F480370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 777 | 262 | 1554 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300025938|Ga0207704_10238533|Ga0207704_102385332 |
| Length | 280 |
| Sequence | MKTACRIDDPVIFFEHKGLYRQVFSKAFEPDADYLIPFGKAKIVQPGSDMTAITWGSGVVRCQRAAAELEKEGFSLTGQQTGKGALELCRQVRPDLVLLDIMLPDSDGLDICKAIRKDSDLAATPIIFLTARASETDRIVGLELGANDYVVKPFFVRELIARIKLQFRNQATPTRVLEAGGVELDRTSCQVRVNGTPLALTATEFRLLEYLMNRPGVVFSREQLLNAVWGQDRAITDRAVDVYVLRLRQKVEQDPAAPVLIHSVRGFGYTFEPRRSMAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 93.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207704_10238533 | 3300025938 | Bacteria | 1357 |
| 2 | Ga0070658_10003050 | 3300005327 | Bacteria | 13842 |
| 3 | Ga0070658_10052271 | 3300005327 | Bacteria | 3313 |
| 4 | Ga0070658_10077773 | 3300005327 | Bacteria | 2722 |
| 5 | Ga0070658_10312031 | 3300005327 | Bacteria | 1342 |
| 6 | Ga0070683_100000012 | 3300005329 | Bacteria | 274646 |
| 7 | Ga0070683_100006580 | 3300005329 | Bacteria | 9758 |
| 8 | Ga0070683_100011594 | 3300005329 | Bacteria | 7627 |
| 9 | Ga0070683_100016852 | 3300005329 | Bacteria | 6446 |
| 10 | Ga0070683_100108824 | 3300005329 | Bacteria | 2614 |
| 11 | Ga0070683_100128534 | 3300005329 | Bacteria | 2396 |
| 12 | Ga0070683_100183635 | 3300005329 | Bacteria | 1985 |
| 13 | Ga0070683_100186885 | 3300005329 | Unclassified | 1967 |
| 14 | Ga0070670_100325653 | 3300005331 | Bacteria | 1347 |
| 15 | Ga0070670_100929985 | 3300005331 | Bacteria | 789 |
| 16 | Ga0068869_100014026 | 3300005334 | Bacteria | 5346 |
| 17 | Ga0068869_100732568 | 3300005334 | Bacteria | 845 |
| 18 | Ga0070666_10034480 | 3300005335 | Bacteria | 3354 |
| 19 | Ga0070666_10441382 | 3300005335 | Unclassified | 939 |
| 20 | Ga0070680_100008281 | 3300005336 | Bacteria | 7955 |
| 21 | Ga0068868_100000918 | 3300005338 | Bacteria | 20048 |
| 22 | Ga0068868_100540736 | 3300005338 | Bacteria | 1025 |
| 23 | Ga0068868_100867901 | 3300005338 | Bacteria | 818 |
| 24 | Ga0070660_100002216 | 3300005339 | Bacteria | 13396 |
| 25 | Ga0070660_100032476 | 3300005339 | Bacteria | 3928 |
| 26 | Ga0070660_100093708 | 3300005339 | Bacteria | 2372 |
| 27 | Ga0070660_100191032 | 3300005339 | Bacteria | 1659 |
| 28 | Ga0070689_100314089 | 3300005340 | Bacteria | 1307 |
| 29 | Ga0070689_100373817 | 3300005340 | Bacteria | 1200 |
| 30 | Ga0070691_10008384 | 3300005341 | Bacteria | 4732 |
| 31 | Ga0070661_100093778 | 3300005344 | Bacteria | 2224 |
| 32 | Ga0070661_100149419 | 3300005344 | Bacteria | 1765 |
| 33 | Ga0070675_100784804 | 3300005354 | Bacteria | 870 |
| 34 | Ga0070671_100072096 | 3300005355 | Bacteria | 2884 |
| 35 | Ga0070671_100212452 | 3300005355 | Bacteria | 1641 |
| 36 | Ga0070671_100260046 | 3300005355 | Bacteria | 1475 |
| 37 | Ga0070673_100045074 | 3300005364 | Bacteria | 3418 |
| 38 | Ga0070673_100106905 | 3300005364 | Bacteria | 2314 |
| 39 | Ga0070659_100091186 | 3300005366 | Bacteria | 2443 |
| 40 | Ga0070667_100147411 | 3300005367 | Bacteria | 2065 |
| 41 | Ga0070667_100260852 | 3300005367 | Bacteria | 1552 |
| 42 | Ga0070709_10305444 | 3300005434 | Unclassified | 1163 |
| 43 | Ga0070714_100000378 | 3300005435 | Bacteria | 33231 |
| 44 | Ga0070713_100003417 | 3300005436 | Bacteria | 10492 |
| 45 | Ga0070713_100013803 | 3300005436 | Bacteria | 5977 |
| 46 | Ga0070713_100020429 | 3300005436 | Bacteria | 5078 |
| 47 | Ga0070713_100075270 | 3300005436 | Bacteria | 2863 |
| 48 | Ga0070713_100548079 | 3300005436 | Bacteria | 1095 |
| 49 | Ga0070713_100995284 | 3300005436 | Bacteria | 809 |
| 50 | Ga0070711_100175988 | 3300005439 | Bacteria | 1635 |
| 51 | Ga0070705_100782611 | 3300005440 | Bacteria | 757 |
| 52 | Ga0070663_100025862 | 3300005455 | Bacteria | 3968 |
| 53 | Ga0070663_100404711 | 3300005455 | Bacteria | 1116 |
| 54 | Ga0070678_100288939 | 3300005456 | Bacteria | 1389 |
| 55 | Ga0070678_100402632 | 3300005456 | Unclassified | 1189 |
| 56 | Ga0070662_100546430 | 3300005457 | Bacteria | 970 |
| 57 | Ga0070681_10003147 | 3300005458 | Bacteria | 15338 |
| 58 | Ga0070681_10008764 | 3300005458 | Bacteria | 9927 |
| 59 | Ga0070681_10010237 | 3300005458 | Bacteria | 9252 |
| 60 | Ga0070681_10029433 | 3300005458 | Bacteria | 5515 |
| 61 | Ga0070681_10073280 | 3300005458 | Bacteria | 3386 |
| 62 | Ga0068867_100029691 | 3300005459 | Bacteria | 3940 |
| 63 | Ga0068867_100507319 | 3300005459 | Bacteria | 1038 |
| 64 | Ga0068867_100576460 | 3300005459 | Bacteria | 978 |
| 65 | Ga0070685_10396002 | 3300005466 | Unclassified | 955 |
| 66 | Ga0070706_100873754 | 3300005467 | Unclassified | 831 |
| 67 | Ga0070707_100235015 | 3300005468 | Unclassified | 1784 |
| 68 | Ga0070699_100603244 | 3300005518 | Bacteria | 1001 |
| 69 | Ga0070679_100003335 | 3300005530 | Bacteria | 14706 |
| 70 | Ga0070679_100340249 | 3300005530 | Unclassified | 1448 |
| 71 | Ga0070679_100551890 | 3300005530 | Bacteria | 1096 |
| 72 | Ga0070684_100000013 | 3300005535 | Bacteria | 167281 |
| 73 | Ga0070684_100000798 | 3300005535 | Bacteria | 21897 |
| 74 | Ga0070684_100040738 | 3300005535 | Bacteria | 4001 |
| 75 | Ga0070684_100041379 | 3300005535 | Bacteria | 3972 |
| 76 | Ga0070684_100050302 | 3300005535 | Bacteria | 3620 |
| 77 | Ga0070684_100050622 | 3300005535 | Bacteria | 3609 |
| 78 | Ga0070684_100065843 | 3300005535 | Bacteria | 3181 |
| 79 | Ga0070684_100277510 | 3300005535 | Bacteria | 1535 |
| 80 | Ga0070684_100479517 | 3300005535 | Bacteria | 1151 |
| 81 | Ga0070697_100718397 | 3300005536 | Unclassified | 882 |
| 82 | Ga0068853_100041797 | 3300005539 | Bacteria | 3918 |
| 83 | Ga0068853_100125613 | 3300005539 | Bacteria | 2291 |
| 84 | Ga0068853_100154039 | 3300005539 | Bacteria | 2070 |
| 85 | Ga0068853_100180857 | 3300005539 | Bacteria | 1912 |
| 86 | Ga0068853_100541481 | 3300005539 | Bacteria | 1102 |
| 87 | Ga0070672_100372514 | 3300005543 | Bacteria | 1220 |
| 88 | Ga0070686_100514150 | 3300005544 | Unclassified | 931 |
| 89 | Ga0070693_100030587 | 3300005547 | Bacteria | 2944 |
| 90 | Ga0070665_100077345 | 3300005548 | Bacteria | 3334 |
| 91 | Ga0070665_100219259 | 3300005548 | Bacteria | 1903 |
| 92 | Ga0070665_100321073 | 3300005548 | Bacteria | 1553 |
| 93 | Ga0070665_100566774 | 3300005548 | Bacteria | 1148 |
| 94 | Ga0070665_100575896 | 3300005548 | Bacteria | 1139 |
| 95 | Ga0070704_100242619 | 3300005549 | Bacteria | 1475 |
| 96 | Ga0068855_100000760 | 3300005563 | Bacteria | 39704 |
| 97 | Ga0068855_100007656 | 3300005563 | Bacteria | 13064 |
| 98 | Ga0068855_100059243 | 3300005563 | Bacteria | 4481 |
| 99 | Ga0068855_100064244 | 3300005563 | Bacteria | 4280 |
| 100 | Ga0068855_100086265 | 3300005563 | Bacteria | 3630 |
| 101 | Ga0068855_100200127 | 3300005563 | Bacteria | 2249 |
| 102 | Ga0068855_100226839 | 3300005563 | Bacteria | 2093 |
| 103 | Ga0068855_100334026 | 3300005563 | Bacteria | 1672 |
| 104 | Ga0068855_100350257 | 3300005563 | Bacteria | 1627 |
| 105 | Ga0068855_100499736 | 3300005563 | Bacteria | 1322 |
| 106 | Ga0070664_100013849 | 3300005564 | Bacteria | 6575 |
| 107 | Ga0070664_100203105 | 3300005564 | Bacteria | 1769 |
| 108 | Ga0070664_100544118 | 3300005564 | Bacteria | 1073 |
| 109 | Ga0070664_100718846 | 3300005564 | Bacteria | 931 |
| 110 | Ga0068857_100002143 | 3300005577 | Bacteria | 16043 |
| 111 | Ga0068857_100019037 | 3300005577 | Bacteria | 6024 |
| 112 | Ga0068857_100283092 | 3300005577 | Bacteria | 1525 |
| 113 | Ga0068854_100588802 | 3300005578 | Bacteria | 948 |
| 114 | Ga0068856_100002863 | 3300005614 | Bacteria | 17656 |
| 115 | Ga0068856_100005385 | 3300005614 | Bacteria | 12615 |
| 116 | Ga0068856_100006645 | 3300005614 | Bacteria | 11333 |
| 117 | Ga0068856_100010449 | 3300005614 | Bacteria | 9010 |
| 118 | Ga0068856_100015815 | 3300005614 | Bacteria | 7296 |
| 119 | Ga0068856_100057188 | 3300005614 | Bacteria | 3850 |
| 120 | Ga0068856_100093089 | 3300005614 | Bacteria | 2999 |
| 121 | Ga0068856_100181217 | 3300005614 | Bacteria | 2119 |
| 122 | Ga0068856_100302890 | 3300005614 | Bacteria | 1616 |
| 123 | Ga0070702_100114356 | 3300005615 | Bacteria | 1679 |
| 124 | Ga0068852_100016955 | 3300005616 | Bacteria | 5699 |
| 125 | Ga0068852_100158266 | 3300005616 | Bacteria | 2112 |
| 126 | Ga0068852_100247987 | 3300005616 | Bacteria | 1705 |
| 127 | Ga0068859_100030378 | 3300005617 | Bacteria | 5422 |
| 128 | Ga0068859_100138127 | 3300005617 | Bacteria | 2511 |
| 129 | Ga0068859_100157977 | 3300005617 | Bacteria | 2346 |
| 130 | Ga0068859_100268856 | 3300005617 | Bacteria | 1797 |
| 131 | Ga0068859_100312974 | 3300005617 | Bacteria | 1664 |
| 132 | Ga0068859_100824024 | 3300005617 | Bacteria | 1015 |
| 133 | Ga0068864_100010367 | 3300005618 | Bacteria | 7696 |
| 134 | Ga0068864_100371938 | 3300005618 | Bacteria | 1353 |
| 135 | Ga0068864_100456304 | 3300005618 | Bacteria | 1223 |
| 136 | Ga0068864_101112746 | 3300005618 | Bacteria | 786 |
| 137 | Ga0068861_100265741 | 3300005719 | Bacteria | 1471 |
| 138 | Ga0068861_100453251 | 3300005719 | Bacteria | 1150 |
| 139 | Ga0068851_10187583 | 3300005834 | Bacteria | 1148 |
| 140 | Ga0068870_10022050 | 3300005840 | Bacteria | 3125 |
| 141 | Ga0068863_100010818 | 3300005841 | Bacteria | 8846 |
| 142 | Ga0068863_100053554 | 3300005841 | Unclassified | 3825 |
| 143 | Ga0068863_100068704 | 3300005841 | Bacteria | 3351 |
| 144 | Ga0068863_100164816 | 3300005841 | Bacteria | 2125 |
| 145 | Ga0068863_100663243 | 3300005841 | Bacteria | 1035 |
| 146 | Ga0068858_100007268 | 3300005842 | Bacteria | 10731 |
| 147 | Ga0068858_100013273 | 3300005842 | Bacteria | 7765 |
| 148 | Ga0068858_100015721 | 3300005842 | Bacteria | 7117 |
| 149 | Ga0068858_100418804 | 3300005842 | Bacteria | 1288 |
| 150 | Ga0068858_100578951 | 3300005842 | Bacteria | 1088 |
| 151 | Ga0068858_100701717 | 3300005842 | Bacteria | 985 |
| 152 | Ga0068860_100005291 | 3300005843 | Bacteria | 13097 |
| 153 | Ga0068860_100032249 | 3300005843 | Bacteria | 5035 |
| 154 | Ga0068860_100237595 | 3300005843 | Bacteria | 1772 |
| 155 | Ga0068860_100611894 | 3300005843 | Bacteria | 1095 |
| 156 | Ga0068860_100851443 | 3300005843 | Bacteria | 926 |
| 157 | Ga0068860_101058773 | 3300005843 | Bacteria | 830 |
| 158 | Ga0081455_10122137 | 3300005937 | Bacteria | 2051 |
| 159 | Ga0070717_10008660 | 3300006028 | Bacteria | 7608 |
| 160 | Ga0070717_10010881 | 3300006028 | Bacteria | 6888 |
| 161 | Ga0070717_10173728 | 3300006028 | Bacteria | 1875 |
| 162 | Ga0097621_100017283 | 3300006237 | Bacteria | 5474 |
| 163 | Ga0097621_100037371 | 3300006237 | Bacteria | 3890 |
| 164 | Ga0097621_100038178 | 3300006237 | Bacteria | 3853 |
| 165 | Ga0097621_100063374 | 3300006237 | Bacteria | 3038 |
| 166 | Ga0097621_100241388 | 3300006237 | Bacteria | 1579 |
| 167 | Ga0068871_100015277 | 3300006358 | Bacteria | 5742 |
| 168 | Ga0068871_100022629 | 3300006358 | Bacteria | 4849 |
| 169 | Ga0068871_100034378 | 3300006358 | Bacteria | 4022 |
| 170 | Ga0068871_100041480 | 3300006358 | Bacteria | 3691 |
| 171 | Ga0068871_100097722 | 3300006358 | Bacteria | 2455 |
| 172 | Ga0068871_100563266 | 3300006358 | Bacteria | 1033 |
| 173 | Ga0075430_100163260 | 3300006846 | Bacteria | 1854 |
| 174 | Ga0075430_100530432 | 3300006846 | Bacteria | 971 |
| 175 | Ga0075431_100002412 | 3300006847 | Bacteria | 17990 |
| 176 | Ga0075434_101015522 | 3300006871 | Bacteria | 843 |
| 177 | Ga0068865_100633133 | 3300006881 | Bacteria | 907 |
| 178 | Ga0075436_100640084 | 3300006914 | Bacteria | 785 |
| 179 | Ga0097620_100030378 | 3300006931 | Bacteria | 5422 |
| 180 | Ga0097620_100138134 | 3300006931 | Bacteria | 2511 |
| 181 | Ga0097620_100157975 | 3300006931 | Bacteria | 2346 |
| 182 | Ga0097620_100268857 | 3300006931 | Bacteria | 1797 |
| 183 | Ga0097620_100312937 | 3300006931 | Bacteria | 1664 |
| 184 | Ga0097620_100824004 | 3300006931 | Bacteria | 1015 |
| 185 | Ga0105240_10000476 | 3300009093 | Bacteria | 74156 |
| 186 | Ga0105240_10000512 | 3300009093 | Bacteria | 71437 |
| 187 | Ga0105240_10001614 | 3300009093 | Bacteria | 38227 |
| 188 | Ga0105240_10003078 | 3300009093 | Bacteria | 26206 |
| 189 | Ga0105240_10008448 | 3300009093 | Bacteria | 14727 |
| 190 | Ga0105240_10018269 | 3300009093 | Bacteria | 9425 |
| 191 | Ga0105240_10062337 | 3300009093 | Bacteria | 4642 |
| 192 | Ga0105240_10099047 | 3300009093 | Bacteria | 3549 |
| 193 | Ga0105240_10366124 | 3300009093 | Bacteria | 1631 |
| 194 | Ga0105240_10562935 | 3300009093 | Bacteria | 1259 |
| 195 | Ga0105240_10688927 | 3300009093 | Unclassified | 1117 |
| 196 | Ga0105245_10002187 | 3300009098 | Bacteria | 17718 |
| 197 | Ga0105245_10011779 | 3300009098 | Bacteria | 7607 |
| 198 | Ga0105245_10022089 | 3300009098 | Bacteria | 5586 |
| 199 | Ga0105245_10035591 | 3300009098 | Bacteria | 4419 |
| 200 | Ga0105245_10174062 | 3300009098 | Bacteria | 2052 |
| 201 | Ga0105245_10321698 | 3300009098 | Bacteria | 1524 |
| 202 | Ga0105245_10323290 | 3300009098 | Bacteria | 1520 |
| 203 | Ga0105245_10347799 | 3300009098 | Bacteria | 1468 |
| 204 | Ga0105245_10876159 | 3300009098 | Bacteria | 939 |
| 205 | Ga0114129_10194240 | 3300009147 | Bacteria | 2754 |
| 206 | Ga0114129_10210433 | 3300009147 | Bacteria | 2629 |
| 207 | Ga0114129_10431588 | 3300009147 | Bacteria | 1731 |
| 208 | Ga0105243_10077240 | 3300009148 | Bacteria | 2708 |
| 209 | Ga0105243_10243613 | 3300009148 | Bacteria | 1601 |
| 210 | Ga0105243_10335735 | 3300009148 | Bacteria | 1382 |
| 211 | Ga0105241_10007601 | 3300009174 | Bacteria | 7967 |
| 212 | Ga0105241_10034600 | 3300009174 | Bacteria | 3796 |
| 213 | Ga0105241_10049504 | 3300009174 | Bacteria | 3200 |
| 214 | Ga0105241_10082823 | 3300009174 | Bacteria | 2516 |
| 215 | Ga0105241_10108042 | 3300009174 | Unclassified | 2223 |
| 216 | Ga0105241_10485730 | 3300009174 | Bacteria | 1099 |
| 217 | Ga0105241_10577524 | 3300009174 | Bacteria | 1013 |
| 218 | Ga0105241_10639889 | 3300009174 | Bacteria | 965 |
| 219 | Ga0105242_10042634 | 3300009176 | Bacteria | 3666 |
| 220 | Ga0105242_10066424 | 3300009176 | Bacteria | 2978 |
| 221 | Ga0105242_10108998 | 3300009176 | Bacteria | 2357 |
| 222 | Ga0105242_10229241 | 3300009176 | Bacteria | 1664 |
| 223 | Ga0105242_10272179 | 3300009176 | Bacteria | 1535 |
| 224 | Ga0105242_10553733 | 3300009176 | Bacteria | 1103 |
| 225 | Ga0105242_11043679 | 3300009176 | Bacteria | 828 |
| 226 | Ga0105248_10001968 | 3300009177 | Bacteria | 22832 |
| 227 | Ga0105248_10066936 | 3300009177 | Bacteria | 4033 |
| 228 | Ga0105248_10095912 | 3300009177 | Bacteria | 3340 |
| 229 | Ga0105248_10096222 | 3300009177 | Bacteria | 3335 |
| 230 | Ga0105248_10157781 | 3300009177 | Bacteria | 2560 |
| 231 | Ga0105248_10188377 | 3300009177 | Bacteria | 2324 |
| 232 | Ga0105248_10289909 | 3300009177 | Bacteria | 1843 |
| 233 | Ga0105248_10475372 | 3300009177 | Bacteria | 1409 |
| 234 | Ga0105248_10960661 | 3300009177 | Bacteria | 965 |
| 235 | Ga0105237_10006588 | 3300009545 | Bacteria | 12842 |
| 236 | Ga0105237_10009023 | 3300009545 | Bacteria | 10718 |
| 237 | Ga0105237_10017112 | 3300009545 | Bacteria | 7521 |
| 238 | Ga0105237_10070242 | 3300009545 | Unclassified | 3497 |
| 239 | Ga0105237_10102791 | 3300009545 | Bacteria | 2849 |
| 240 | Ga0105237_10208888 | 3300009545 | Bacteria | 1952 |
| 241 | Ga0105238_10003611 | 3300009551 | Bacteria | 15420 |
| 242 | Ga0105238_10012355 | 3300009551 | Bacteria | 8612 |
| 243 | Ga0105238_10026467 | 3300009551 | Bacteria | 5915 |
| 244 | Ga0105238_10028609 | 3300009551 | Bacteria | 5677 |
| 245 | Ga0105238_10073675 | 3300009551 | Bacteria | 3409 |
| 246 | Ga0105238_10086841 | 3300009551 | Bacteria | 3115 |
| 247 | Ga0105238_10106070 | 3300009551 | Bacteria | 2791 |
| 248 | Ga0105238_10166627 | 3300009551 | Bacteria | 2179 |
| 249 | Ga0105238_10281745 | 3300009551 | Archaea | 1644 |
| 250 | Ga0105238_10314746 | 3300009551 | Bacteria | 1550 |
| 251 | Ga0105238_10919136 | 3300009551 | Bacteria | 894 |
| 252 | Ga0105249_10001753 | 3300009553 | Bacteria | 18934 |
| 253 | Ga0105249_10495533 | 3300009553 | Bacteria | 1266 |
| 254 | Ga0105239_10002634 | 3300010375 | Bacteria | 22663 |
| 255 | Ga0105239_10025951 | 3300010375 | Bacteria | 6451 |
| 256 | Ga0105239_10037788 | 3300010375 | Bacteria | 5291 |
| 257 | Ga0105239_10046911 | 3300010375 | Bacteria | 4733 |
| 258 | Ga0105239_10051089 | 3300010375 | Bacteria | 4532 |
| 259 | Ga0105239_10173195 | 3300010375 | Bacteria | 2414 |
| 260 | Ga0105246_10001571 | 3300011119 | Bacteria | 13590 |
| 261 | Ga0105246_10154138 | 3300011119 | Bacteria | 1743 |
| 262 | Ga0157373_10059785 | 3300013100 | Bacteria | 2701 |
| 263 | Ga0157371_10229850 | 3300013102 | Bacteria | 1333 |
| 264 | Ga0157370_10001831 | 3300013104 | Bacteria | 26198 |
| 265 | Ga0157370_10004896 | 3300013104 | Bacteria | 15181 |
| 266 | Ga0157370_10005817 | 3300013104 | Bacteria | 13780 |
| 267 | Ga0157370_10091472 | 3300013104 | Bacteria | 2856 |
| 268 | Ga0157370_10135439 | 3300013104 | Bacteria | 2296 |
| 269 | Ga0157370_10160037 | 3300013104 | Bacteria | 2095 |
| 270 | Ga0157370_10283691 | 3300013104 | Bacteria | 1530 |
| 271 | Ga0157370_10297507 | 3300013104 | Bacteria | 1490 |
| 272 | Ga0157370_10377990 | 3300013104 | Bacteria | 1305 |
| 273 | Ga0157369_10003873 | 3300013105 | Bacteria | 17770 |
| 274 | Ga0157369_10007349 | 3300013105 | Bacteria | 12682 |
| 275 | Ga0157369_10009823 | 3300013105 | Bacteria | 10941 |
| 276 | Ga0157369_10025125 | 3300013105 | Bacteria | 6616 |
| 277 | Ga0157369_10034096 | 3300013105 | Bacteria | 5589 |
| 278 | Ga0157369_10042767 | 3300013105 | Bacteria | 4942 |
| 279 | Ga0157369_10078538 | 3300013105 | Bacteria | 3536 |
| 280 | Ga0157369_10125532 | 3300013105 | Bacteria | 2721 |
| 281 | Ga0157369_10153670 | 3300013105 | Bacteria | 2432 |
| 282 | Ga0157369_10300077 | 3300013105 | Bacteria | 1671 |
| 283 | Ga0157374_10003874 | 3300013296 | Bacteria | 12561 |
| 284 | Ga0157374_10006595 | 3300013296 | Bacteria | 9858 |
| 285 | Ga0157374_10011399 | 3300013296 | Bacteria | 7694 |
| 286 | Ga0157374_10089598 | 3300013296 | Bacteria | 2931 |
| 287 | Ga0157374_10108030 | 3300013296 | Bacteria | 2674 |
| 288 | Ga0157378_10003385 | 3300013297 | Bacteria | 14178 |
| 289 | Ga0157378_10007415 | 3300013297 | Bacteria | 9583 |
| 290 | Ga0157378_10283291 | 3300013297 | Bacteria | 1598 |
| 291 | Ga0163162_10003341 | 3300013306 | Bacteria | 15350 |
| 292 | Ga0163162_10573125 | 3300013306 | Bacteria | 1256 |
| 293 | Ga0157372_10032266 | 3300013307 | Bacteria | 5741 |
| 294 | Ga0157372_10115508 | 3300013307 | Bacteria | 3077 |
| 295 | Ga0157372_10150478 | 3300013307 | Bacteria | 2686 |
| 296 | Ga0157375_10027355 | 3300013308 | Bacteria | 5330 |
| 297 | Ga0157375_10251121 | 3300013308 | Bacteria | 1929 |
| 298 | Ga0157375_10345711 | 3300013308 | Bacteria | 1653 |
| 299 | Ga0157375_10449537 | 3300013308 | Bacteria | 1454 |
| 300 | Ga0157375_10522831 | 3300013308 | Bacteria | 1350 |
| 301 | Ga0157375_10545546 | 3300013308 | Bacteria | 1321 |
| 302 | Ga0157375_10550471 | 3300013308 | Bacteria | 1315 |
| 303 | Ga0163163_10002245 | 3300014325 | Bacteria | 16271 |
| 304 | Ga0163163_10030706 | 3300014325 | Bacteria | 5180 |
| 305 | Ga0163163_10041151 | 3300014325 | Bacteria | 4518 |
| 306 | Ga0163163_10106871 | 3300014325 | Bacteria | 2825 |
| 307 | Ga0163163_10114517 | 3300014325 | Bacteria | 2727 |
| 308 | Ga0163163_10168500 | 3300014325 | Bacteria | 2237 |
| 309 | Ga0157379_10016743 | 3300014968 | Bacteria | 6451 |
| 310 | Ga0157379_10575146 | 3300014968 | Bacteria | 1050 |
| 311 | Ga0157376_10004764 | 3300014969 | Bacteria | 9437 |
| 312 | Ga0157376_10095431 | 3300014969 | Bacteria | 2586 |
| 313 | Ga0157376_10548801 | 3300014969 | Unclassified | 1143 |
| 314 | Ga0157376_10688787 | 3300014969 | Bacteria | 1026 |
| 315 | Ga0157376_10997744 | 3300014969 | Bacteria | 860 |
| 316 | Ga0206349_1221229 | 3300020075 | Bacteria | 1484 |
| 317 | Ga0213873_10039013 | 3300021358 | Bacteria | 1215 |
| 318 | Ga0213872_10003238 | 3300021361 | Bacteria | 9094 |
| 319 | Ga0213874_10088077 | 3300021377 | Bacteria | 1016 |
| 320 | Ga0213876_10028032 | 3300021384 | Bacteria | 2969 |
| 321 | Ga0213876_10314572 | 3300021384 | Bacteria | 832 |
| 322 | Ga0213875_10000038 | 3300021388 | Bacteria | 164463 |
| 323 | Ga0213875_10000062 | 3300021388 | Bacteria | 130710 |
| 324 | Ga0213875_10007603 | 3300021388 | Bacteria | 5588 |
| 325 | Ga0213875_10024117 | 3300021388 | Unclassified | 2902 |
| 326 | Ga0213875_10101518 | 3300021388 | Bacteria | 1343 |
| 327 | Ga0213875_10108518 | 3300021388 | Bacteria | 1295 |
| 328 | Ga0213875_10127281 | 3300021388 | Bacteria | 1190 |
| 329 | Ga0207692_10214243 | 3300025898 | Bacteria | 1139 |
| 330 | Ga0207692_10302711 | 3300025898 | Bacteria | 973 |
| 331 | Ga0207680_10331636 | 3300025903 | Unclassified | 1066 |
| 332 | Ga0207699_10009713 | 3300025906 | Bacteria | 4804 |
| 333 | Ga0207699_10290916 | 3300025906 | Bacteria | 1138 |
| 334 | Ga0207705_10049331 | 3300025909 | Bacteria | 3030 |
| 335 | Ga0207705_10053376 | 3300025909 | Bacteria | 2912 |
| 336 | Ga0207705_10076018 | 3300025909 | Bacteria | 2441 |
| 337 | Ga0207654_10024145 | 3300025911 | Unclassified | 3265 |
| 338 | Ga0207654_10026313 | 3300025911 | Bacteria | 3149 |
| 339 | Ga0207654_10062590 | 3300025911 | Bacteria | 2181 |
| 340 | Ga0207654_10086228 | 3300025911 | Bacteria | 1903 |
| 341 | Ga0207654_10213831 | 3300025911 | Bacteria | 1275 |
| 342 | Ga0207654_10276711 | 3300025911 | Unclassified | 1134 |
| 343 | Ga0207654_10541868 | 3300025911 | Bacteria | 826 |
| 344 | Ga0207707_10007487 | 3300025912 | Bacteria | 9514 |
| 345 | Ga0207707_10172966 | 3300025912 | Bacteria | 1887 |
| 346 | Ga0207695_10000391 | 3300025913 | Bacteria | 98481 |
| 347 | Ga0207695_10021301 | 3300025913 | Bacteria | 7401 |
| 348 | Ga0207695_10021620 | 3300025913 | Bacteria | 7334 |
| 349 | Ga0207695_10023195 | 3300025913 | Bacteria | 7021 |
| 350 | Ga0207695_10025664 | 3300025913 | Bacteria | 6592 |
| 351 | Ga0207695_10055477 | 3300025913 | Bacteria | 4129 |
| 352 | Ga0207695_10061299 | 3300025913 | Bacteria | 3888 |
| 353 | Ga0207695_10093597 | 3300025913 | Bacteria | 3014 |
| 354 | Ga0207695_10099085 | 3300025913 | Bacteria | 2912 |
| 355 | Ga0207695_10327953 | 3300025913 | Bacteria | 1420 |
| 356 | Ga0207671_10029785 | 3300025914 | Bacteria | 4075 |
| 357 | Ga0207671_10044156 | 3300025914 | Bacteria | 3295 |
| 358 | Ga0207671_10048011 | 3300025914 | Bacteria | 3159 |
| 359 | Ga0207671_10050777 | 3300025914 | Bacteria | 3071 |
| 360 | Ga0207671_10096573 | 3300025914 | Bacteria | 2233 |
| 361 | Ga0207671_10261424 | 3300025914 | Bacteria | 1362 |
| 362 | Ga0207693_10655653 | 3300025915 | Bacteria | 815 |
| 363 | Ga0207663_10212681 | 3300025916 | Bacteria | 1402 |
| 364 | Ga0207660_10107609 | 3300025917 | Bacteria | 2093 |
| 365 | Ga0207660_10549717 | 3300025917 | Bacteria | 939 |
| 366 | Ga0207657_10011039 | 3300025919 | Bacteria | 8978 |
| 367 | Ga0207657_10011772 | 3300025919 | Bacteria | 8666 |
| 368 | Ga0207657_10020285 | 3300025919 | Bacteria | 6286 |
| 369 | Ga0207657_10098806 | 3300025919 | Bacteria | 2425 |
| 370 | Ga0207657_10163762 | 3300025919 | Bacteria | 1805 |
| 371 | Ga0207649_10032074 | 3300025920 | Bacteria | 3129 |
| 372 | Ga0207649_10317812 | 3300025920 | Bacteria | 1143 |
| 373 | Ga0207652_10015014 | 3300025921 | Bacteria | 6282 |
| 374 | Ga0207652_10088274 | 3300025921 | Bacteria | 2720 |
| 375 | Ga0207652_10124527 | 3300025921 | Bacteria | 2295 |
| 376 | Ga0207652_10142082 | 3300025921 | Bacteria | 2147 |
| 377 | Ga0207681_10279895 | 3300025923 | Bacteria | 1313 |
| 378 | Ga0207694_10007379 | 3300025924 | Bacteria | 8339 |
| 379 | Ga0207694_10019809 | 3300025924 | Bacteria | 5089 |
| 380 | Ga0207694_10084660 | 3300025924 | Bacteria | 2494 |
| 381 | Ga0207694_10105901 | 3300025924 | Bacteria | 2233 |
| 382 | Ga0207694_10135203 | 3300025924 | Bacteria | 1979 |
| 383 | Ga0207694_10211390 | 3300025924 | Bacteria | 1580 |
| 384 | Ga0207694_10546191 | 3300025924 | Archaea | 972 |
| 385 | Ga0207650_10376318 | 3300025925 | Bacteria | 1172 |
| 386 | Ga0207687_10002567 | 3300025927 | Bacteria | 12336 |
| 387 | Ga0207687_10006881 | 3300025927 | Bacteria | 7492 |
| 388 | Ga0207687_10006899 | 3300025927 | Bacteria | 7481 |
| 389 | Ga0207687_10012260 | 3300025927 | Bacteria | 5605 |
| 390 | Ga0207687_10018118 | 3300025927 | Bacteria | 4646 |
| 391 | Ga0207687_10018938 | 3300025927 | Bacteria | 4554 |
| 392 | Ga0207687_10089636 | 3300025927 | Bacteria | 2240 |
| 393 | Ga0207687_10252856 | 3300025927 | Bacteria | 1402 |
| 394 | Ga0207687_10277196 | 3300025927 | Bacteria | 1343 |
| 395 | Ga0207687_10351783 | 3300025927 | Bacteria | 1200 |
| 396 | Ga0207687_10403317 | 3300025927 | Bacteria | 1125 |
| 397 | Ga0207700_10006865 | 3300025928 | Bacteria | 6919 |
| 398 | Ga0207700_10181961 | 3300025928 | Bacteria | 1761 |
| 399 | Ga0207664_10000243 | 3300025929 | Bacteria | 41025 |
| 400 | Ga0207664_10126948 | 3300025929 | Bacteria | 2143 |
| 401 | Ga0207644_10181618 | 3300025931 | Bacteria | 1649 |
| 402 | Ga0207644_10606261 | 3300025931 | Bacteria | 909 |
| 403 | Ga0207706_10117324 | 3300025933 | Bacteria | 2341 |
| 404 | Ga0207706_10522074 | 3300025933 | Bacteria | 1024 |
| 405 | Ga0207686_10024625 | 3300025934 | Bacteria | 3490 |
| 406 | Ga0207686_10025699 | 3300025934 | Bacteria | 3429 |
| 407 | Ga0207686_10099599 | 3300025934 | Bacteria | 1938 |
| 408 | Ga0207686_10170295 | 3300025934 | Bacteria | 1535 |
| 409 | Ga0207686_10211339 | 3300025934 | Bacteria | 1395 |
| 410 | Ga0207686_10248513 | 3300025934 | Bacteria | 1298 |
| 411 | Ga0207686_10678685 | 3300025934 | Bacteria | 817 |
| 412 | Ga0207709_10082335 | 3300025935 | Bacteria | 2078 |
| 413 | Ga0207709_10093435 | 3300025935 | Bacteria | 1972 |
| 414 | Ga0207709_10206909 | 3300025935 | Bacteria | 1405 |
| 415 | Ga0207670_10207092 | 3300025936 | Bacteria | 1493 |
| 416 | Ga0207670_10228774 | 3300025936 | Bacteria | 1427 |
| 417 | Ga0207704_10025163 | 3300025938 | Bacteria | 3244 |
| 418 | Ga0207704_10029017 | 3300025938 | Bacteria | 3078 |
| 419 | Ga0207704_10535387 | 3300025938 | Bacteria | 950 |
| 420 | Ga0207691_10402596 | 3300025940 | Bacteria | 1167 |
| 421 | Ga0207711_10001007 | 3300025941 | Bacteria | 27032 |
| 422 | Ga0207711_10007937 | 3300025941 | Bacteria | 8879 |
| 423 | Ga0207711_10061358 | 3300025941 | Bacteria | 3242 |
| 424 | Ga0207711_10078285 | 3300025941 | Bacteria | 2884 |
| 425 | Ga0207711_10082604 | 3300025941 | Bacteria | 2809 |
| 426 | Ga0207711_10133767 | 3300025941 | Bacteria | 2225 |
| 427 | Ga0207711_10213694 | 3300025941 | Bacteria | 1762 |
| 428 | Ga0207689_10022089 | 3300025942 | Bacteria | 5351 |
| 429 | Ga0207689_10168173 | 3300025942 | Bacteria | 1806 |
| 430 | Ga0207661_10000034 | 3300025944 | Bacteria | 154138 |
| 431 | Ga0207661_10002034 | 3300025944 | Bacteria | 13947 |
| 432 | Ga0207661_10005480 | 3300025944 | Bacteria | 8951 |
| 433 | Ga0207661_10059166 | 3300025944 | Bacteria | 3087 |
| 434 | Ga0207661_10230110 | 3300025944 | Bacteria | 1641 |
| 435 | Ga0207661_10624849 | 3300025944 | Bacteria | 989 |
| 436 | Ga0207679_10015828 | 3300025945 | Bacteria | 4997 |
| 437 | Ga0207679_10075535 | 3300025945 | Bacteria | 2557 |
| 438 | Ga0207679_10195418 | 3300025945 | Bacteria | 1686 |
| 439 | Ga0207667_10005205 | 3300025949 | Bacteria | 15878 |
| 440 | Ga0207667_10009407 | 3300025949 | Bacteria | 11511 |
| 441 | Ga0207667_10025046 | 3300025949 | Bacteria | 6540 |
| 442 | Ga0207667_10025758 | 3300025949 | Bacteria | 6434 |
| 443 | Ga0207667_10066800 | 3300025949 | Bacteria | 3748 |
| 444 | Ga0207667_10216718 | 3300025949 | Bacteria | 1961 |
| 445 | Ga0207667_10320444 | 3300025949 | Bacteria | 1583 |
| 446 | Ga0207651_10107272 | 3300025960 | Bacteria | 2087 |
| 447 | Ga0207712_10001973 | 3300025961 | Bacteria | 13455 |
| 448 | Ga0207658_10123897 | 3300025986 | Bacteria | 2065 |
| 449 | Ga0207658_10229278 | 3300025986 | Bacteria | 1567 |
| 450 | Ga0207677_10076391 | 3300026023 | Bacteria | 2384 |
| 451 | Ga0207677_10130357 | 3300026023 | Bacteria | 1908 |
| 452 | Ga0207677_10290142 | 3300026023 | Bacteria | 1347 |
| 453 | Ga0207677_10496238 | 3300026023 | Bacteria | 1054 |
| 454 | Ga0207703_10006427 | 3300026035 | Bacteria | 9392 |
| 455 | Ga0207703_10009108 | 3300026035 | Bacteria | 7816 |
| 456 | Ga0207703_10063903 | 3300026035 | Bacteria | 3019 |
| 457 | Ga0207703_10065078 | 3300026035 | Bacteria | 2995 |
| 458 | Ga0207639_10025331 | 3300026041 | Bacteria | 4301 |
| 459 | Ga0207639_10263691 | 3300026041 | Bacteria | 1508 |
| 460 | Ga0207639_10507593 | 3300026041 | Bacteria | 1103 |
| 461 | Ga0207639_10594819 | 3300026041 | Bacteria | 1020 |
| 462 | Ga0207678_10030369 | 3300026067 | Bacteria | 4718 |
| 463 | Ga0207678_10526320 | 3300026067 | Bacteria | 1032 |
| 464 | Ga0207678_10601572 | 3300026067 | Bacteria | 964 |
| 465 | Ga0207708_10275622 | 3300026075 | Bacteria | 1362 |
| 466 | Ga0207702_10002595 | 3300026078 | Bacteria | 16977 |
| 467 | Ga0207702_10011666 | 3300026078 | Bacteria | 7320 |
| 468 | Ga0207702_10024177 | 3300026078 | Bacteria | 5040 |
| 469 | Ga0207702_10037503 | 3300026078 | Bacteria | 4058 |
| 470 | Ga0207702_10041531 | 3300026078 | Bacteria | 3857 |
| 471 | Ga0207702_10153922 | 3300026078 | Bacteria | 2094 |
| 472 | Ga0207702_10199833 | 3300026078 | Bacteria | 1852 |
| 473 | Ga0207641_10004312 | 3300026088 | Bacteria | 12351 |
| 474 | Ga0207641_10048045 | 3300026088 | Unclassified | 3601 |
| 475 | Ga0207648_10644344 | 3300026089 | Bacteria | 979 |
| 476 | Ga0207648_10716372 | 3300026089 | Bacteria | 928 |
| 477 | Ga0207676_10125194 | 3300026095 | Bacteria | 2175 |
| 478 | Ga0207676_10478500 | 3300026095 | Bacteria | 1179 |
| 479 | Ga0207676_10759169 | 3300026095 | Bacteria | 944 |
| 480 | Ga0207676_10879253 | 3300026095 | Bacteria | 878 |
| 481 | Ga0207674_10001768 | 3300026116 | Bacteria | 27613 |
| 482 | Ga0207674_10005073 | 3300026116 | Bacteria | 15716 |
| 483 | Ga0207675_100139949 | 3300026118 | Bacteria | 2298 |
| 484 | Ga0207675_100374378 | 3300026118 | Bacteria | 1399 |
| 485 | Ga0207683_10168069 | 3300026121 | Bacteria | 1985 |
| 486 | Ga0207698_10007422 | 3300026142 | Bacteria | 6868 |
| 487 | Ga0207698_10132464 | 3300026142 | Bacteria | 2133 |
| 488 | Ga0207698_10537449 | 3300026142 | Bacteria | 1143 |
| 489 | Ga0207698_11124874 | 3300026142 | Bacteria | 798 |
| 490 | Ga0268266_10012462 | 3300028379 | Bacteria | 7348 |
| 491 | Ga0268266_10014513 | 3300028379 | Bacteria | 6771 |
| 492 | Ga0268266_10053425 | 3300028379 | Bacteria | 3471 |
| 493 | Ga0268266_10571109 | 3300028379 | Bacteria | 1085 |
| 494 | Ga0268264_10015609 | 3300028381 | Bacteria | 6225 |
| 495 | Ga0265323_10001695 | 3300028653 | Bacteria | 10527 |
| 496 | Ga0265338_10062885 | 3300028800 | Bacteria | 3241 |
| 497 | Ga0265338_10125059 | 3300028800 | Bacteria | 2042 |
| 498 | Ga0265330_10119594 | 3300031235 | Bacteria | 1123 |
| 499 | Ga0265332_10069475 | 3300031238 | Bacteria | 1501 |
| 500 | Ga0265328_10028498 | 3300031239 | Bacteria | 2089 |
| 501 | Ga0265320_10011089 | 3300031240 | Bacteria | 5321 |
| 502 | Ga0265329_10028547 | 3300031242 | Bacteria | 1829 |
| 503 | Ga0265340_10072786 | 3300031247 | Bacteria | 1627 |
| 504 | Ga0265339_10081644 | 3300031249 | Bacteria | 1708 |
| 505 | Ga0265331_10004555 | 3300031250 | Bacteria | 8638 |
| 506 | Ga0265331_10007736 | 3300031250 | Bacteria | 6175 |
| 507 | Ga0265331_10036214 | 3300031250 | Bacteria | 2424 |
| 508 | Ga0265331_10111592 | 3300031250 | Bacteria | 1254 |
| 509 | Ga0265316_10002711 | 3300031344 | Bacteria | 18188 |
| 510 | Ga0265316_10003486 | 3300031344 | Bacteria | 15879 |
| 511 | Ga0265316_10019660 | 3300031344 | Bacteria | 5768 |
| 512 | Ga0265316_10025064 | 3300031344 | Bacteria | 4983 |
| 513 | Ga0265316_10046149 | 3300031344 | Bacteria | 3454 |
| 514 | Ga0265316_10048282 | 3300031344 | Bacteria | 3362 |
| 515 | Ga0265316_10057326 | 3300031344 | Bacteria | 3038 |
| 516 | Ga0265316_10250029 | 3300031344 | Bacteria | 1302 |
| 517 | Ga0265313_10003093 | 3300031595 | Bacteria | 13801 |
| 518 | Ga0265314_10000463 | 3300031711 | Bacteria | 54000 |
| 519 | Ga0265314_10000763 | 3300031711 | Bacteria | 38536 |
| 520 | Ga0265314_10035179 | 3300031711 | Bacteria | 3653 |
| 521 | Ga0265314_10116234 | 3300031711 | Bacteria | 1691 |
| 522 | Ga0265342_10114026 | 3300031712 | Bacteria | 1527 |
| 523 | Ga0373926_0058906 | 3300035083 | Bacteria | 1397 |
| 524 | Ga0373934_0025573 | 3300035086 | Bacteria | 2287 |
| 525 | Ga0373923_0033751 | 3300035111 | Bacteria | 2074 |
| 526 | Ga0373936_0183873 | 3300035113 | Bacteria | 918 |
| 527 | Ga0373939_0068509 | 3300035114 | Bacteria | 1149 |
| 528 | Ga0373945_0128240 | 3300035116 | Bacteria | 1014 |
| 529 | Ga0373953_0006782 | 3300035117 | Bacteria | 3795 |
| 530 | Ga0373953_0017360 | 3300035117 | Bacteria | 2645 |
| 531 | Ga0373953_0046076 | 3300035117 | Bacteria | 1750 |
| 532 | Ga0373953_0073134 | 3300035117 | Bacteria | 1417 |
| 533 | Ga0373954_0006291 | 3300035118 | Bacteria | 5176 |
| 534 | Ga0373954_0007483 | 3300035118 | Bacteria | 4777 |
| 535 | Ga0373954_0048928 | 3300035118 | Bacteria | 1981 |
| 536 | Ga0373956_0026065 | 3300035119 | Bacteria | 2531 |
| 537 | Ga0373956_0099952 | 3300035119 | Bacteria | 1345 |
| 538 | Ga0373957_0153447 | 3300035120 | Bacteria | 946 |
| 539 | Ga0373943_0035231 | 3300035170 | Bacteria | 2390 |
| 540 | Ga0373946_0066642 | 3300035171 | Bacteria | 1544 |
| 541 | Ga0373946_0096413 | 3300035171 | Bacteria | 1319 |
| 542 | Ga0373955_0359834 | 3300035172 | Bacteria | 882 |
| 543 | Ga0373955_0432333 | 3300035172 | Bacteria | 801 |
| 544 | Ga0373955_0443876 | 3300035172 | Bacteria | 790 |
| 545 | Ga0373931_0193530 | 3300035691 | Bacteria | 1211 |
| 546 | Ga0373935_0023490 | 3300035692 | Bacteria | 3789 |
| 547 | Ga0373935_0038674 | 3300035692 | Bacteria | 2988 |
| 548 | Ga0373935_0075536 | 3300035692 | Bacteria | 2180 |
| 549 | Ga0373935_0099346 | 3300035692 | Bacteria | 1916 |
| 550 | Ga0373935_0326222 | 3300035692 | Bacteria | 1090 |
| 551 | Ga0373935_0462975 | 3300035692 | Bacteria | 917 |
| 552 | Ga0373927_0000693 | 3300035695 | Bacteria | 25750 |
| 553 | Ga0373927_0008989 | 3300035695 | Bacteria | 6707 |
| 554 | Ga0373927_0009091 | 3300035695 | Bacteria | 6668 |
| 555 | Ga0373927_0041626 | 3300035695 | Bacteria | 2980 |
| 556 | Ga0373927_0142350 | 3300035695 | Bacteria | 1569 |
| 557 | Ga0373927_0330146 | 3300035695 | Bacteria | 1005 |
| 558 | Ga0373927_0382002 | 3300035695 | Bacteria | 929 |
| 559 | Ga0373933_0007991 | 3300035724 | Bacteria | 5771 |
| 560 | Ga0373933_0428432 | 3300035724 | Bacteria | 864 |
| 561 | Ga0373947_0004248 | 3300035725 | Bacteria | 8403 |
| 562 | Ga0373947_0005444 | 3300035725 | Bacteria | 7428 |
| 563 | Ga0373947_0138468 | 3300035725 | Bacteria | 1559 |
| 564 | Ga0373937_0013196 | 3300036401 | Bacteria | 7275 |
| 565 | Ga0373937_0019184 | 3300036401 | Bacteria | 6122 |
| 566 | Ga0373937_0022623 | 3300036401 | Bacteria | 5653 |
| 567 | Ga0373937_0041526 | 3300036401 | Bacteria | 4195 |
| 568 | Ga0373937_0061945 | 3300036401 | Bacteria | 3439 |
| 569 | Ga0373937_0093980 | 3300036401 | Bacteria | 2780 |
| 570 | Ga0373937_0127081 | 3300036401 | Bacteria | 2379 |
| 571 | Ga0373937_0256146 | 3300036401 | Bacteria | 1650 |
| 572 | Ga0373937_0609042 | 3300036401 | Bacteria | 1037 |
| 573 | Ga0373925_0005661 | 3300037068 | Bacteria | 9297 |
| 574 | Ga0373925_0009298 | 3300037068 | Bacteria | 7154 |
| 575 | Ga0373925_0046235 | 3300037068 | Bacteria | 3236 |
| 576 | Ga0373925_0070541 | 3300037068 | Bacteria | 2642 |
| 577 | Ga0373925_0084910 | 3300037068 | Bacteria | 2413 |
| 578 | Ga0373925_0119521 | 3300037068 | Bacteria | 2044 |
| 579 | Ga0373925_0172937 | 3300037068 | Bacteria | 1706 |
| 580 | Ga0373925_0325816 | 3300037068 | Bacteria | 1244 |
| 581 | Ga0373925_0351600 | 3300037068 | Bacteria | 1197 |
| 582 | Ga0373925_0600910 | 3300037068 | Bacteria | 906 |
| 583 | Ga0395900_0270844 | 3300037418 | Bacteria | 1693 |
| 584 | Ga0436364_0031755 | 3300037853 | Bacteria | 11738 |
| 585 | Ga0436364_0061193 | 3300037853 | Bacteria | 1069 |
| 586 | Ga0436364_0116838 | 3300037853 | Bacteria | 4905 |
| 587 | Ga0436364_0155407 | 3300037853 | Bacteria | 3161 |
| 588 | Ga0436364_0404360 | 3300037853 | Bacteria | 5589 |
| 589 | Ga0436364_0451172 | 3300037853 | Bacteria | 9705 |
| 590 | Ga0436364_0692444 | 3300037853 | Unclassified | 2977 |
| 591 | Ga0436364_0752221 | 3300037853 | Bacteria | 2873 |
| 592 | Ga0436364_0789899 | 3300037853 | Bacteria | 9344 |
| 593 | Ga0436364_0799077 | 3300037853 | Bacteria | 5024 |
| 594 | Ga0436364_0991316 | 3300037853 | Bacteria | 187962 |
| 595 | Ga0436364_1019864 | 3300037853 | Bacteria | 3055 |
| 596 | Ga0436364_1065030 | 3300037853 | Bacteria | 28547 |
| 597 | Ga0436364_1155435 | 3300037853 | Unclassified | 871 |
| 598 | Ga0436364_1285749 | 3300037853 | Bacteria | 4815 |
| 599 | Ga0436364_1321932 | 3300037853 | Bacteria | 3231 |
| 600 | Ga0436364_1424606 | 3300037853 | Bacteria | 107493 |
| 601 | Ga0436364_1498390 | 3300037853 | Unclassified | 2366 |
| 602 | Ga0436364_1530732 | 3300037853 | Bacteria | 1037 |
| 603 | Ga0436365_0108255 | 3300039437 | Bacteria | 7346 |
| 604 | Ga0436365_0352593 | 3300039437 | Bacteria | 6940 |
| 605 | Ga0436365_0419695 | 3300039437 | Unclassified | 1399 |
| 606 | Ga0436365_0540111 | 3300039437 | Bacteria | 1268 |
| 607 | Ga0436365_0573506 | 3300039437 | Bacteria | 3985 |
| 608 | Ga0436365_0965866 | 3300039437 | Bacteria | 1640 |
| 609 | Ga0436365_1375986 | 3300039437 | Bacteria | 2094 |
| 610 | Ga0436365_1556196 | 3300039437 | Bacteria | 3655 |
| 611 | Ga0436360_0186249 | 3300039438 | Bacteria | 804 |
| 612 | Ga0436360_1019100 | 3300039438 | Bacteria | 1786 |
| 613 | Ga0436360_1294045 | 3300039438 | Bacteria | 1194 |
| 614 | Ga0436361_0863641 | 3300039447 | Bacteria | 83672 |
| 615 | Ga0436363_0043746 | 3300039450 | Bacteria | 2141 |
| 616 | Ga0436363_0221023 | 3300039450 | Bacteria | 7711 |
| 617 | Ga0436363_0308712 | 3300039450 | Bacteria | 1332 |
| 618 | Ga0436362_0077579 | 3300039453 | Bacteria | 5452 |
| 619 | Ga0436362_0318356 | 3300039453 | Bacteria | 1608 |
| 620 | Ga0436362_0779550 | 3300039453 | Bacteria | 2001 |
| 621 | Ga0436362_0866484 | 3300039453 | Bacteria | 855 |
| 622 | Ga0451576_0230137 | 3300045051 | Bacteria | 1936 |
| 623 | Ga0451576_0629547 | 3300045051 | Bacteria | 1127 |
| 624 | Ga0466958_0278037 | 3300045836 | Bacteria | 1073 |
| 625 | Ga0466967_0223594 | 3300045976 | Bacteria | 1790 |
| 626 | Ga0495592_0007212 | 3300046454 | Bacteria | 8326 |
| 627 | Ga0495592_0038518 | 3300046454 | Bacteria | 3597 |
| 628 | Ga0495651_0142144 | 3300046462 | Bacteria | 1739 |
| 629 | Ga0495651_0230987 | 3300046462 | Bacteria | 1274 |
| 630 | Ga0495580_0006186 | 3300046472 | Bacteria | 9787 |
| 631 | Ga0495580_0006440 | 3300046472 | Bacteria | 9559 |
| 632 | Ga0495580_0015358 | 3300046472 | Bacteria | 5776 |
| 633 | Ga0495580_0026441 | 3300046472 | Bacteria | 4231 |
| 634 | Ga0495580_0041349 | 3300046472 | Bacteria | 3288 |
| 635 | Ga0495580_0067700 | 3300046472 | Bacteria | 2498 |
| 636 | Ga0495580_0070112 | 3300046472 | Bacteria | 2449 |
| 637 | Ga0495580_0071381 | 3300046472 | Bacteria | 2426 |
| 638 | Ga0495580_0080577 | 3300046472 | Bacteria | 2269 |
| 639 | Ga0495582_0126458 | 3300046473 | Unclassified | 1442 |
| 640 | Ga0495662_0014992 | 3300046476 | Bacteria | 3765 |
| 641 | Ga0495664_0169299 | 3300046477 | Bacteria | 1325 |
| 642 | Ga0495664_0269159 | 3300046477 | Archaea | 1030 |
| 643 | Ga0495594_0019018 | 3300046499 | Bacteria | 3647 |
| 644 | Ga0495594_0149550 | 3300046499 | Bacteria | 1326 |
| 645 | Ga0495608_0107531 | 3300046511 | Bacteria | 1795 |
| 646 | Ga0495618_0134125 | 3300046514 | Bacteria | 1584 |
| 647 | Ga0495628_0237823 | 3300046516 | Bacteria | 1363 |
| 648 | Ga0495630_0031393 | 3300046517 | Bacteria | 3955 |
| 649 | Ga0495630_0442243 | 3300046517 | Bacteria | 996 |
| 650 | Ga0495666_0174668 | 3300046526 | Unclassified | 993 |
| 651 | Ga0495652_0005190 | 3300046529 | Bacteria | 12312 |
| 652 | Ga0495652_0532967 | 3300046529 | Bacteria | 810 |
| 653 | Ga0495665_0068594 | 3300046531 | Bacteria | 1870 |
| 654 | Ga0495665_0111636 | 3300046531 | Bacteria | 1434 |
| 655 | Ga0495665_0175850 | 3300046531 | Bacteria | 1113 |
| 656 | Ga0495586_0036444 | 3300046535 | Bacteria | 2640 |
| 657 | Ga0495587_0003616 | 3300046536 | Bacteria | 10288 |
| 658 | Ga0495587_0038848 | 3300046536 | Bacteria | 2851 |
| 659 | Ga0495587_0057715 | 3300046536 | Bacteria | 2282 |
| 660 | Ga0495587_0117439 | 3300046536 | Bacteria | 1525 |
| 661 | Ga0495645_0004183 | 3300046543 | Bacteria | 9864 |
| 662 | Ga0495645_0103954 | 3300046543 | Bacteria | 2017 |
| 663 | Ga0495645_0107106 | 3300046543 | Bacteria | 1982 |
| 664 | Ga0495645_0340261 | 3300046543 | Bacteria | 969 |
| 665 | Ga0495667_0056415 | 3300046559 | Bacteria | 2583 |
| 666 | Ga0495667_0158318 | 3300046559 | Bacteria | 1457 |
| 667 | Ga0495634_0011585 | 3300046642 | Bacteria | 6415 |
| 668 | Ga0495634_0013158 | 3300046642 | Bacteria | 5978 |
| 669 | Ga0495635_0185267 | 3300046663 | Bacteria | 1414 |
| 670 | Ga0495635_0197057 | 3300046663 | Bacteria | 1367 |
| 671 | Ga0495635_0332788 | 3300046663 | Unclassified | 1015 |
| 672 | Ga0495657_0170196 | 3300046675 | Bacteria | 1342 |
| 673 | Ga0495599_0001158 | 3300046678 | Bacteria | 14951 |
| 674 | Ga0495599_0043705 | 3300046678 | Bacteria | 2812 |
| 675 | Ga0495599_0162147 | 3300046678 | Bacteria | 1382 |
| 676 | Ga0495623_0129681 | 3300046679 | Bacteria | 1511 |
| 677 | Ga0495623_0131240 | 3300046679 | Bacteria | 1500 |
| 678 | Ga0495646_0161268 | 3300046680 | Bacteria | 1241 |
| 679 | Ga0495658_0057476 | 3300046683 | Bacteria | 2222 |
| 680 | Ga0495613_0145337 | 3300046689 | Bacteria | 1693 |
| 681 | Ga0495613_0192240 | 3300046689 | Bacteria | 1442 |
| 682 | Ga0495600_0449384 | 3300046809 | Unclassified | 797 |
| 683 | Ga0495604_0071930 | 3300047317 | Bacteria | 2615 |
| 684 | Ga0495604_0082344 | 3300047317 | Bacteria | 2407 |
| 685 | Ga0495674_0006809 | 3300047319 | Bacteria | 10943 |
| 686 | Ga0495674_0046440 | 3300047319 | Bacteria | 3854 |
| 687 | Ga0495674_0129054 | 3300047319 | Bacteria | 2131 |
| 688 | Ga0495674_0761732 | 3300047319 | Bacteria | 756 |
| 689 | Ga0495680_0074584 | 3300047322 | Bacteria | 2576 |
| 690 | Ga0495675_0021967 | 3300047444 | Bacteria | 4065 |
| 691 | Ga0495684_0060464 | 3300047471 | Bacteria | 2884 |
| 692 | Ga0495684_0097138 | 3300047471 | Bacteria | 2229 |
| 693 | Ga0495684_0265914 | 3300047471 | Unclassified | 1242 |
| 694 | Ga0495602_0001423 | 3300048088 | Bacteria | 23732 |
| 695 | Ga0495602_0080166 | 3300048088 | Bacteria | 2751 |
| 696 | Ga0495602_0445267 | 3300048088 | Bacteria | 915 |
| 697 | Ga0496102_0433605 | 3300048905 | Unclassified | 1234 |
| 698 | Ga0496104_0286429 | 3300048907 | Bacteria | 1560 |
| 699 | Ga0496104_0764777 | 3300048907 | Bacteria | 873 |
| 700 | Ga0496112_0006624 | 3300048915 | Bacteria | 10198 |
| 701 | Ga0496112_0262123 | 3300048915 | Bacteria | 1678 |
| 702 | Ga0496115_0006544 | 3300048918 | Bacteria | 8541 |
| 703 | Ga0496115_0269313 | 3300048918 | Bacteria | 1400 |
| 704 | Ga0496115_0313374 | 3300048918 | Bacteria | 1284 |
| 705 | Ga0501031_0004453 | 3300049568 | Bacteria | 9090 |
| 706 | Ga0501031_0121220 | 3300049568 | Bacteria | 1708 |
| 707 | Ga0501032_0002278 | 3300049569 | Bacteria | 15077 |
| 708 | Ga0501032_0054654 | 3300049569 | Bacteria | 2687 |
| 709 | Ga0501033_0005380 | 3300049570 | Bacteria | 10144 |
| 710 | Ga0501033_0017899 | 3300049570 | Bacteria | 5349 |
| 711 | Ga0501034_0007141 | 3300049571 | Bacteria | 11917 |
| 712 | Ga0501034_0010051 | 3300049571 | Bacteria | 9881 |
| 713 | Ga0501034_0013159 | 3300049571 | Bacteria | 8523 |
| 714 | Ga0501034_0235588 | 3300049571 | Bacteria | 1778 |
| 715 | Ga0501036_0000329 | 3300049572 | Bacteria | 33132 |
| 716 | Ga0501036_0000498 | 3300049572 | Bacteria | 28138 |
| 717 | Ga0501037_0013717 | 3300049573 | Bacteria | 5968 |
| 718 | Ga0501038_0012838 | 3300049574 | Bacteria | 7647 |
| 719 | Ga0501038_0013541 | 3300049574 | Bacteria | 7434 |
| 720 | Ga0501038_0080025 | 3300049574 | Unclassified | 2755 |
| 721 | Ga0501039_0018465 | 3300049575 | Bacteria | 5354 |
| 722 | Ga0501039_0180790 | 3300049575 | Bacteria | 1658 |
| 723 | Ga0501040_0435654 | 3300049576 | Bacteria | 943 |
| 724 | Ga0501042_0090194 | 3300049578 | Bacteria | 2200 |
| 725 | Ga0501043_0006639 | 3300049579 | Bacteria | 9259 |
| 726 | Ga0501043_0006983 | 3300049579 | Bacteria | 8993 |
| 727 | Ga0501046_0001380 | 3300049580 | Bacteria | 23364 |
| 728 | Ga0501046_0002887 | 3300049580 | Bacteria | 15937 |
| 729 | Ga0501046_0038558 | 3300049580 | Bacteria | 3833 |
| 730 | Ga0501047_0004568 | 3300049581 | Bacteria | 13021 |
| 731 | Ga0501047_0008173 | 3300049581 | Bacteria | 9881 |
| 732 | Ga0501047_0028507 | 3300049581 | Bacteria | 5384 |
| 733 | Ga0501047_0029771 | 3300049581 | Bacteria | 5262 |
| 734 | Ga0501048_0167741 | 3300049582 | Bacteria | 1554 |
| 735 | Ga0501067_0007862 | 3300049583 | Bacteria | 5926 |
| 736 | Ga0501067_0017255 | 3300049583 | Bacteria | 3989 |
| 737 | Ga0501068_0000768 | 3300049584 | Bacteria | 16530 |
| 738 | Ga0501068_0001224 | 3300049584 | Bacteria | 13615 |
| 739 | Ga0501069_0003086 | 3300049585 | Bacteria | 8532 |
| 740 | Ga0501069_0015707 | 3300049585 | Bacteria | 4058 |
| 741 | Ga0501070_0006405 | 3300049586 | Bacteria | 10015 |
| 742 | Ga0501070_0009865 | 3300049586 | Bacteria | 8074 |
| 743 | Ga0501070_0038634 | 3300049586 | Bacteria | 3983 |
| 744 | Ga0501070_0087889 | 3300049586 | Bacteria | 2572 |
| 745 | Ga0501072_0000320 | 3300049588 | Bacteria | 34200 |
| 746 | Ga0501072_0041536 | 3300049588 | Bacteria | 3612 |
| 747 | Ga0501073_0000432 | 3300049589 | Bacteria | 28777 |
| 748 | Ga0501073_0059590 | 3300049589 | Bacteria | 2665 |
| 749 | Ga0501074_0025861 | 3300049590 | Bacteria | 4258 |
| 750 | Ga0501074_0041722 | 3300049590 | Bacteria | 3321 |
| 751 | Ga0501076_0034374 | 3300049592 | Bacteria | 3962 |
| 752 | Ga0501076_0143430 | 3300049592 | Bacteria | 1941 |
| 753 | Ga0501077_0000457 | 3300049593 | Bacteria | 24786 |
| 754 | Ga0501077_0009559 | 3300049593 | Bacteria | 6029 |
| 755 | Ga0501079_0001554 | 3300049741 | Bacteria | 16270 |
| 756 | Ga0501079_0014989 | 3300049741 | Bacteria | 5908 |
| 757 | Ga0501080_0000559 | 3300049742 | Bacteria | 29429 |
| 758 | Ga0501080_0002238 | 3300049742 | Bacteria | 16814 |
| 759 | Ga0501083_0009706 | 3300049744 | Bacteria | 6796 |
| 760 | Ga0501035_0018483 | 3300049822 | Bacteria | 6421 |
| 761 | Ga0501035_0042942 | 3300049822 | Bacteria | 4075 |
| 762 | Ga0501044_0002364 | 3300049823 | Bacteria | 21500 |
| 763 | Ga0501044_0014229 | 3300049823 | Bacteria | 8592 |
| 764 | Ga0501044_0017624 | 3300049823 | Bacteria | 7660 |
| 765 | Ga0501044_0110693 | 3300049823 | Bacteria | 2754 |
| 766 | Ga0501045_0124371 | 3300049824 | Bacteria | 1915 |
| 767 | nmdc:mga05p37_245765_c1 | 3300050507 | Bacteria | 2148 |
| 768 | nmdc:mga06r32_27179_c1 | 3300050510 | Bacteria | 5342 |
| 769 | nmdc:mga08x19_593576_c1 | 3300050514 | Bacteria | 785 |
| 770 | Ga0495601_0058669 | 3300053077 | Bacteria | 2440 |
| 771 | Ga0495601_0238188 | 3300053077 | Bacteria | 1188 |
| 772 | Ga0495619_0189046 | 3300053085 | Bacteria | 1425 |
| 773 | Ga0500568_0007085 | 3300053139 | Bacteria | 5542 |
| 774 | Ga0501084_0002600 | 3300054114 | Bacteria | 14548 |
| 775 | Ga0501084_0002811 | 3300054114 | Bacteria | 14056 |
| 776 | Ga0501082_0001311 | 3300060353 | Bacteria | 21804 |
| 777 | Ga0501082_0008060 | 3300060353 | Bacteria | 9088 |
| 778 | Ga0207704_10238533 | |||
| 779 | Ga0070658_10003050 | |||
| 780 | Ga0070658_10052271 | |||
| 781 | Ga0070658_10077773 | |||
| 782 | Ga0070658_10312031 | |||
| 783 | Ga0070683_100000012 | |||
| 784 | Ga0070683_100006580 | |||
| 785 | Ga0070683_100011594 | |||
| 786 | Ga0070683_100016852 | |||
| 787 | Ga0070683_100108824 | |||
| 788 | Ga0070683_100128534 | |||
| 789 | Ga0070683_100183635 | |||
| 790 | Ga0070683_100186885 | |||
| 791 | Ga0070670_100325653 | |||
| 792 | Ga0070670_100929985 | |||
| 793 | Ga0068869_100014026 | |||
| 794 | Ga0068869_100732568 | |||
| 795 | Ga0070666_10034480 | |||
| 796 | Ga0070666_10441382 | |||
| 797 | Ga0070680_100008281 | |||
| 798 | Ga0068868_100000918 | |||
| 799 | Ga0068868_100540736 | |||
| 800 | Ga0068868_100867901 | |||
| 801 | Ga0070660_100002216 | |||
| 802 | Ga0070660_100032476 | |||
| 803 | Ga0070660_100093708 | |||
| 804 | Ga0070660_100191032 | |||
| 805 | Ga0070689_100314089 | |||
| 806 | Ga0070689_100373817 | |||
| 807 | Ga0070691_10008384 | |||
| 808 | Ga0070661_100093778 | |||
| 809 | Ga0070661_100149419 | |||
| 810 | Ga0070675_100784804 | |||
| 811 | Ga0070671_100072096 | |||
| 812 | Ga0070671_100212452 | |||
| 813 | Ga0070671_100260046 | |||
| 814 | Ga0070673_100045074 | |||
| 815 | Ga0070673_100106905 | |||
| 816 | Ga0070659_100091186 | |||
| 817 | Ga0070667_100147411 | |||
| 818 | Ga0070667_100260852 | |||
| 819 | Ga0070709_10305444 | |||
| 820 | Ga0070714_100000378 | |||
| 821 | Ga0070713_100003417 | |||
| 822 | Ga0070713_100013803 | |||
| 823 | Ga0070713_100020429 | |||
| 824 | Ga0070713_100075270 | |||
| 825 | Ga0070713_100548079 | |||
| 826 | Ga0070713_100995284 | |||
| 827 | Ga0070711_100175988 | |||
| 828 | Ga0070705_100782611 | |||
| 829 | Ga0070663_100025862 | |||
| 830 | Ga0070663_100404711 | |||
| 831 | Ga0070678_100288939 | |||
| 832 | Ga0070678_100402632 | |||
| 833 | Ga0070662_100546430 | |||
| 834 | Ga0070681_10003147 | |||
| 835 | Ga0070681_10008764 | |||
| 836 | Ga0070681_10010237 | |||
| 837 | Ga0070681_10029433 | |||
| 838 | Ga0070681_10073280 | |||
| 839 | Ga0068867_100029691 | |||
| 840 | Ga0068867_100507319 | |||
| 841 | Ga0068867_100576460 | |||
| 842 | Ga0070685_10396002 | |||
| 843 | Ga0070706_100873754 | |||
| 844 | Ga0070707_100235015 | |||
| 845 | Ga0070699_100603244 | |||
| 846 | Ga0070679_100003335 | |||
| 847 | Ga0070679_100340249 | |||
| 848 | Ga0070679_100551890 | |||
| 849 | Ga0070684_100000013 | |||
| 850 | Ga0070684_100000798 | |||
| 851 | Ga0070684_100040738 | |||
| 852 | Ga0070684_100041379 | |||
| 853 | Ga0070684_100050302 | |||
| 854 | Ga0070684_100050622 | |||
| 855 | Ga0070684_100065843 | |||
| 856 | Ga0070684_100277510 | |||
| 857 | Ga0070684_100479517 | |||
| 858 | Ga0070697_100718397 | |||
| 859 | Ga0068853_100041797 | |||
| 860 | Ga0068853_100125613 | |||
| 861 | Ga0068853_100154039 | |||
| 862 | Ga0068853_100180857 | |||
| 863 | Ga0068853_100541481 | |||
| 864 | Ga0070672_100372514 | |||
| 865 | Ga0070686_100514150 | |||
| 866 | Ga0070693_100030587 | |||
| 867 | Ga0070665_100077345 | |||
| 868 | Ga0070665_100219259 | |||
| 869 | Ga0070665_100321073 | |||
| 870 | Ga0070665_100566774 | |||
| 871 | Ga0070665_100575896 | |||
| 872 | Ga0070704_100242619 | |||
| 873 | Ga0068855_100000760 | |||
| 874 | Ga0068855_100007656 | |||
| 875 | Ga0068855_100059243 | |||
| 876 | Ga0068855_100064244 | |||
| 877 | Ga0068855_100086265 | |||
| 878 | Ga0068855_100200127 | |||
| 879 | Ga0068855_100226839 | |||
| 880 | Ga0068855_100334026 | |||
| 881 | Ga0068855_100350257 | |||
| 882 | Ga0068855_100499736 | |||
| 883 | Ga0070664_100013849 | |||
| 884 | Ga0070664_100203105 | |||
| 885 | Ga0070664_100544118 | |||
| 886 | Ga0070664_100718846 | |||
| 887 | Ga0068857_100002143 | |||
| 888 | Ga0068857_100019037 | |||
| 889 | Ga0068857_100283092 | |||
| 890 | Ga0068854_100588802 | |||
| 891 | Ga0068856_100002863 | |||
| 892 | Ga0068856_100005385 | |||
| 893 | Ga0068856_100006645 | |||
| 894 | Ga0068856_100010449 | |||
| 895 | Ga0068856_100015815 | |||
| 896 | Ga0068856_100057188 | |||
| 897 | Ga0068856_100093089 | |||
| 898 | Ga0068856_100181217 | |||
| 899 | Ga0068856_100302890 | |||
| 900 | Ga0070702_100114356 | |||
| 901 | Ga0068852_100016955 | |||
| 902 | Ga0068852_100158266 | |||
| 903 | Ga0068852_100247987 | |||
| 904 | Ga0068859_100030378 | |||
| 905 | Ga0068859_100138127 | |||
| 906 | Ga0068859_100157977 | |||
| 907 | Ga0068859_100268856 | |||
| 908 | Ga0068859_100312974 | |||
| 909 | Ga0068859_100824024 | |||
| 910 | Ga0068864_100010367 | |||
| 911 | Ga0068864_100371938 | |||
| 912 | Ga0068864_100456304 | |||
| 913 | Ga0068864_101112746 | |||
| 914 | Ga0068861_100265741 | |||
| 915 | Ga0068861_100453251 | |||
| 916 | Ga0068851_10187583 | |||
| 917 | Ga0068870_10022050 | |||
| 918 | Ga0068863_100010818 | |||
| 919 | Ga0068863_100053554 | |||
| 920 | Ga0068863_100068704 | |||
| 921 | Ga0068863_100164816 | |||
| 922 | Ga0068863_100663243 | |||
| 923 | Ga0068858_100007268 | |||
| 924 | Ga0068858_100013273 | |||
| 925 | Ga0068858_100015721 | |||
| 926 | Ga0068858_100418804 | |||
| 927 | Ga0068858_100578951 | |||
| 928 | Ga0068858_100701717 | |||
| 929 | Ga0068860_100005291 | |||
| 930 | Ga0068860_100032249 | |||
| 931 | Ga0068860_100237595 | |||
| 932 | Ga0068860_100611894 | |||
| 933 | Ga0068860_100851443 | |||
| 934 | Ga0068860_101058773 | |||
| 935 | Ga0081455_10122137 | |||
| 936 | Ga0070717_10008660 | |||
| 937 | Ga0070717_10010881 | |||
| 938 | Ga0070717_10173728 | |||
| 939 | Ga0097621_100017283 | |||
| 940 | Ga0097621_100037371 | |||
| 941 | Ga0097621_100038178 | |||
| 942 | Ga0097621_100063374 | |||
| 943 | Ga0097621_100241388 | |||
| 944 | Ga0068871_100015277 | |||
| 945 | Ga0068871_100022629 | |||
| 946 | Ga0068871_100034378 | |||
| 947 | Ga0068871_100041480 | |||
| 948 | Ga0068871_100097722 | |||
| 949 | Ga0068871_100563266 | |||
| 950 | Ga0075430_100163260 | |||
| 951 | Ga0075430_100530432 | |||
| 952 | Ga0075431_100002412 | |||
| 953 | Ga0075434_101015522 | |||
| 954 | Ga0068865_100633133 | |||
| 955 | Ga0075436_100640084 | |||
| 956 | Ga0097620_100030378 | |||
| 957 | Ga0097620_100138134 | |||
| 958 | Ga0097620_100157975 | |||
| 959 | Ga0097620_100268857 | |||
| 960 | Ga0097620_100312937 | |||
| 961 | Ga0097620_100824004 | |||
| 962 | Ga0105240_10000476 | |||
| 963 | Ga0105240_10000512 | |||
| 964 | Ga0105240_10001614 | |||
| 965 | Ga0105240_10003078 | |||
| 966 | Ga0105240_10008448 | |||
| 967 | Ga0105240_10018269 | |||
| 968 | Ga0105240_10062337 | |||
| 969 | Ga0105240_10099047 | |||
| 970 | Ga0105240_10366124 | |||
| 971 | Ga0105240_10562935 | |||
| 972 | Ga0105240_10688927 | |||
| 973 | Ga0105245_10002187 | |||
| 974 | Ga0105245_10011779 | |||
| 975 | Ga0105245_10022089 | |||
| 976 | Ga0105245_10035591 | |||
| 977 | Ga0105245_10174062 | |||
| 978 | Ga0105245_10321698 | |||
| 979 | Ga0105245_10323290 | |||
| 980 | Ga0105245_10347799 | |||
| 981 | Ga0105245_10876159 | |||
| 982 | Ga0114129_10194240 | |||
| 983 | Ga0114129_10210433 | |||
| 984 | Ga0114129_10431588 | |||
| 985 | Ga0105243_10077240 | |||
| 986 | Ga0105243_10243613 | |||
| 987 | Ga0105243_10335735 | |||
| 988 | Ga0105241_10007601 | |||
| 989 | Ga0105241_10034600 | |||
| 990 | Ga0105241_10049504 | |||
| 991 | Ga0105241_10082823 | |||
| 992 | Ga0105241_10108042 | |||
| 993 | Ga0105241_10485730 | |||
| 994 | Ga0105241_10577524 | |||
| 995 | Ga0105241_10639889 | |||
| 996 | Ga0105242_10042634 | |||
| 997 | Ga0105242_10066424 | |||
| 998 | Ga0105242_10108998 | |||
| 999 | Ga0105242_10229241 | |||
| 1000 | Ga0105242_10272179 | |||
| 1001 | Ga0105242_10553733 | |||
| 1002 | Ga0105242_11043679 | |||
| 1003 | Ga0105248_10001968 | |||
| 1004 | Ga0105248_10066936 | |||
| 1005 | Ga0105248_10095912 | |||
| 1006 | Ga0105248_10096222 | |||
| 1007 | Ga0105248_10157781 | |||
| 1008 | Ga0105248_10188377 | |||
| 1009 | Ga0105248_10289909 | |||
| 1010 | Ga0105248_10475372 | |||
| 1011 | Ga0105248_10960661 | |||
| 1012 | Ga0105237_10006588 | |||
| 1013 | Ga0105237_10009023 | |||
| 1014 | Ga0105237_10017112 | |||
| 1015 | Ga0105237_10070242 | |||
| 1016 | Ga0105237_10102791 | |||
| 1017 | Ga0105237_10208888 | |||
| 1018 | Ga0105238_10003611 | |||
| 1019 | Ga0105238_10012355 | |||
| 1020 | Ga0105238_10026467 | |||
| 1021 | Ga0105238_10028609 | |||
| 1022 | Ga0105238_10073675 | |||
| 1023 | Ga0105238_10086841 | |||
| 1024 | Ga0105238_10106070 | |||
| 1025 | Ga0105238_10166627 | |||
| 1026 | Ga0105238_10281745 | |||
| 1027 | Ga0105238_10314746 | |||
| 1028 | Ga0105238_10919136 | |||
| 1029 | Ga0105249_10001753 | |||
| 1030 | Ga0105249_10495533 | |||
| 1031 | Ga0105239_10002634 | |||
| 1032 | Ga0105239_10025951 | |||
| 1033 | Ga0105239_10037788 | |||
| 1034 | Ga0105239_10046911 | |||
| 1035 | Ga0105239_10051089 | |||
| 1036 | Ga0105239_10173195 | |||
| 1037 | Ga0105246_10001571 | |||
| 1038 | Ga0105246_10154138 | |||
| 1039 | Ga0157373_10059785 | |||
| 1040 | Ga0157371_10229850 | |||
| 1041 | Ga0157370_10001831 | |||
| 1042 | Ga0157370_10004896 | |||
| 1043 | Ga0157370_10005817 | |||
| 1044 | Ga0157370_10091472 | |||
| 1045 | Ga0157370_10135439 | |||
| 1046 | Ga0157370_10160037 | |||
| 1047 | Ga0157370_10283691 | |||
| 1048 | Ga0157370_10297507 | |||
| 1049 | Ga0157370_10377990 | |||
| 1050 | Ga0157369_10003873 | |||
| 1051 | Ga0157369_10007349 | |||
| 1052 | Ga0157369_10009823 | |||
| 1053 | Ga0157369_10025125 | |||
| 1054 | Ga0157369_10034096 | |||
| 1055 | Ga0157369_10042767 | |||
| 1056 | Ga0157369_10078538 | |||
| 1057 | Ga0157369_10125532 | |||
| 1058 | Ga0157369_10153670 | |||
| 1059 | Ga0157369_10300077 | |||
| 1060 | Ga0157374_10003874 | |||
| 1061 | Ga0157374_10006595 | |||
| 1062 | Ga0157374_10011399 | |||
| 1063 | Ga0157374_10089598 | |||
| 1064 | Ga0157374_10108030 | |||
| 1065 | Ga0157378_10003385 | |||
| 1066 | Ga0157378_10007415 | |||
| 1067 | Ga0157378_10283291 | |||
| 1068 | Ga0163162_10003341 | |||
| 1069 | Ga0163162_10573125 | |||
| 1070 | Ga0157372_10032266 | |||
| 1071 | Ga0157372_10115508 | |||
| 1072 | Ga0157372_10150478 | |||
| 1073 | Ga0157375_10027355 | |||
| 1074 | Ga0157375_10251121 | |||
| 1075 | Ga0157375_10345711 | |||
| 1076 | Ga0157375_10449537 | |||
| 1077 | Ga0157375_10522831 | |||
| 1078 | Ga0157375_10545546 | |||
| 1079 | Ga0157375_10550471 | |||
| 1080 | Ga0163163_10002245 | |||
| 1081 | Ga0163163_10030706 | |||
| 1082 | Ga0163163_10041151 | |||
| 1083 | Ga0163163_10106871 | |||
| 1084 | Ga0163163_10114517 | |||
| 1085 | Ga0163163_10168500 | |||
| 1086 | Ga0157379_10016743 | |||
| 1087 | Ga0157379_10575146 | |||
| 1088 | Ga0157376_10004764 | |||
| 1089 | Ga0157376_10095431 | |||
| 1090 | Ga0157376_10548801 | |||
| 1091 | Ga0157376_10688787 | |||
| 1092 | Ga0157376_10997744 | |||
| 1093 | Ga0206349_1221229 | |||
| 1094 | Ga0213873_10039013 | |||
| 1095 | Ga0213872_10003238 | |||
| 1096 | Ga0213874_10088077 | |||
| 1097 | Ga0213876_10028032 | |||
| 1098 | Ga0213876_10314572 | |||
| 1099 | Ga0213875_10000038 | |||
| 1100 | Ga0213875_10000062 | |||
| 1101 | Ga0213875_10007603 | |||
| 1102 | Ga0213875_10024117 | |||
| 1103 | Ga0213875_10101518 | |||
| 1104 | Ga0213875_10108518 | |||
| 1105 | Ga0213875_10127281 | |||
| 1106 | Ga0207692_10214243 | |||
| 1107 | Ga0207692_10302711 | |||
| 1108 | Ga0207680_10331636 | |||
| 1109 | Ga0207699_10009713 | |||
| 1110 | Ga0207699_10290916 | |||
| 1111 | Ga0207705_10049331 | |||
| 1112 | Ga0207705_10053376 | |||
| 1113 | Ga0207705_10076018 | |||
| 1114 | Ga0207654_10024145 | |||
| 1115 | Ga0207654_10026313 | |||
| 1116 | Ga0207654_10062590 | |||
| 1117 | Ga0207654_10086228 | |||
| 1118 | Ga0207654_10213831 | |||
| 1119 | Ga0207654_10276711 | |||
| 1120 | Ga0207654_10541868 | |||
| 1121 | Ga0207707_10007487 | |||
| 1122 | Ga0207707_10172966 | |||
| 1123 | Ga0207695_10000391 | |||
| 1124 | Ga0207695_10021301 | |||
| 1125 | Ga0207695_10021620 | |||
| 1126 | Ga0207695_10023195 | |||
| 1127 | Ga0207695_10025664 | |||
| 1128 | Ga0207695_10055477 | |||
| 1129 | Ga0207695_10061299 | |||
| 1130 | Ga0207695_10093597 | |||
| 1131 | Ga0207695_10099085 | |||
| 1132 | Ga0207695_10327953 | |||
| 1133 | Ga0207671_10029785 | |||
| 1134 | Ga0207671_10044156 | |||
| 1135 | Ga0207671_10048011 | |||
| 1136 | Ga0207671_10050777 | |||
| 1137 | Ga0207671_10096573 | |||
| 1138 | Ga0207671_10261424 | |||
| 1139 | Ga0207693_10655653 | |||
| 1140 | Ga0207663_10212681 | |||
| 1141 | Ga0207660_10107609 | |||
| 1142 | Ga0207660_10549717 | |||
| 1143 | Ga0207657_10011039 | |||
| 1144 | Ga0207657_10011772 | |||
| 1145 | Ga0207657_10020285 | |||
| 1146 | Ga0207657_10098806 | |||
| 1147 | Ga0207657_10163762 | |||
| 1148 | Ga0207649_10032074 | |||
| 1149 | Ga0207649_10317812 | |||
| 1150 | Ga0207652_10015014 | |||
| 1151 | Ga0207652_10088274 | |||
| 1152 | Ga0207652_10124527 | |||
| 1153 | Ga0207652_10142082 | |||
| 1154 | Ga0207681_10279895 | |||
| 1155 | Ga0207694_10007379 | |||
| 1156 | Ga0207694_10019809 | |||
| 1157 | Ga0207694_10084660 | |||
| 1158 | Ga0207694_10105901 | |||
| 1159 | Ga0207694_10135203 | |||
| 1160 | Ga0207694_10211390 | |||
| 1161 | Ga0207694_10546191 | |||
| 1162 | Ga0207650_10376318 | |||
| 1163 | Ga0207687_10002567 | |||
| 1164 | Ga0207687_10006881 | |||
| 1165 | Ga0207687_10006899 | |||
| 1166 | Ga0207687_10012260 | |||
| 1167 | Ga0207687_10018118 | |||
| 1168 | Ga0207687_10018938 | |||
| 1169 | Ga0207687_10089636 | |||
| 1170 | Ga0207687_10252856 | |||
| 1171 | Ga0207687_10277196 | |||
| 1172 | Ga0207687_10351783 | |||
| 1173 | Ga0207687_10403317 | |||
| 1174 | Ga0207700_10006865 | |||
| 1175 | Ga0207700_10181961 | |||
| 1176 | Ga0207664_10000243 | |||
| 1177 | Ga0207664_10126948 | |||
| 1178 | Ga0207644_10181618 | |||
| 1179 | Ga0207644_10606261 | |||
| 1180 | Ga0207706_10117324 | |||
| 1181 | Ga0207706_10522074 | |||
| 1182 | Ga0207686_10024625 | |||
| 1183 | Ga0207686_10025699 | |||
| 1184 | Ga0207686_10099599 | |||
| 1185 | Ga0207686_10170295 | |||
| 1186 | Ga0207686_10211339 | |||
| 1187 | Ga0207686_10248513 | |||
| 1188 | Ga0207686_10678685 | |||
| 1189 | Ga0207709_10082335 | |||
| 1190 | Ga0207709_10093435 | |||
| 1191 | Ga0207709_10206909 | |||
| 1192 | Ga0207670_10207092 | |||
| 1193 | Ga0207670_10228774 | |||
| 1194 | Ga0207704_10025163 | |||
| 1195 | Ga0207704_10029017 | |||
| 1196 | Ga0207704_10535387 | |||
| 1197 | Ga0207691_10402596 | |||
| 1198 | Ga0207711_10001007 | |||
| 1199 | Ga0207711_10007937 | |||
| 1200 | Ga0207711_10061358 | |||
| 1201 | Ga0207711_10078285 | |||
| 1202 | Ga0207711_10082604 | |||
| 1203 | Ga0207711_10133767 | |||
| 1204 | Ga0207711_10213694 | |||
| 1205 | Ga0207689_10022089 | |||
| 1206 | Ga0207689_10168173 | |||
| 1207 | Ga0207661_10000034 | |||
| 1208 | Ga0207661_10002034 | |||
| 1209 | Ga0207661_10005480 | |||
| 1210 | Ga0207661_10059166 | |||
| 1211 | Ga0207661_10230110 | |||
| 1212 | Ga0207661_10624849 | |||
| 1213 | Ga0207679_10015828 | |||
| 1214 | Ga0207679_10075535 | |||
| 1215 | Ga0207679_10195418 | |||
| 1216 | Ga0207667_10005205 | |||
| 1217 | Ga0207667_10009407 | |||
| 1218 | Ga0207667_10025046 | |||
| 1219 | Ga0207667_10025758 | |||
| 1220 | Ga0207667_10066800 | |||
| 1221 | Ga0207667_10216718 | |||
| 1222 | Ga0207667_10320444 | |||
| 1223 | Ga0207651_10107272 | |||
| 1224 | Ga0207712_10001973 | |||
| 1225 | Ga0207658_10123897 | |||
| 1226 | Ga0207658_10229278 | |||
| 1227 | Ga0207677_10076391 | |||
| 1228 | Ga0207677_10130357 | |||
| 1229 | Ga0207677_10290142 | |||
| 1230 | Ga0207677_10496238 | |||
| 1231 | Ga0207703_10006427 | |||
| 1232 | Ga0207703_10009108 | |||
| 1233 | Ga0207703_10063903 | |||
| 1234 | Ga0207703_10065078 | |||
| 1235 | Ga0207639_10025331 | |||
| 1236 | Ga0207639_10263691 | |||
| 1237 | Ga0207639_10507593 | |||
| 1238 | Ga0207639_10594819 | |||
| 1239 | Ga0207678_10030369 | |||
| 1240 | Ga0207678_10526320 | |||
| 1241 | Ga0207678_10601572 | |||
| 1242 | Ga0207708_10275622 | |||
| 1243 | Ga0207702_10002595 | |||
| 1244 | Ga0207702_10011666 | |||
| 1245 | Ga0207702_10024177 | |||
| 1246 | Ga0207702_10037503 | |||
| 1247 | Ga0207702_10041531 | |||
| 1248 | Ga0207702_10153922 | |||
| 1249 | Ga0207702_10199833 | |||
| 1250 | Ga0207641_10004312 | |||
| 1251 | Ga0207641_10048045 | |||
| 1252 | Ga0207648_10644344 | |||
| 1253 | Ga0207648_10716372 | |||
| 1254 | Ga0207676_10125194 | |||
| 1255 | Ga0207676_10478500 | |||
| 1256 | Ga0207676_10759169 | |||
| 1257 | Ga0207676_10879253 | |||
| 1258 | Ga0207674_10001768 | |||
| 1259 | Ga0207674_10005073 | |||
| 1260 | Ga0207675_100139949 | |||
| 1261 | Ga0207675_100374378 | |||
| 1262 | Ga0207683_10168069 | |||
| 1263 | Ga0207698_10007422 | |||
| 1264 | Ga0207698_10132464 | |||
| 1265 | Ga0207698_10537449 | |||
| 1266 | Ga0207698_11124874 | |||
| 1267 | Ga0268266_10012462 | |||
| 1268 | Ga0268266_10014513 | |||
| 1269 | Ga0268266_10053425 | |||
| 1270 | Ga0268266_10571109 | |||
| 1271 | Ga0268264_10015609 | |||
| 1272 | Ga0265323_10001695 | |||
| 1273 | Ga0265338_10062885 | |||
| 1274 | Ga0265338_10125059 | |||
| 1275 | Ga0265330_10119594 | |||
| 1276 | Ga0265332_10069475 | |||
| 1277 | Ga0265328_10028498 | |||
| 1278 | Ga0265320_10011089 | |||
| 1279 | Ga0265329_10028547 | |||
| 1280 | Ga0265340_10072786 | |||
| 1281 | Ga0265339_10081644 | |||
| 1282 | Ga0265331_10004555 | |||
| 1283 | Ga0265331_10007736 | |||
| 1284 | Ga0265331_10036214 | |||
| 1285 | Ga0265331_10111592 | |||
| 1286 | Ga0265316_10002711 | |||
| 1287 | Ga0265316_10003486 | |||
| 1288 | Ga0265316_10019660 | |||
| 1289 | Ga0265316_10025064 | |||
| 1290 | Ga0265316_10046149 | |||
| 1291 | Ga0265316_10048282 | |||
| 1292 | Ga0265316_10057326 | |||
| 1293 | Ga0265316_10250029 | |||
| 1294 | Ga0265313_10003093 | |||
| 1295 | Ga0265314_10000463 | |||
| 1296 | Ga0265314_10000763 | |||
| 1297 | Ga0265314_10035179 | |||
| 1298 | Ga0265314_10116234 | |||
| 1299 | Ga0265342_10114026 | |||
| 1300 | Ga0373926_0058906 | |||
| 1301 | Ga0373934_0025573 | |||
| 1302 | Ga0373923_0033751 | |||
| 1303 | Ga0373936_0183873 | |||
| 1304 | Ga0373939_0068509 | |||
| 1305 | Ga0373945_0128240 | |||
| 1306 | Ga0373953_0006782 | |||
| 1307 | Ga0373953_0017360 | |||
| 1308 | Ga0373953_0046076 | |||
| 1309 | Ga0373953_0073134 | |||
| 1310 | Ga0373954_0006291 | |||
| 1311 | Ga0373954_0007483 | |||
| 1312 | Ga0373954_0048928 | |||
| 1313 | Ga0373956_0026065 | |||
| 1314 | Ga0373956_0099952 | |||
| 1315 | Ga0373957_0153447 | |||
| 1316 | Ga0373943_0035231 | |||
| 1317 | Ga0373946_0066642 | |||
| 1318 | Ga0373946_0096413 | |||
| 1319 | Ga0373955_0359834 | |||
| 1320 | Ga0373955_0432333 | |||
| 1321 | Ga0373955_0443876 | |||
| 1322 | Ga0373931_0193530 | |||
| 1323 | Ga0373935_0023490 | |||
| 1324 | Ga0373935_0038674 | |||
| 1325 | Ga0373935_0075536 | |||
| 1326 | Ga0373935_0099346 | |||
| 1327 | Ga0373935_0326222 | |||
| 1328 | Ga0373935_0462975 | |||
| 1329 | Ga0373927_0000693 | |||
| 1330 | Ga0373927_0008989 | |||
| 1331 | Ga0373927_0009091 | |||
| 1332 | Ga0373927_0041626 | |||
| 1333 | Ga0373927_0142350 | |||
| 1334 | Ga0373927_0330146 | |||
| 1335 | Ga0373927_0382002 | |||
| 1336 | Ga0373933_0007991 | |||
| 1337 | Ga0373933_0428432 | |||
| 1338 | Ga0373947_0004248 | |||
| 1339 | Ga0373947_0005444 | |||
| 1340 | Ga0373947_0138468 | |||
| 1341 | Ga0373937_0013196 | |||
| 1342 | Ga0373937_0019184 | |||
| 1343 | Ga0373937_0022623 | |||
| 1344 | Ga0373937_0041526 | |||
| 1345 | Ga0373937_0061945 | |||
| 1346 | Ga0373937_0093980 | |||
| 1347 | Ga0373937_0127081 | |||
| 1348 | Ga0373937_0256146 | |||
| 1349 | Ga0373937_0609042 | |||
| 1350 | Ga0373925_0005661 | |||
| 1351 | Ga0373925_0009298 | |||
| 1352 | Ga0373925_0046235 | |||
| 1353 | Ga0373925_0070541 | |||
| 1354 | Ga0373925_0084910 | |||
| 1355 | Ga0373925_0119521 | |||
| 1356 | Ga0373925_0172937 | |||
| 1357 | Ga0373925_0325816 | |||
| 1358 | Ga0373925_0351600 | |||
| 1359 | Ga0373925_0600910 | |||
| 1360 | Ga0395900_0270844 | |||
| 1361 | Ga0436364_0031755 | |||
| 1362 | Ga0436364_0061193 | |||
| 1363 | Ga0436364_0116838 | |||
| 1364 | Ga0436364_0155407 | |||
| 1365 | Ga0436364_0404360 | |||
| 1366 | Ga0436364_0451172 | |||
| 1367 | Ga0436364_0692444 | |||
| 1368 | Ga0436364_0752221 | |||
| 1369 | Ga0436364_0789899 | |||
| 1370 | Ga0436364_0799077 | |||
| 1371 | Ga0436364_0991316 | |||
| 1372 | Ga0436364_1019864 | |||
| 1373 | Ga0436364_1065030 | |||
| 1374 | Ga0436364_1155435 | |||
| 1375 | Ga0436364_1285749 | |||
| 1376 | Ga0436364_1321932 | |||
| 1377 | Ga0436364_1424606 | |||
| 1378 | Ga0436364_1498390 | |||
| 1379 | Ga0436364_1530732 | |||
| 1380 | Ga0436365_0108255 | |||
| 1381 | Ga0436365_0352593 | |||
| 1382 | Ga0436365_0419695 | |||
| 1383 | Ga0436365_0540111 | |||
| 1384 | Ga0436365_0573506 | |||
| 1385 | Ga0436365_0965866 | |||
| 1386 | Ga0436365_1375986 | |||
| 1387 | Ga0436365_1556196 | |||
| 1388 | Ga0436360_0186249 | |||
| 1389 | Ga0436360_1019100 | |||
| 1390 | Ga0436360_1294045 | |||
| 1391 | Ga0436361_0863641 | |||
| 1392 | Ga0436363_0043746 | |||
| 1393 | Ga0436363_0221023 | |||
| 1394 | Ga0436363_0308712 | |||
| 1395 | Ga0436362_0077579 | |||
| 1396 | Ga0436362_0318356 | |||
| 1397 | Ga0436362_0779550 | |||
| 1398 | Ga0436362_0866484 | |||
| 1399 | Ga0451576_0230137 | |||
| 1400 | Ga0451576_0629547 | |||
| 1401 | Ga0466958_0278037 | |||
| 1402 | Ga0466967_0223594 | |||
| 1403 | Ga0495592_0007212 | |||
| 1404 | Ga0495592_0038518 | |||
| 1405 | Ga0495651_0142144 | |||
| 1406 | Ga0495651_0230987 | |||
| 1407 | Ga0495580_0006186 | |||
| 1408 | Ga0495580_0006440 | |||
| 1409 | Ga0495580_0015358 | |||
| 1410 | Ga0495580_0026441 | |||
| 1411 | Ga0495580_0041349 | |||
| 1412 | Ga0495580_0067700 | |||
| 1413 | Ga0495580_0070112 | |||
| 1414 | Ga0495580_0071381 | |||
| 1415 | Ga0495580_0080577 | |||
| 1416 | Ga0495582_0126458 | |||
| 1417 | Ga0495662_0014992 | |||
| 1418 | Ga0495664_0169299 | |||
| 1419 | Ga0495664_0269159 | |||
| 1420 | Ga0495594_0019018 | |||
| 1421 | Ga0495594_0149550 | |||
| 1422 | Ga0495608_0107531 | |||
| 1423 | Ga0495618_0134125 | |||
| 1424 | Ga0495628_0237823 | |||
| 1425 | Ga0495630_0031393 | |||
| 1426 | Ga0495630_0442243 | |||
| 1427 | Ga0495666_0174668 | |||
| 1428 | Ga0495652_0005190 | |||
| 1429 | Ga0495652_0532967 | |||
| 1430 | Ga0495665_0068594 | |||
| 1431 | Ga0495665_0111636 | |||
| 1432 | Ga0495665_0175850 | |||
| 1433 | Ga0495586_0036444 | |||
| 1434 | Ga0495587_0003616 | |||
| 1435 | Ga0495587_0038848 | |||
| 1436 | Ga0495587_0057715 | |||
| 1437 | Ga0495587_0117439 | |||
| 1438 | Ga0495645_0004183 | |||
| 1439 | Ga0495645_0103954 | |||
| 1440 | Ga0495645_0107106 | |||
| 1441 | Ga0495645_0340261 | |||
| 1442 | Ga0495667_0056415 | |||
| 1443 | Ga0495667_0158318 | |||
| 1444 | Ga0495634_0011585 | |||
| 1445 | Ga0495634_0013158 | |||
| 1446 | Ga0495635_0185267 | |||
| 1447 | Ga0495635_0197057 | |||
| 1448 | Ga0495635_0332788 | |||
| 1449 | Ga0495657_0170196 | |||
| 1450 | Ga0495599_0001158 | |||
| 1451 | Ga0495599_0043705 | |||
| 1452 | Ga0495599_0162147 | |||
| 1453 | Ga0495623_0129681 | |||
| 1454 | Ga0495623_0131240 | |||
| 1455 | Ga0495646_0161268 | |||
| 1456 | Ga0495658_0057476 | |||
| 1457 | Ga0495613_0145337 | |||
| 1458 | Ga0495613_0192240 | |||
| 1459 | Ga0495600_0449384 | |||
| 1460 | Ga0495604_0071930 | |||
| 1461 | Ga0495604_0082344 | |||
| 1462 | Ga0495674_0006809 | |||
| 1463 | Ga0495674_0046440 | |||
| 1464 | Ga0495674_0129054 | |||
| 1465 | Ga0495674_0761732 | |||
| 1466 | Ga0495680_0074584 | |||
| 1467 | Ga0495675_0021967 | |||
| 1468 | Ga0495684_0060464 | |||
| 1469 | Ga0495684_0097138 | |||
| 1470 | Ga0495684_0265914 | |||
| 1471 | Ga0495602_0001423 | |||
| 1472 | Ga0495602_0080166 | |||
| 1473 | Ga0495602_0445267 | |||
| 1474 | Ga0496102_0433605 | |||
| 1475 | Ga0496104_0286429 | |||
| 1476 | Ga0496104_0764777 | |||
| 1477 | Ga0496112_0006624 | |||
| 1478 | Ga0496112_0262123 | |||
| 1479 | Ga0496115_0006544 | |||
| 1480 | Ga0496115_0269313 | |||
| 1481 | Ga0496115_0313374 | |||
| 1482 | Ga0501031_0004453 | |||
| 1483 | Ga0501031_0121220 | |||
| 1484 | Ga0501032_0002278 | |||
| 1485 | Ga0501032_0054654 | |||
| 1486 | Ga0501033_0005380 | |||
| 1487 | Ga0501033_0017899 | |||
| 1488 | Ga0501034_0007141 | |||
| 1489 | Ga0501034_0010051 | |||
| 1490 | Ga0501034_0013159 | |||
| 1491 | Ga0501034_0235588 | |||
| 1492 | Ga0501036_0000329 | |||
| 1493 | Ga0501036_0000498 | |||
| 1494 | Ga0501037_0013717 | |||
| 1495 | Ga0501038_0012838 | |||
| 1496 | Ga0501038_0013541 | |||
| 1497 | Ga0501038_0080025 | |||
| 1498 | Ga0501039_0018465 | |||
| 1499 | Ga0501039_0180790 | |||
| 1500 | Ga0501040_0435654 | |||
| 1501 | Ga0501042_0090194 | |||
| 1502 | Ga0501043_0006639 | |||
| 1503 | Ga0501043_0006983 | |||
| 1504 | Ga0501046_0001380 | |||
| 1505 | Ga0501046_0002887 | |||
| 1506 | Ga0501046_0038558 | |||
| 1507 | Ga0501047_0004568 | |||
| 1508 | Ga0501047_0008173 | |||
| 1509 | Ga0501047_0028507 | |||
| 1510 | Ga0501047_0029771 | |||
| 1511 | Ga0501048_0167741 | |||
| 1512 | Ga0501067_0007862 | |||
| 1513 | Ga0501067_0017255 | |||
| 1514 | Ga0501068_0000768 | |||
| 1515 | Ga0501068_0001224 | |||
| 1516 | Ga0501069_0003086 | |||
| 1517 | Ga0501069_0015707 | |||
| 1518 | Ga0501070_0006405 | |||
| 1519 | Ga0501070_0009865 | |||
| 1520 | Ga0501070_0038634 | |||
| 1521 | Ga0501070_0087889 | |||
| 1522 | Ga0501072_0000320 | |||
| 1523 | Ga0501072_0041536 | |||
| 1524 | Ga0501073_0000432 | |||
| 1525 | Ga0501073_0059590 | |||
| 1526 | Ga0501074_0025861 | |||
| 1527 | Ga0501074_0041722 | |||
| 1528 | Ga0501076_0034374 | |||
| 1529 | Ga0501076_0143430 | |||
| 1530 | Ga0501077_0000457 | |||
| 1531 | Ga0501077_0009559 | |||
| 1532 | Ga0501079_0001554 | |||
| 1533 | Ga0501079_0014989 | |||
| 1534 | Ga0501080_0000559 | |||
| 1535 | Ga0501080_0002238 | |||
| 1536 | Ga0501083_0009706 | |||
| 1537 | Ga0501035_0018483 | |||
| 1538 | Ga0501035_0042942 | |||
| 1539 | Ga0501044_0002364 | |||
| 1540 | Ga0501044_0014229 | |||
| 1541 | Ga0501044_0017624 | |||
| 1542 | Ga0501044_0110693 | |||
| 1543 | Ga0501045_0124371 | |||
| 1544 | nmdc:mga05p37_245765_c1 | |||
| 1545 | nmdc:mga06r32_27179_c1 | |||
| 1546 | nmdc:mga08x19_593576_c1 | |||
| 1547 | Ga0495601_0058669 | |||
| 1548 | Ga0495601_0238188 | |||
| 1549 | Ga0495619_0189046 | |||
| 1550 | Ga0500568_0007085 | |||
| 1551 | Ga0501084_0002600 | |||
| 1552 | Ga0501084_0002811 | |||
| 1553 | Ga0501082_0001311 | |||
| 1554 | Ga0501082_0008060 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.971 | 1 | 80 |
| 1mb3-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ | 0.9679 | 1 | 80 |
| 1mav-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ | 0.9674 | 1 | 82 |
| 5za3-assembly1.cif.gz_B | structure of a c-terminal s. mutans response regulator vicr domain | 0.9487 | 128 | 223 |
| 2d1v-assembly1.cif.gz_A | crystal structure of dna-binding domain of bacillus subtilis yycf | 0.9483 | 127 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9526 | 1 | 83 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9505 | 1 | 83 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9502 | 1 | 83 | 3.40.50.2300 |
| 5za3A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9475 | 128 | 224 | 1.10.10.10 |
| 3r0jA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9471 | 128 | 223 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9GE60-F1-model_v4 | DNA-binding response regulator | 0.9693 | 128 | 204 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0R2NUL5-F1-model_v4 | Response regulator | 0.9668 | 129 | 227 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1F5Y9K7-F1-model_v4 | Response regulatory domain-containing protein | 0.9537 | 3 | 80 |
GO:0000160
|
| AF-A0A1R1SPM0-F1-model_v4 | Two-component system response regulator | 0.9499 | 2 | 80 |
GO:0000160
|
| AF-A0A3R9VID6-F1-model_v4 | deleted | 0.9497 | 128 | 226 |
|