035797 | Ga0373953_0035797_723_1646 | 305 |
| 719 | 3300035120 | Ga0373957_0013071 | Ga0373957_0013071_797_1720 | 305 |
| 720 | 3300035410 | Ga0373924_0033008 | Ga0373924_0033008_938_1861 | 305 |
| 721 | 3300035691 | Ga0373931_0132514 | Ga0373931_0132514_474_1397 | 305 |
| 722 | 3300036401 | Ga0373937_0100979 | Ga0373937_0100979_1057_1980 | 305 |
| 723 | 3300037068 | Ga0373925_0022318 | Ga0373925_0022318_1626_2549 | 305 |
| 724 | 3300037853 | Ga0436364_1074833 | Ga0436364_1074833_3219_4148 | 305 |
| 725 | 3300044656 | Ga0466969_0042525 | Ga0466969_0042525_1117_2055 | 305 |
| 726 | 3300044684 | Ga0466966_0061017 | Ga0466966_0061017_573_1532 | 305 |
| 727 | 3300046462 | Ga0495651_0100648 | Ga0495651_0100648_187_1110 | 305 |
| 728 | 3300046514 | Ga0495618_0057476 | Ga0495618_0057476_1323_2246 | 305 |
| 729 | 3300046516 | Ga0495628_0235997 | Ga0495628_0235997_77_1000 | 305 |
| 730 | 3300046517 | Ga0495630_0052973 | Ga0495630_0052973_1847_2770 | 305 |
| 731 | 3300046533 | Ga0495640_0135972 | Ga0495640_0135972_609_1532 | 305 |
| 732 | 3300046536 | Ga0495587_0051821 | Ga0495587_0051821_119_1042 | 305 |
| 733 | 3300046543 | Ga0495645_0041434 | Ga0495645_0041434_1713_2636 | 305 |
| 734 | 3300046557 | Ga0495622_0127491 | Ga0495622_0127491_192_1115 | 305 |
| 735 | 3300046559 | Ga0495667_0031460 | Ga0495667_0031460_781_1704 | 305 |
| 736 | 3300046680 | Ga0495646_0053536 | Ga0495646_0053536_49_972 | 305 |
| 737 | 3300046809 | Ga0495600_0256848 | Ga0495600_0256848_119_1042 | 305 |
| 738 | 3300047319 | Ga0495674_0036465 | Ga0495674_0036465_1702_2625 | 305 |
| 739 | 3300048904 | Ga0496101_0058748 | Ga0496101_0058748_721_1644 | 305 |
| 740 | 3300048904 | Ga0496101_0061665 | Ga0496101_0061665_715_1638 | 305 |
| 741 | 3300048905 | Ga0496102_0072396 | Ga0496102_0072396_443_1366 | 305 |
| 742 | 3300048905 | Ga0496102_0097001 | Ga0496102_0097001_223_1146 | 305 |
| 743 | 3300048907 | Ga0496104_0018203 | Ga0496104_0018203_3616_4539 | 305 |
| 744 | 3300048909 | Ga0496106_0050208 | Ga0496106_0050208_296_1219 | 305 |
| 745 | 3300048910 | Ga0496107_0007328 | Ga0496107_0007328_4692_5615 | 305 |
| 746 | 3300048910 | Ga0496107_0046023 | Ga0496107_0046023_868_1791 | 305 |
| 747 | 3300048911 | Ga0496108_0447246 | Ga0496108_0447246_31_954 | 305 |
| 748 | 3300048912 | Ga0496109_0438307 | Ga0496109_0438307_234_1157 | 305 |
| 749 | 3300048913 | Ga0496110_0205416 | Ga0496110_0205416_172_1095 | 305 |
| 750 | 3300048915 | Ga0496112_0018080 | Ga0496112_0018080_1340_2263 | 305 |
| 751 | 3300048915 | Ga0496112_0139350 | Ga0496112_0139350_1210_2133 | 305 |
| 752 | 3300048917 | Ga0496114_0072007 | Ga0496114_0072007_227_1150 | 305 |
| 753 | 3300048918 | Ga0496115_0067760 | Ga0496115_0067760_694_1617 | 305 |
| 754 | 3300048918 | Ga0496115_0255204 | Ga0496115_0255204_60_983 | 305 |
| 755 | 3300048918 | Ga0496115_0321083 | Ga0496115_0321083_263_1186 | 305 |
| 756 | 3300048929 | Ga0496126_0032037 | Ga0496126_0032037_1495_2418 | 305 |
| 757 | 3300048929 | Ga0496126_0070101 | Ga0496126_0070101_1303_2226 | 305 |
| 758 | 3300048929 | Ga0496126_0208115 | Ga0496126_0208115_622_1545 | 305 |
| 759 | iso_pu_bacteria | 8016511872 | 8016520582 | 305 |
| 760 | 3300009551 | Ga0105238_10104419 | Ga0105238_101044193 | 306 |
| 761 | 3300005434 | Ga0070709_10013391 | Ga0070709_100133911 | 307 |
| 762 | 3300005435 | Ga0070714_100022201 | Ga0070714_1000222016 | 307 |
| 763 | 3300005437 | Ga0070710_10011800 | Ga0070710_100118003 | 307 |
| 764 | 3300005439 | Ga0070711_100073365 | Ga0070711_1000733651 | 307 |
| 765 | 3300006028 | Ga0070717_10044803 | Ga0070717_100448033 | 307 |
| 766 | 3300025898 | Ga0207692_10008557 | Ga0207692_100085573 | 307 |
| 767 | 3300025906 | Ga0207699_10014226 | Ga0207699_100142261 | 307 |
| 768 | 3300025916 | Ga0207663_10042784 | Ga0207663_100427841 | 307 |
| 769 | 3300046462 | Ga0495651_0098201 | Ga0495651_0098201_127_1173 | 307 |
| 770 | iso_pu_bacteria | 3005594810 | 3005600380 | 307 |
| 771 | iso_pu_bacteria | 8056967851 | 8056975000 | 307 |
| 772 | 3300053725 | Ga0500576_028192 | Ga0500576_028192_1317_2372 | 308 |
| 773 | 3300003203 | JGI25406J46586_10000223 | JGI25406J46586_100002234 | 311 |
| 774 | 3300005985 | Ga0081539_10000325 | Ga0081539_1000032565 | 311 |
| 775 | 3300035695 | Ga0373927_0044698 | Ga0373927_0044698_74_1183 | 311 |
| 776 | 3300035725 | Ga0373947_0007716 | Ga0373947_0007716_22_1131 | 311 |
| 777 | 3300046455 | Ga0495603_0028282 | Ga0495603_0028282_900_2009 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ie6-assembly2.cif.gz_C-2 | crystal structure of a lactonase mutant in complex with substrate b | 0.9515 | 111 | 154 |
| 6eb3-assembly3.cif.gz_C | structural and enzymatic characterization of an esterase from a metagenomic library | 0.8825 | 16 | 309 |
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.8761 | 14 | 157 |
| 6eb3-assembly3.cif.gz_C | structural and enzymatic characterization of an esterase from a metagenomic library | 0.8761 | 16 | 309 |
| 6eb3-assembly1.cif.gz_A | structural and enzymatic characterization of an esterase from a metagenomic library | 0.8746 | 16 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96935_7_300_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9479 | 18 | 307 | 3.40.50.1820 |
| af_Q4CQ95_18_306_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9455 | 23 | 304 | 3.40.50.1820 |
| af_A4HXH8_39_324_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9432 | 23 | 299 | 3.40.50.1820 |
| af_P96935_7_300_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9322 | 18 | 307 | 3.40.50.1820 |
| af_A4I3N6_52_340_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9233 | 23 | 303 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431JT55-F1-model_v4 | Alpha/beta hydrolase | 0.9714 | 10 | 304 |
GO:0004806
GO:0046503 |
| AF-A0A3S0BND3-F1-model_v4 | Alpha/beta fold hydrolase | 0.9677 | 13 | 286 |
GO:0004806
GO:0046503 |
| AF-A0A1G0IAP8-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.96 | 14 | 310 |
GO:0004806
GO:0046503 |
| AF-A0A431JT55-F1-model_v4 | Alpha/beta hydrolase | 0.9586 | 10 | 304 |
GO:0004806
GO:0046503 |
| AF-A0A7I8MJP8-F1-model_v4 | Carboxyl esterase, a/b hydrolase | 0.956 | 16 | 307 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar