F480318

General Info

Members Datasets Scaffolds Average Seq Length
776 338 772 124

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000395|Ga0265337_100039523
Length 118
Sequence MPPPDGAAAGALAWGTGAPGTGAGHIEAVAEQVFIALADPSRRAILAALAGAGPATAALLTEAGLVTAEPGERRRVRYRLHSAPMRVAQQFLAALARDWDGPLGALKDHLDKQAGAPA

Samples

Sample ID Description Type Environment
1 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
2 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
101 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.16
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 10.82
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003182 3300002459 Bacteria 3309
2 Ga0070658_10040464 3300005327 Bacteria 3760
3 Ga0070658_11657079 3300005327 Bacteria 554
4 Ga0070676_10331454 3300005328 Bacteria 1041
5 Ga0070683_100052373 3300005329 Bacteria 3781
6 Ga0070683_100796339 3300005329 Bacteria 906
7 Ga0070683_101308524 3300005329 Bacteria 696
8 Ga0070690_101437926 3300005330 Bacteria 556
9 Ga0070670_100255372 3300005331 Bacteria 1527
10 Ga0068869_100110630 3300005334 Bacteria 2089
11 Ga0070666_10614291 3300005335 Bacteria 794
12 Ga0070680_100711232 3300005336 Bacteria 864
13 Ga0070682_100025511 3300005337 Bacteria 3528
14 Ga0070682_100319565 3300005337 Bacteria 1146
15 Ga0070682_100884637 3300005337 Bacteria 733
16 Ga0068868_100242163 3300005338 Bacteria 1516
17 Ga0068868_100557480 3300005338 Bacteria 1010
18 Ga0068868_100581055 3300005338 Bacteria 990
19 Ga0068868_101424320 3300005338 Bacteria 647
20 Ga0070660_100313786 3300005339 Bacteria 1287
21 Ga0070689_100116724 3300005340 Bacteria 2128
22 Ga0070691_10026408 3300005341 Bacteria 2706
23 Ga0070687_101317826 3300005343 Bacteria 537
24 Ga0070661_100151274 3300005344 Bacteria 1754
25 Ga0070692_10013899 3300005345 Bacteria 3763
26 Ga0070675_100124838 3300005354 Bacteria 2189
27 Ga0070675_100844610 3300005354 Bacteria 838
28 Ga0070671_100005402 3300005355 Bacteria 10189
29 Ga0070674_100436357 3300005356 Bacteria 1078
30 Ga0070673_100314174 3300005364 Bacteria 1383
31 Ga0070673_100318813 3300005364 Bacteria 1373
32 Ga0070673_101752924 3300005364 Bacteria 588
33 Ga0070688_100100420 3300005365 Bacteria 1907
34 Ga0070659_100030882 3300005366 Bacteria 4147
35 Ga0070659_100394351 3300005366 Bacteria 1168
36 Ga0070667_100435226 3300005367 Bacteria 1197
37 Ga0070667_101851071 3300005367 Bacteria 568
38 Ga0070709_10028810 3300005434 Bacteria 3315
39 Ga0070709_10096367 3300005434 Bacteria 1961
40 Ga0070709_10337100 3300005434 Bacteria 1111
41 Ga0070709_10400314 3300005434 Bacteria 1025
42 Ga0070714_100000937 3300005435 Bacteria 20745
43 Ga0070714_100136993 3300005435 Bacteria 2193
44 Ga0070714_100392814 3300005435 Bacteria 1310
45 Ga0070714_100624457 3300005435 Bacteria 1036
46 Ga0070714_100659508 3300005435 Bacteria 1008
47 Ga0070714_100730257 3300005435 Bacteria 956
48 Ga0070714_101139138 3300005435 Bacteria 761
49 Ga0070713_100021731 3300005436 Bacteria 4943
50 Ga0070713_100030293 3300005436 Bacteria 4296
51 Ga0070713_100031660 3300005436 Bacteria 4216
52 Ga0070713_100156458 3300005436 Bacteria 2032
53 Ga0070713_100175596 3300005436 Bacteria 1922
54 Ga0070713_100263862 3300005436 Bacteria 1575
55 Ga0070713_100323660 3300005436 Bacteria 1424
56 Ga0070713_100573788 3300005436 Bacteria 1070
57 Ga0070713_100592023 3300005436 Bacteria 1053
58 Ga0070713_100614444 3300005436 Bacteria 1033
59 Ga0070713_101002666 3300005436 Bacteria 806
60 Ga0070713_101498763 3300005436 Bacteria 654
61 Ga0070710_10110023 3300005437 Bacteria 1654
62 Ga0070710_10190195 3300005437 Bacteria 1290
63 Ga0070710_10249046 3300005437 Bacteria 1141
64 Ga0070711_100013342 3300005439 Bacteria 5159
65 Ga0070711_100025647 3300005439 Bacteria 3858
66 Ga0070711_100243365 3300005439 Bacteria 1407
67 Ga0070711_100425451 3300005439 Bacteria 1083
68 Ga0070711_100710542 3300005439 Bacteria 847
69 Ga0070711_101064194 3300005439 Bacteria 696
70 Ga0070705_100127804 3300005440 Bacteria 1653
71 Ga0070705_100611013 3300005440 Bacteria 845
72 Ga0070700_100033987 3300005441 Bacteria 3075
73 Ga0070663_100016494 3300005455 Bacteria 4800
74 Ga0070663_100122415 3300005455 Bacteria 1966
75 Ga0070663_100448047 3300005455 Bacteria 1063
76 Ga0070678_100503563 3300005456 Bacteria 1069
77 Ga0070678_100567890 3300005456 Bacteria 1009
78 Ga0070678_101035630 3300005456 Bacteria 756
79 Ga0070678_101122991 3300005456 Bacteria 726
80 Ga0070662_100511848 3300005457 Bacteria 1002
81 Ga0070662_101162242 3300005457 Bacteria 663
82 Ga0070681_10032437 3300005458 Bacteria 5242
83 Ga0070685_10231754 3300005466 Bacteria 1215
84 Ga0070706_100297573 3300005467 Bacteria 1506
85 Ga0070706_100563986 3300005467 Bacteria 1059
86 Ga0070706_100872534 3300005467 Bacteria 832
87 Ga0070706_101152073 3300005467 Unclassified 713
88 Ga0070707_100005889 3300005468 Bacteria 11433
89 Ga0070707_100020582 3300005468 Bacteria 6225
90 Ga0070707_101950411 3300005468 Bacteria 555
91 Ga0070698_100384244 3300005471 Bacteria 1337
92 Ga0070698_101397775 3300005471 Bacteria 651
93 Ga0070679_100034523 3300005530 Bacteria 5013
94 Ga0070679_100174074 3300005530 Bacteria 2125
95 Ga0070679_100368759 3300005530 Bacteria 1383
96 Ga0070684_100114599 3300005535 Bacteria 2420
97 Ga0070684_100238972 3300005535 Bacteria 1659
98 Ga0070684_100611980 3300005535 Bacteria 1013
99 Ga0070684_101307283 3300005535 Bacteria 682
100 Ga0070684_102158659 3300005535 Bacteria 525
101 Ga0070686_100460688 3300005544 Bacteria 979
102 Ga0070686_100644652 3300005544 Bacteria 839
103 Ga0070695_101069987 3300005545 Bacteria 659
104 Ga0070693_100348721 3300005547 Bacteria 1012
105 Ga0070665_100019562 3300005548 Bacteria 6797
106 Ga0070665_100150342 3300005548 Bacteria 2331
107 Ga0070665_100208055 3300005548 Bacteria 1957
108 Ga0070704_100507319 3300005549 Bacteria 1048
109 Ga0068855_100573435 3300005563 Bacteria 1219
110 Ga0070664_100131133 3300005564 Bacteria 2201
111 Ga0070664_100572186 3300005564 Bacteria 1046
112 Ga0070664_100859371 3300005564 Bacteria 850
113 Ga0070664_100892212 3300005564 Bacteria 833
114 Ga0070664_102166292 3300005564 Bacteria 527
115 Ga0068857_100769685 3300005577 Bacteria 918
116 Ga0068857_100906072 3300005577 Bacteria 846
117 Ga0068857_100926014 3300005577 Bacteria 836
118 Ga0068854_101810018 3300005578 Bacteria 560
119 Ga0068856_100042296 3300005614 Bacteria 4482
120 Ga0068856_100158753 3300005614 Bacteria 2272
121 Ga0068856_101427183 3300005614 Bacteria 706
122 Ga0070702_100000699 3300005615 Bacteria 12654
123 Ga0070702_100326675 3300005615 Bacteria 1071
124 Ga0070702_100876734 3300005615 Bacteria 701
125 Ga0068852_100017058 3300005616 Bacteria 5687
126 Ga0068859_100355094 3300005617 Bacteria 1561
127 Ga0068859_101562035 3300005617 Bacteria 729
128 Ga0068859_102774994 3300005617 Bacteria 538
129 Ga0068864_100180116 3300005618 Bacteria 1932
130 Ga0068864_100189578 3300005618 Bacteria 1884
131 Ga0068864_100295598 3300005618 Bacteria 1515
132 Ga0068864_100497376 3300005618 Bacteria 1172
133 Ga0068864_100511097 3300005618 Bacteria 1157
134 Ga0068864_100611038 3300005618 Bacteria 1059
135 Ga0068851_10018753 3300005834 Bacteria 3338
136 Ga0068851_10098824 3300005834 Bacteria 1546
137 Ga0068870_10037245 3300005840 Bacteria 2506
138 Ga0068870_10410050 3300005840 Bacteria 884
139 Ga0068863_100014461 3300005841 Bacteria 7602
140 Ga0068863_100225369 3300005841 Bacteria 1807
141 Ga0068863_100588458 3300005841 Bacteria 1101
142 Ga0068863_100657588 3300005841 Bacteria 1040
143 Ga0068858_100007085 3300005842 Bacteria 10884
144 Ga0068858_100766011 3300005842 Bacteria 941
145 Ga0068862_100930876 3300005844 Bacteria 856
146 Ga0081455_10012740 3300005937 Bacteria 8365
147 Ga0081540_1000130 3300005983 Bacteria 80050
148 Ga0081540_1018759 3300005983 Bacteria 4229
149 Ga0081539_10184408 3300005985 Bacteria 976
150 Ga0070717_10011647 3300006028 Bacteria 6689
151 Ga0070717_10080331 3300006028 Bacteria 2736
152 Ga0070717_10133495 3300006028 Bacteria 2137
153 Ga0070717_10215727 3300006028 Bacteria 1685
154 Ga0070717_10218010 3300006028 Bacteria 1676
155 Ga0070717_10247061 3300006028 Bacteria 1575
156 Ga0070717_10354842 3300006028 Bacteria 1312
157 Ga0070717_11232435 3300006028 Bacteria 681
158 Ga0075432_10078620 3300006058 Bacteria 1193
159 Ga0070715_10001007 3300006163 Bacteria 7919
160 Ga0070715_10158032 3300006163 Bacteria 1117
161 Ga0070716_100028331 3300006173 Bacteria 3017
162 Ga0070716_100080873 3300006173 Bacteria 1938
163 Ga0070716_100449537 3300006173 Bacteria 939
164 Ga0070712_100032518 3300006175 Bacteria 3523
165 Ga0070712_100049959 3300006175 Bacteria 2907
166 Ga0070712_100290209 3300006175 Bacteria 1320
167 Ga0070712_100333417 3300006175 Bacteria 1237
168 Ga0070712_100453204 3300006175 Bacteria 1068
169 Ga0070712_100818426 3300006175 Bacteria 800
170 Ga0070712_101179353 3300006175 Bacteria 666
171 Ga0075367_10798380 3300006178 Bacteria 601
172 Ga0097621_100012139 3300006237 Bacteria 6374
173 Ga0097621_100388232 3300006237 Bacteria 1248
174 Ga0068871_100114640 3300006358 Bacteria 2271
175 Ga0068871_100463449 3300006358 Bacteria 1138
176 Ga0068871_100709426 3300006358 Bacteria 922
177 Ga0075428_100712971 3300006844 Bacteria 1068
178 Ga0075430_101391243 3300006846 Bacteria 577
179 Ga0075431_100340777 3300006847 Bacteria 1509
180 Ga0075433_10030854 3300006852 Bacteria 4577
181 Ga0075434_100008238 3300006871 Bacteria 9678
182 Ga0075434_100028027 3300006871 Bacteria 5531
183 Ga0075429_100327577 3300006880 Bacteria 1340
184 Ga0068865_101285523 3300006881 Bacteria 650
185 Ga0075436_100119535 3300006914 Bacteria 1843
186 Ga0075436_100451878 3300006914 Bacteria 936
187 Ga0097620_100355098 3300006931 Bacteria 1561
188 Ga0097620_101562085 3300006931 Bacteria 729
189 Ga0097620_102774409 3300006931 Bacteria 538
190 Ga0075435_100085064 3300007076 Bacteria 2603
191 Ga0075435_100132301 3300007076 Bacteria 2087
192 Ga0099794_10227437 3300007265 Bacteria 959
193 Ga0099794_10232037 3300007265 Bacteria 950
194 Ga0111539_10066323 3300009094 Bacteria 4264
195 Ga0111539_10614608 3300009094 Bacteria 1266
196 Ga0111539_12256436 3300009094 Bacteria 631
197 Ga0105245_10012353 3300009098 Bacteria 7430
198 Ga0105245_10171636 3300009098 Bacteria 2066
199 Ga0105245_10306220 3300009098 Bacteria 1561
200 Ga0105245_10779848 3300009098 Bacteria 993
201 Ga0105245_10864737 3300009098 Bacteria 945
202 Ga0105247_10269257 3300009101 Bacteria 1171
203 Ga0105247_10383658 3300009101 Bacteria 997
204 Ga0105247_10645988 3300009101 Bacteria 790
205 Ga0105247_10916399 3300009101 Bacteria 678
206 Ga0114129_10385042 3300009147 Bacteria 1851
207 Ga0114129_10679304 3300009147 Bacteria 1326
208 Ga0114129_11021087 3300009147 Bacteria 1040
209 Ga0105243_10592473 3300009148 Bacteria 1066
210 Ga0105241_10008085 3300009174 Bacteria 7738
211 Ga0105241_10501419 3300009174 Bacteria 1082
212 Ga0105242_10569302 3300009176 Bacteria 1089
213 Ga0105242_10899249 3300009176 Bacteria 885
214 Ga0105248_10493782 3300009177 Bacteria 1380
215 Ga0105248_10592881 3300009177 Bacteria 1250
216 Ga0105237_10158460 3300009545 Bacteria 2261
217 Ga0105238_10026472 3300009551 Bacteria 5914
218 Ga0105249_10115493 3300009553 Bacteria 2543
219 Ga0105249_10275336 3300009553 Bacteria 1678
220 Ga0105249_12494479 3300009553 Bacteria 589
221 Ga0105239_10417257 3300010375 Bacteria 1520
222 Ga0105239_10870195 3300010375 Bacteria 1034
223 Ga0105239_11816212 3300010375 Bacteria 706
224 Ga0105239_12530365 3300010375 Bacteria 598
225 Ga0105246_10004526 3300011119 Bacteria 8457
226 Ga0105246_10069132 3300011119 Bacteria 2479
227 Ga0105246_10687854 3300011119 Bacteria 895
228 Ga0105246_10771941 3300011119 Bacteria 850
229 Ga0105246_10844507 3300011119 Bacteria 816
230 Ga0105246_11488007 3300011119 Bacteria 635
231 Ga0157320_1004200 3300012481 Bacteria 909
232 Ga0157329_1001096 3300012491 Bacteria 1295
233 Ga0157371_10086727 3300013102 Bacteria 2217
234 Ga0157370_10024014 3300013104 Bacteria 6045
235 Ga0157370_10309511 3300013104 Bacteria 1458
236 Ga0157369_10059476 3300013105 Bacteria 4120
237 Ga0157369_10290741 3300013105 Bacteria 1701
238 Ga0157369_10586110 3300013105 Bacteria 1152
239 Ga0157369_11501494 3300013105 Bacteria 685
240 Ga0157374_10015605 3300013296 Bacteria 6667
241 Ga0157374_10565468 3300013296 Unclassified 1145
242 Ga0157374_11097550 3300013296 Bacteria 816
243 Ga0157378_10727701 3300013297 Bacteria 1013
244 Ga0163162_10704482 3300013306 Bacteria 1131
245 Ga0163162_10800267 3300013306 Bacteria 1060
246 Ga0163162_10814133 3300013306 Bacteria 1051
247 Ga0157372_10993195 3300013307 Bacteria 972
248 Ga0157372_12408752 3300013307 Bacteria 604
249 Ga0157372_12481884 3300013307 Bacteria 595
250 Ga0157375_10138437 3300013308 Bacteria 2559
251 Ga0157375_10262065 3300013308 Bacteria 1890
252 Ga0157375_10291180 3300013308 Bacteria 1796
253 Ga0157375_10402962 3300013308 Bacteria 1535
254 Ga0163163_10277423 3300014325 Bacteria 1727
255 Ga0163163_10362961 3300014325 Bacteria 1505
256 Ga0163163_10486663 3300014325 Bacteria 1295
257 Ga0163163_10541370 3300014325 Bacteria 1226
258 Ga0163163_10561257 3300014325 Bacteria 1204
259 Ga0163163_10961725 3300014325 Bacteria 917
260 Ga0163163_11424862 3300014325 Bacteria 754
261 Ga0157380_10627038 3300014326 Bacteria 1068
262 Ga0157380_10662032 3300014326 Bacteria 1043
263 Ga0182008_10262034 3300014497 Bacteria 894
264 Ga0182008_10988643 3300014497 Bacteria 501
265 Ga0157377_10063184 3300014745 Bacteria 2120
266 Ga0157377_10184400 3300014745 Bacteria 1315
267 Ga0157377_11070178 3300014745 Bacteria 616
268 Ga0157379_10690337 3300014968 Bacteria 958
269 Ga0157379_10696713 3300014968 Bacteria 953
270 Ga0157376_10958946 3300014969 Bacteria 876
271 Ga0157376_11133679 3300014969 Bacteria 809
272 Ga0157376_11436643 3300014969 Bacteria 722
273 Ga0163161_10391681 3300017792 Bacteria 1112
274 Ga0163161_10986533 3300017792 Bacteria 718
275 Ga0197907_10462210 3300020069 Bacteria 920
276 Ga0197907_10610233 3300020069 Bacteria 1020
277 Ga0206354_10888142 3300020081 Bacteria 660
278 Ga0206354_11300942 3300020081 Bacteria 1133
279 Ga0206353_10100621 3300020082 Bacteria 2382
280 Ga0206353_10237056 3300020082 Bacteria 2163
281 Ga0213876_10025335 3300021384 Bacteria 3130
282 Ga0213876_10297070 3300021384 Bacteria 858
283 Ga0213875_10000104 3300021388 Bacteria 96500
284 Ga0213875_10121738 3300021388 Bacteria 1219
285 Ga0224712_10096279 3300022467 Bacteria 1248
286 Ga0224712_10104518 3300022467 Bacteria 1206
287 Ga0224712_10186804 3300022467 Bacteria 936
288 Ga0207656_10025425 3300025321 Bacteria 2403
289 Ga0207692_10001780 3300025898 Bacteria 8175
290 Ga0207692_10040645 3300025898 Bacteria 2296
291 Ga0207692_10091916 3300025898 Bacteria 1647
292 Ga0207692_10271138 3300025898 Bacteria 1023
293 Ga0207692_10740146 3300025898 Bacteria 640
294 Ga0207642_10234247 3300025899 Bacteria 1033
295 Ga0207710_10274048 3300025900 Bacteria 848
296 Ga0207710_10596490 3300025900 Bacteria 577
297 Ga0207688_10013216 3300025901 Bacteria 4488
298 Ga0207680_10290077 3300025903 Bacteria 1138
299 Ga0207680_10292423 3300025903 Bacteria 1134
300 Ga0207647_10057082 3300025904 Bacteria 2394
301 Ga0207685_10008461 3300025905 Bacteria 2931
302 Ga0207685_10077184 3300025905 Bacteria 1368
303 Ga0207699_10017496 3300025906 Bacteria 3775
304 Ga0207699_10039554 3300025906 Bacteria 2710
305 Ga0207699_10252090 3300025906 Bacteria 1217
306 Ga0207699_10373324 3300025906 Bacteria 1011
307 Ga0207645_10303888 3300025907 Bacteria 1062
308 Ga0207643_10000196 3300025908 Bacteria 41902
309 Ga0207643_10128165 3300025908 Bacteria 1508
310 Ga0207643_10370237 3300025908 Bacteria 902
311 Ga0207643_10878524 3300025908 Bacteria 581
312 Ga0207705_10229386 3300025909 Bacteria 1412
313 Ga0207684_10279757 3300025910 Bacteria 1439
314 Ga0207684_10377861 3300025910 Bacteria 1219
315 Ga0207654_10017240 3300025911 Bacteria 3772
316 Ga0207707_10036983 3300025912 Bacteria 4266
317 Ga0207671_10173318 3300025914 Bacteria 1676
318 Ga0207693_10002838 3300025915 Bacteria 15009
319 Ga0207693_10041863 3300025915 Bacteria 3606
320 Ga0207693_10073831 3300025915 Bacteria 2670
321 Ga0207693_10251621 3300025915 Bacteria 1386
322 Ga0207693_10657585 3300025915 Bacteria 814
323 Ga0207693_10981765 3300025915 Bacteria 645
324 Ga0207663_10017879 3300025916 Bacteria 3960
325 Ga0207663_10092844 3300025916 Bacteria 2007
326 Ga0207663_10275867 3300025916 Bacteria 1247
327 Ga0207663_10487931 3300025916 Bacteria 955
328 Ga0207663_10721660 3300025916 Bacteria 790
329 Ga0207660_10741866 3300025917 Bacteria 801
330 Ga0207660_11715109 3300025917 Bacteria 505
331 Ga0207662_10412841 3300025918 Bacteria 917
332 Ga0207662_11333249 3300025918 Bacteria 510
333 Ga0207657_10051547 3300025919 Bacteria 3577
334 Ga0207657_10152361 3300025919 Bacteria 1882
335 Ga0207649_10206430 3300025920 Bacteria 1391
336 Ga0207652_10309723 3300025921 Bacteria 1425
337 Ga0207646_10088665 3300025922 Bacteria 2768
338 Ga0207646_10174644 3300025922 Bacteria 1940
339 Ga0207646_10182493 3300025922 Bacteria 1895
340 Ga0207650_10015635 3300025925 Bacteria 5289
341 Ga0207650_11523366 3300025925 Bacteria 568
342 Ga0207659_10012749 3300025926 Bacteria 5365
343 Ga0207659_10497983 3300025926 Bacteria 1031
344 Ga0207659_10847512 3300025926 Bacteria 786
345 Ga0207659_10992707 3300025926 Bacteria 722
346 Ga0207687_10101756 3300025927 Bacteria 2115
347 Ga0207687_10172821 3300025927 Bacteria 1668
348 Ga0207687_10197693 3300025927 Bacteria 1569
349 Ga0207687_10258370 3300025927 Bacteria 1388
350 Ga0207700_10001069 3300025928 Bacteria 15781
351 Ga0207700_10009263 3300025928 Bacteria 6142
352 Ga0207700_10025003 3300025928 Bacteria 4141
353 Ga0207700_10044839 3300025928 Bacteria 3258
354 Ga0207700_10057544 3300025928 Bacteria 2932
355 Ga0207700_10126999 3300025928 Bacteria 2076
356 Ga0207700_10193962 3300025928 Bacteria 1708
357 Ga0207700_10291651 3300025928 Bacteria 1406
358 Ga0207700_10402204 3300025928 Bacteria 1200
359 Ga0207700_10464388 3300025928 Bacteria 1117
360 Ga0207700_11096223 3300025928 Bacteria 712
361 Ga0207664_10001327 3300025929 Bacteria 16297
362 Ga0207664_10002398 3300025929 Bacteria 12393
363 Ga0207664_10016121 3300025929 Bacteria 5444
364 Ga0207664_10025223 3300025929 Bacteria 4475
365 Ga0207664_10062607 3300025929 Bacteria 2971
366 Ga0207664_10194144 3300025929 Bacteria 1749
367 Ga0207664_10282912 3300025929 Bacteria 1456
368 Ga0207664_10417760 3300025929 Bacteria 1194
369 Ga0207664_10709559 3300025929 Bacteria 904
370 Ga0207644_10013239 3300025931 Bacteria 5495
371 Ga0207690_10374532 3300025932 Bacteria 1130
372 Ga0207706_10171732 3300025933 Bacteria 1905
373 Ga0207706_11151246 3300025933 Bacteria 646
374 Ga0207686_10841877 3300025934 Bacteria 737
375 Ga0207709_10631566 3300025935 Bacteria 851
376 Ga0207670_10082384 3300025936 Bacteria 2254
377 Ga0207670_10096131 3300025936 Bacteria 2106
378 Ga0207669_11936021 3300025937 Bacteria 504
379 Ga0207704_10789613 3300025938 Bacteria 792
380 Ga0207665_10004471 3300025939 Bacteria 9286
381 Ga0207665_10005230 3300025939 Bacteria 8667
382 Ga0207665_10352660 3300025939 Bacteria 1111
383 Ga0207691_10154496 3300025940 Bacteria 2016
384 Ga0207691_10677181 3300025940 Bacteria 870
385 Ga0207711_10697514 3300025941 Bacteria 947
386 Ga0207689_10001658 3300025942 Bacteria 21104
387 Ga0207689_10511008 3300025942 Bacteria 1007
388 Ga0207689_10666031 3300025942 Bacteria 877
389 Ga0207689_11676632 3300025942 Bacteria 527
390 Ga0207661_10019838 3300025944 Bacteria 5016
391 Ga0207661_10328861 3300025944 Bacteria 1375
392 Ga0207661_10376657 3300025944 Bacteria 1284
393 Ga0207661_10882785 3300025944 Bacteria 823
394 Ga0207661_10992529 3300025944 Bacteria 773
395 Ga0207661_11514822 3300025944 Bacteria 614
396 Ga0207679_10004949 3300025945 Bacteria 8311
397 Ga0207679_10293152 3300025945 Bacteria 1399
398 Ga0207679_10533408 3300025945 Bacteria 1051
399 Ga0207679_11156040 3300025945 Bacteria 710
400 Ga0207667_10302014 3300025949 Bacteria 1636
401 Ga0207667_10458925 3300025949 Bacteria 1294
402 Ga0207651_10490902 3300025960 Bacteria 1060
403 Ga0207712_10147227 3300025961 Bacteria 1815
404 Ga0207712_11431061 3300025961 Bacteria 619
405 Ga0207668_11835155 3300025972 Bacteria 547
406 Ga0207640_10164234 3300025981 Bacteria 1647
407 Ga0207658_10160943 3300025986 Bacteria 1840
408 Ga0207677_10119703 3300026023 Bacteria 1978
409 Ga0207677_10144765 3300026023 Bacteria 1825
410 Ga0207677_10209905 3300026023 Bacteria 1554
411 Ga0207677_10327913 3300026023 Bacteria 1275
412 Ga0207677_10412372 3300026023 Bacteria 1148
413 Ga0207677_11586313 3300026023 Bacteria 606
414 Ga0207703_10105533 3300026035 Bacteria 2395
415 Ga0207703_10458548 3300026035 Bacteria 1192
416 Ga0207639_11619761 3300026041 Bacteria 607
417 Ga0207678_10000794 3300026067 Bacteria 28950
418 Ga0207678_10104558 3300026067 Bacteria 2416
419 Ga0207678_11438847 3300026067 Bacteria 609
420 Ga0207708_10012630 3300026075 Bacteria 6299
421 Ga0207702_10020495 3300026078 Bacteria 5474
422 Ga0207702_10022811 3300026078 Bacteria 5192
423 Ga0207702_11046008 3300026078 Bacteria 810
424 Ga0207641_10178236 3300026088 Bacteria 1945
425 Ga0207641_10264833 3300026088 Bacteria 1611
426 Ga0207641_10511129 3300026088 Bacteria 1167
427 Ga0207641_10893079 3300026088 Bacteria 882
428 Ga0207676_10000651 3300026095 Bacteria 27828
429 Ga0207676_10379543 3300026095 Bacteria 1315
430 Ga0207676_10481057 3300026095 Bacteria 1176
431 Ga0207676_10622093 3300026095 Bacteria 1039
432 Ga0207676_10938944 3300026095 Bacteria 850
433 Ga0207676_11211410 3300026095 Bacteria 748
434 Ga0207683_10010407 3300026121 Bacteria 7933
435 Ga0207683_10029666 3300026121 Bacteria 4737
436 Ga0207683_10224995 3300026121 Bacteria 1710
437 Ga0207683_10321318 3300026121 Bacteria 1418
438 Ga0207683_10496904 3300026121 Bacteria 1126
439 Ga0207698_10009693 3300026142 Bacteria 6150
440 Ga0207698_10617004 3300026142 Bacteria 1071
441 Ga0209588_1229230 3300027671 Bacteria 572
442 Ga0207428_10037356 3300027907 Bacteria 3951
443 Ga0268266_10094489 3300028379 Bacteria 2624
444 Ga0268266_10430738 3300028379 Bacteria 1251
445 Ga0268266_10436691 3300028379 Bacteria 1243
446 Ga0268266_10561420 3300028379 Bacteria 1094
447 Ga0268265_10629585 3300028380 Bacteria 1029
448 Ga0268264_10056594 3300028381 Bacteria 3278
449 Ga0268264_11088194 3300028381 Bacteria 808
450 Ga0265337_1000395 3300028556 Bacteria 23441
451 Ga0265326_10008675 3300028558 Bacteria 3057
452 Ga0265319_1003518 3300028563 Bacteria 8135
453 Ga0265334_10000389 3300028573 Bacteria 23222
454 Ga0265318_10012538 3300028577 Bacteria 3604
455 Ga0265323_10015922 3300028653 Bacteria 2946
456 Ga0265322_10012148 3300028654 Bacteria 2490
457 Ga0265338_10000375 3300028800 Bacteria 79976
458 Ga0265338_10000911 3300028800 Bacteria 49821
459 Ga0265324_10008124 3300029957 Bacteria 4195
460 Ga0265332_10010288 3300031238 Bacteria 4164
461 Ga0265320_10001205 3300031240 Bacteria 19014
462 Ga0265325_10018874 3300031241 Bacteria 3821
463 Ga0265329_10097639 3300031242 Bacteria 934
464 Ga0265340_10003267 3300031247 Bacteria 9198
465 Ga0265339_10025516 3300031249 Bacteria 3392
466 Ga0265316_10072731 3300031344 Bacteria 2648
467 Ga0307408_100341465 3300031548 Bacteria 1267
468 Ga0265313_10023978 3300031595 Bacteria 3272
469 Ga0265314_10013101 3300031711 Bacteria 6718
470 Ga0265342_10001780 3300031712 Bacteria 19620
471 Ga0307406_10345601 3300031901 Bacteria 1160
472 Ga0307415_101704642 3300032126 Bacteria 608
473 Ga0373930_0073705 3300034816 Bacteria 780
474 Ga0373926_0003730 3300035083 Bacteria 4958
475 Ga0373928_0019732 3300035084 Bacteria 1409
476 Ga0373934_0000161 3300035086 Bacteria 24391
477 Ga0373934_0135914 3300035086 Bacteria 1004
478 Ga0373944_0005260 3300035089 Bacteria 3403
479 Ga0373952_0024052 3300035092 Bacteria 1305
480 Ga0373923_0017856 3300035111 Bacteria 2720
481 Ga0373932_0245935 3300035112 Bacteria 651
482 Ga0373936_0000206 3300035113 Bacteria 19595
483 Ga0373936_0008494 3300035113 Bacteria 3868
484 Ga0373936_0431587 3300035113 Bacteria 607
485 Ga0373941_0426801 3300035115 Bacteria 553
486 Ga0373945_0001919 3300035116 Bacteria 6451
487 Ga0373953_0000035 3300035117 Bacteria 35807
488 Ga0373954_0006506 3300035118 Bacteria 5093
489 Ga0373954_0201926 3300035118 Bacteria 977
490 Ga0373956_0000318 3300035119 Bacteria 19456
491 Ga0373956_0007792 3300035119 Bacteria 4321
492 Ga0373957_0000039 3300035120 Bacteria 34100
493 Ga0373943_0001364 3300035170 Bacteria 11010
494 Ga0373943_0026256 3300035170 Bacteria 2728
495 Ga0373943_0103898 3300035170 Bacteria 1490
496 Ga0373946_0000123 3300035171 Bacteria 22784
497 Ga0373946_0083161 3300035171 Bacteria 1405
498 Ga0373955_0000124 3300035172 Bacteria 30735
499 Ga0373955_0072561 3300035172 Bacteria 1928
500 Ga0373955_0187489 3300035172 Bacteria 1229
501 Ga0373942_0020587 3300035207 Bacteria 1658
502 Ga0373924_0000479 3300035410 Bacteria 12217
503 Ga0373924_0035869 3300035410 Bacteria 2012
504 Ga0373931_0069736 3300035691 Bacteria 1916
505 Ga0373931_0502728 3300035691 Bacteria 782
506 Ga0373931_0845081 3300035691 Bacteria 612
507 Ga0373935_0005609 3300035692 Bacteria 7402
508 Ga0373935_0128916 3300035692 Bacteria 1698
509 Ga0373935_0168854 3300035692 Bacteria 1495
510 Ga0373935_0433572 3300035692 Bacteria 947
511 Ga0373935_0584807 3300035692 Bacteria 816
512 Ga0373927_0001451 3300035695 Bacteria 17876
513 Ga0373927_0064620 3300035695 Bacteria 2367
514 Ga0373927_0626322 3300035695 Bacteria 711
515 Ga0373933_0000069 3300035724 Bacteria 62983
516 Ga0373933_0023254 3300035724 Bacteria 3538
517 Ga0373947_0000510 3300035725 Bacteria 22565
518 Ga0373947_0871213 3300035725 Bacteria 615
519 Ga0373947_1160396 3300035725 Bacteria 526
520 Ga0373937_0000168 3300036401 Bacteria 63667
521 Ga0373937_0046204 3300036401 Bacteria 3981
522 Ga0373937_0324361 3300036401 Bacteria 1457
523 Ga0373937_1798970 3300036401 Bacteria 559
524 Ga0373925_0000879 3300037068 Bacteria 27479
525 Ga0373925_0002965 3300037068 Bacteria 13400
526 Ga0395898_0845471 3300037466 Bacteria 854
527 Ga0436364_0153646 3300037853 Bacteria 589
528 Ga0436364_0493666 3300037853 Bacteria 3729
529 Ga0436364_0731702 3300037853 Bacteria 1052
530 Ga0436364_1079797 3300037853 Bacteria 1932
531 Ga0436364_1302603 3300037853 Bacteria 592
532 Ga0436364_1340274 3300037853 Bacteria 7133
533 Ga0436364_1497153 3300037853 Bacteria 67687
534 Ga0436365_0274842 3300039437 Bacteria 818
535 Ga0436365_0985376 3300039437 Bacteria 1253
536 Ga0436365_1026192 3300039437 Bacteria 608
537 Ga0436365_1268655 3300039437 Bacteria 26104
538 Ga0436365_1803159 3300039437 Bacteria 5030
539 Ga0436365_1931865 3300039437 Bacteria 6692
540 Ga0436361_1006166 3300039447 Bacteria 638
541 Ga0436363_0660717 3300039450 Bacteria 606
542 Ga0436363_0682306 3300039450 Bacteria 851
543 Ga0436362_0768964 3300039453 Bacteria 671
544 Ga0451851_1363798 3300041507 Bacteria 523
545 Ga0439455_0221766 3300042012 Bacteria 550
546 Ga0439463_025845 3300042016 Bacteria 1474
547 Ga0439463_104456 3300042016 Bacteria 731
548 Ga0439458_0049023 3300042157 Bacteria 1039
549 Ga0439459_0002078 3300042438 Bacteria 3053
550 Ga0466972_0125251 3300044658 Bacteria 1211
551 Ga0466972_0179580 3300044658 Bacteria 993
552 Ga0466966_0085686 3300044684 Bacteria 1959
553 Ga0466966_0284844 3300044684 Bacteria 994
554 Ga0466961_0002925 3300044693 Bacteria 10609
555 Ga0466961_0164307 3300044693 Bacteria 1383
556 Ga0466963_0135203 3300044694 Bacteria 1705
557 Ga0466963_0871806 3300044694 Bacteria 635
558 Ga0466971_0091915 3300044719 Bacteria 1390
559 Ga0466971_0157557 3300044719 Bacteria 1062
560 Ga0466971_0207219 3300044719 Bacteria 927
561 Ga0466971_0653254 3300044719 Bacteria 527
562 Ga0466970_0270861 3300044765 Bacteria 954
563 Ga0466957_0283700 3300044842 Bacteria 1109
564 Ga0466957_0309464 3300044842 Bacteria 1063
565 Ga0466957_1288038 3300044842 Bacteria 530
566 Ga0466960_0026340 3300044901 Bacteria 2641
567 Ga0466959_0071971 3300045049 Bacteria 2503
568 Ga0466959_0534964 3300045049 Bacteria 791
569 Ga0466958_0060893 3300045836 Bacteria 2298
570 Ga0466967_0256960 3300045976 Bacteria 1670
571 Ga0466967_0473759 3300045976 Bacteria 1226
572 Ga0466967_0744873 3300045976 Bacteria 972
573 Ga0495592_0000144 3300046454 Bacteria 62983
574 Ga0495603_0238032 3300046455 Bacteria 1049
575 Ga0495603_0515673 3300046455 Bacteria 685
576 Ga0495629_0016555 3300046459 Bacteria 5292
577 Ga0495629_0122290 3300046459 Bacteria 1813
578 Ga0495651_0000100 3300046462 Bacteria 62983
579 Ga0495651_0012138 3300046462 Bacteria 6631
580 Ga0495653_0000436 3300046463 Bacteria 32860
581 Ga0495653_0019577 3300046463 Bacteria 5488
582 Ga0495653_0043967 3300046463 Bacteria 3469
583 Ga0495653_0748320 3300046463 Bacteria 591
584 Ga0495580_0068952 3300046472 Bacteria 2472
585 Ga0495639_0042213 3300046475 Bacteria 2056
586 Ga0495662_0008779 3300046476 Bacteria 4971
587 Ga0495664_0001416 3300046477 Bacteria 12712
588 Ga0495664_0070271 3300046477 Bacteria 2091
589 Ga0495664_0244205 3300046477 Bacteria 1086
590 Ga0495608_0000093 3300046511 Bacteria 64243
591 Ga0495608_0009607 3300046511 Bacteria 6752
592 Ga0495608_0217297 3300046511 Bacteria 1200
593 Ga0495618_0038322 3300046514 Bacteria 3012
594 Ga0495628_0000308 3300046516 Bacteria 43976
595 Ga0495628_0068577 3300046516 Bacteria 2767
596 Ga0495628_0725202 3300046516 Bacteria 700
597 Ga0495630_0001678 3300046517 Bacteria 15421
598 Ga0495630_0028951 3300046517 Bacteria 4116
599 Ga0495630_0176284 3300046517 Bacteria 1629
600 Ga0495630_0262702 3300046517 Bacteria 1319
601 Ga0495644_0163044 3300046523 Bacteria 855
602 Ga0495666_0466604 3300046526 Bacteria 565
603 Ga0495652_0000126 3300046529 Bacteria 84302
604 Ga0495652_0014642 3300046529 Bacteria 7032
605 Ga0495652_0092705 3300046529 Bacteria 2467
606 Ga0495652_0169601 3300046529 Bacteria 1686
607 Ga0495665_0027230 3300046531 Bacteria 3069
608 Ga0495665_0076751 3300046531 Bacteria 1758
609 Ga0495640_0155963 3300046533 Bacteria 1465
610 Ga0495586_0465864 3300046535 Bacteria 729
611 Ga0495587_0000104 3300046536 Bacteria 63667
612 Ga0495587_0017950 3300046536 Bacteria 4387
613 Ga0495645_0111347 3300046543 Bacteria 1936
614 Ga0495645_0321713 3300046543 Bacteria 1004
615 Ga0495667_0000097 3300046559 Bacteria 62983
616 Ga0495667_0002066 3300046559 Bacteria 13331
617 Ga0495634_0047852 3300046642 Bacteria 2880
618 Ga0495634_0150733 3300046642 Bacteria 1471
619 Ga0495635_0002813 3300046663 Bacteria 11939
620 Ga0495588_0187321 3300046674 Bacteria 1093
621 Ga0495657_0000325 3300046675 Bacteria 43650
622 Ga0495657_0016729 3300046675 Bacteria 5336
623 Ga0495657_0022596 3300046675 Bacteria 4502
624 Ga0495599_0000214 3300046678 Bacteria 37089
625 Ga0495599_0007609 3300046678 Bacteria 6578
626 Ga0495599_0166504 3300046678 Bacteria 1361
627 Ga0495599_0310325 3300046678 Bacteria 951
628 Ga0495623_0000090 3300046679 Bacteria 53800
629 Ga0495646_0032866 3300046680 Bacteria 3226
630 Ga0495646_0266648 3300046680 Bacteria 913
631 Ga0495647_0144672 3300046681 Bacteria 1016
632 Ga0495647_0156642 3300046681 Bacteria 979
633 Ga0495658_0700943 3300046683 Bacteria 648
634 Ga0495613_0532616 3300046689 Bacteria 788
635 Ga0495624_0072175 3300046690 Bacteria 2148
636 Ga0495624_0327526 3300046690 Bacteria 922
637 Ga0495649_0248720 3300046694 Bacteria 914
638 Ga0495600_0010254 3300046809 Bacteria 5809
639 Ga0495600_0106319 3300046809 Bacteria 1828
640 Ga0495581_0020561 3300047315 Bacteria 3830
641 Ga0495581_0025904 3300047315 Bacteria 3401
642 Ga0495581_0193518 3300047315 Bacteria 1190
643 Ga0495604_0000135 3300047317 Bacteria 62983
644 Ga0495604_0026803 3300047317 Bacteria 4586
645 Ga0495674_0002794 3300047319 Bacteria 16941
646 Ga0495672_0353707 3300047320 Bacteria 682
647 Ga0495676_0007451 3300047321 Bacteria 10039
648 Ga0495676_0243463 3300047321 Bacteria 1230
649 Ga0495680_0000156 3300047322 Bacteria 69379
650 Ga0495680_0015795 3300047322 Bacteria 6499
651 Ga0495680_0030252 3300047322 Bacteria 4423
652 Ga0495675_0000102 3300047444 Bacteria 61796
653 Ga0495675_0039238 3300047444 Bacteria 3016
654 Ga0495684_0006613 3300047471 Bacteria 8991
655 Ga0495684_0137566 3300047471 Bacteria 1832
656 Ga0495684_0633855 3300047471 Bacteria 717
657 Ga0495593_0159897 3300047673 Bacteria 1137
658 Ga0495602_0005662 3300048088 Bacteria 13101
659 Ga0495602_0010831 3300048088 Bacteria 9450
660 Ga0495614_0086249 3300048089 Bacteria 1363
661 Ga0496100_0111409 3300048903 Bacteria 1902
662 Ga0496100_0366552 3300048903 Bacteria 1091
663 Ga0496101_0197182 3300048904 Bacteria 1555
664 Ga0496101_0225368 3300048904 Bacteria 1456
665 Ga0496101_0348623 3300048904 Bacteria 1163
666 Ga0496101_1029557 3300048904 Bacteria 647
667 Ga0496101_1119315 3300048904 Bacteria 618
668 Ga0496101_1576247 3300048904 Bacteria 510
669 Ga0496102_0111722 3300048905 Bacteria 2548
670 Ga0496102_0249595 3300048905 Unclassified 1673
671 Ga0496102_0381263 3300048905 Bacteria 1327
672 Ga0496103_0370228 3300048906 Bacteria 921
673 Ga0496104_0005163 3300048907 Bacteria 11409
674 Ga0496104_0030892 3300048907 Bacteria 4980
675 Ga0496104_0033506 3300048907 Bacteria 4786
676 Ga0496104_0181582 3300048907 Unclassified 2014
677 Ga0496104_0264162 3300048907 Bacteria 1633
678 Ga0496104_1562008 3300048907 Bacteria 563
679 Ga0496105_0004718 3300048908 Bacteria 10285
680 Ga0496105_0012672 3300048908 Bacteria 6679
681 Ga0496105_0021444 3300048908 Bacteria 5227
682 Ga0496105_1099946 3300048908 Bacteria 590
683 Ga0496106_0029465 3300048909 Bacteria 4091
684 Ga0496106_0086654 3300048909 Bacteria 2412
685 Ga0496106_0309783 3300048909 Bacteria 1267
686 Ga0496106_0611718 3300048909 Bacteria 872
687 Ga0496106_1044624 3300048909 Bacteria 641
688 Ga0496107_0171160 3300048910 Bacteria 1612
689 Ga0496107_0611012 3300048910 Bacteria 805
690 Ga0496108_0004974 3300048911 Bacteria 10742
691 Ga0496108_0085639 3300048911 Bacteria 2675
692 Ga0496108_0136338 3300048911 Bacteria 2112
693 Ga0496108_0166408 3300048911 Bacteria 1906
694 Ga0496108_0190165 3300048911 Bacteria 1779
695 Ga0496108_0191970 3300048911 Bacteria 1770
696 Ga0496108_0219703 3300048911 Bacteria 1651
697 Ga0496108_0293786 3300048911 Bacteria 1415
698 Ga0496108_0297186 3300048911 Bacteria 1406
699 Ga0496108_0475101 3300048911 Bacteria 1092
700 Ga0496109_0010814 3300048912 Bacteria 7813
701 Ga0496109_0044183 3300048912 Bacteria 4041
702 Ga0496109_0057455 3300048912 Bacteria 3552
703 Ga0496109_0077768 3300048912 Bacteria 3053
704 Ga0496109_0138011 3300048912 Bacteria 2279
705 Ga0496109_0295637 3300048912 Bacteria 1527
706 Ga0496109_0727120 3300048912 Bacteria 930
707 Ga0496109_1063842 3300048912 Bacteria 746
708 Ga0496109_1254922 3300048912 Bacteria 677
709 Ga0496110_0095540 3300048913 Bacteria 2662
710 Ga0496110_0097105 3300048913 Bacteria 2640
711 Ga0496110_0124840 3300048913 Bacteria 2322
712 Ga0496110_0293254 3300048913 Bacteria 1481
713 Ga0496110_0397510 3300048913 Bacteria 1256
714 Ga0496110_1005325 3300048913 Bacteria 741
715 Ga0496111_0024913 3300048914 Bacteria 4220
716 Ga0496111_0170329 3300048914 Bacteria 1618
717 Ga0496111_0238732 3300048914 Bacteria 1350
718 Ga0496111_0266597 3300048914 Bacteria 1270
719 Ga0496111_0755443 3300048914 Bacteria 705
720 Ga0496111_0807125 3300048914 Bacteria 679
721 Ga0496112_0059896 3300048915 Bacteria 3751
722 Ga0496112_0150354 3300048915 Bacteria 2296
723 Ga0496112_0223500 3300048915 Bacteria 1838
724 Ga0496112_0330872 3300048915 Bacteria 1467
725 Ga0496112_0345562 3300048915 Bacteria 1431
726 Ga0496112_1327847 3300048915 Bacteria 634
727 Ga0496113_0004041 3300048916 Bacteria 8932
728 Ga0496113_0029533 3300048916 Bacteria 3961
729 Ga0496113_0045489 3300048916 Bacteria 3256
730 Ga0496113_0052594 3300048916 Bacteria 3043
731 Ga0496113_0098468 3300048916 Bacteria 2263
732 Ga0496113_0436223 3300048916 Bacteria 1052
733 Ga0496113_0893121 3300048916 Bacteria 703
734 Ga0496113_1418373 3300048916 Bacteria 538
735 Ga0496114_0013670 3300048917 Bacteria 6508
736 Ga0496114_0031385 3300048917 Bacteria 4373
737 Ga0496114_0370529 3300048917 Bacteria 1267
738 Ga0496114_0521928 3300048917 Bacteria 1050
739 Ga0496114_0573201 3300048917 Bacteria 996
740 Ga0496114_1224364 3300048917 Bacteria 637
741 Ga0496114_1262293 3300048917 Bacteria 625
742 Ga0496115_0022786 3300048918 Bacteria 4856
743 Ga0496115_0034857 3300048918 Bacteria 3978
744 Ga0496115_0233440 3300048918 Bacteria 1516
745 Ga0496126_0024577 3300048929 Bacteria 5813
746 nmdc:mga06z11_674686_c1 3300050494 Bacteria 629
747 nmdc:mga05p37_839899_c1 3300050507 Bacteria 999
748 nmdc:mga05p37_945656_c1 3300050507 Bacteria 923
749 nmdc:mga09592_626685_c1 3300050508 Bacteria 920
750 nmdc:mga06r32_792933_c1 3300050510 Bacteria 908
751 nmdc:mga08y16_168979_c1 3300050511 Bacteria 2272
752 nmdc:mga08y16_60466_c1 3300050511 Bacteria 3956
753 nmdc:mga0n895_10213_c1 3300050512 Bacteria 8271
754 nmdc:mga0n895_2164801_c1 3300050512 Bacteria 512
755 nmdc:mga0n895_2169_c1 3300050512 Bacteria 15180
756 nmdc:mga0rr50_1868136_c1 3300050513 Bacteria 505
757 nmdc:mga0rr50_220574_c1 3300050513 Bacteria 1566
758 nmdc:mga0rr50_2398_c1 3300050513 Bacteria 10546
759 nmdc:mga0rr50_865846_c1 3300050513 Bacteria 770
760 nmdc:mga08x19_16151_c1 3300050514 Bacteria 4549
761 nmdc:mga08x19_648448_c1 3300050514 Bacteria 749
762 nmdc:mga0a205_39305_c1 3300050515 Bacteria 4554
763 Ga0495601_0035979 3300053077 Bacteria 3091
764 Ga0495612_0112953 3300053078 Bacteria 1164
765 Ga0495595_0001660 3300053084 Bacteria 8704
766 Ga0495619_0022864 3300053085 Bacteria 4003
767 Ga0495619_0576728 3300053085 Bacteria 771
768 Ga0500559_0336106 3300053136 Bacteria 707
769 Ga0590075_002138 3300059424 Bacteria 4751
770 Ga0590077_004008 3300059426 Bacteria 3035
771 Ga0501082_1616419 3300060353 Bacteria 566
772 Ga0466962_0114843 3300061719 Bacteria 1297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1000395 Ga0265337_100039523 96
2 3300028558 Ga0265326_10008675 Ga0265326_100086753 96
3 3300028563 Ga0265319_1003518 Ga0265319_10035188 96
4 3300028573 Ga0265334_10000389 Ga0265334_100003893 96
5 3300028577 Ga0265318_10012538 Ga0265318_100125383 96
6 3300028653 Ga0265323_10015922 Ga0265323_100159222 96
7 3300028800 Ga0265338_10000375 Ga0265338_1000037536 96
8 3300029957 Ga0265324_10008124 Ga0265324_100081242 96
9 3300031238 Ga0265332_10010288 Ga0265332_100102882 96
10 3300031240 Ga0265320_10001205 Ga0265320_1000120520 96
11 3300031241 Ga0265325_10018874 Ga0265325_100188744 96
12 3300031242 Ga0265329_10097639 Ga0265329_100976392 96
13 3300031247 Ga0265340_10003267 Ga0265340_100032679 96
14 3300031249 Ga0265339_10025516 Ga0265339_100255163 96
15 3300031344 Ga0265316_10072731 Ga0265316_100727312 96
16 3300031595 Ga0265313_10023978 Ga0265313_100239782 96
17 3300031711 Ga0265314_10013101 Ga0265314_100131016 96
18 3300031712 Ga0265342_10001780 Ga0265342_100017808 96
19 3300031548 Ga0307408_100341465 Ga0307408_1003414652 104
20 3300031901 Ga0307406_10345601 Ga0307406_103456012 104
21 iso_pu_bacteria 2791354901 2791915934 107
22 3300005436 Ga0070713_101002666 Ga0070713_1010026662 108
23 3300005983 Ga0081540_1018759 Ga0081540_10187594 108
24 3300006178 Ga0075367_10798380 Ga0075367_107983802 108
25 3300006846 Ga0075430_101391243 Ga0075430_1013912432 108
26 3300035170 Ga0373943_0103898 Ga0373943_0103898_839_1192 108
27 3300035692 Ga0373935_0128916 Ga0373935_0128916_210_563 108
28 3300035695 Ga0373927_0626322 Ga0373927_0626322_159_512 108
29 3300047315 Ga0495581_0193518 Ga0495581_0193518_777_1130 108
30 3300050494 nmdc:mga06z11_674686_c1 nmdc:mga06z11_674686_c1_55_423 108
31 3300005327 Ga0070658_11657079 Ga0070658_116570791 109
32 3300005364 Ga0070673_101752924 Ga0070673_1017529242 109
33 3300005436 Ga0070713_100175596 Ga0070713_1001755963 109
34 3300005578 Ga0068854_101810018 Ga0068854_1018100181 109
35 3300005618 Ga0068864_100511097 Ga0068864_1005110972 109
36 3300006028 Ga0070717_10218010 Ga0070717_102180103 109
37 3300006175 Ga0070712_100290209 Ga0070712_1002902093 109
38 3300006881 Ga0068865_101285523 Ga0068865_1012855232 109
39 3300009098 Ga0105245_10171636 Ga0105245_101716363 109
40 3300009553 Ga0105249_10115493 Ga0105249_101154934 109
41 3300011119 Ga0105246_10771941 Ga0105246_107719412 109
42 3300012481 Ga0157320_1004200 Ga0157320_10042002 109
43 3300012491 Ga0157329_1001096 Ga0157329_10010962 109
44 3300013307 Ga0157372_10993195 Ga0157372_109931952 109
45 3300025908 Ga0207643_10128165 Ga0207643_101281654 109
46 3300025927 Ga0207687_10101756 Ga0207687_101017562 109
47 3300025928 Ga0207700_10057544 Ga0207700_100575442 109
48 3300025929 Ga0207664_10016121 Ga0207664_100161214 109
49 3300025938 Ga0207704_10789613 Ga0207704_107896132 109
50 3300025944 Ga0207661_11514822 Ga0207661_115148221 109
51 3300026023 Ga0207677_10119703 Ga0207677_101197032 109
52 3300026142 Ga0207698_10617004 Ga0207698_106170042 109
53 3300035691 Ga0373931_0502728 Ga0373931_0502728_148_501 109
54 3300048905 Ga0496102_0381263 Ga0496102_0381263_361_738 109
55 3300048911 Ga0496108_0191970 Ga0496108_0191970_447_800 109
56 3300048913 Ga0496110_0095540 Ga0496110_0095540_401_754 109
57 3300048914 Ga0496111_0238732 Ga0496111_0238732_720_1073 109
58 3300005435 Ga0070714_100659508 Ga0070714_1006595081 110
59 3300006028 Ga0070717_10247061 Ga0070717_102470613 110
60 3300020081 Ga0206354_10888142 Ga0206354_108881422 110
61 3300025929 Ga0207664_10709559 Ga0207664_107095592 110
62 3300025937 Ga0207669_11936021 Ga0207669_119360211 110
63 3300026095 Ga0207676_10938944 Ga0207676_109389442 110
64 3300005435 Ga0070714_100136993 Ga0070714_1001369932 111
65 3300005435 Ga0070714_101139138 Ga0070714_1011391382 111
66 3300005436 Ga0070713_100021731 Ga0070713_1000217312 111
67 3300005439 Ga0070711_100243365 Ga0070711_1002433652 111
68 3300006028 Ga0070717_10354842 Ga0070717_103548422 111
69 3300006175 Ga0070712_100049959 Ga0070712_1000499591 111
70 3300007265 Ga0099794_10227437 Ga0099794_102274372 111
71 3300020069 Ga0197907_10610233 Ga0197907_106102332 111
72 3300025898 Ga0207692_10740146 Ga0207692_107401462 111
73 3300025915 Ga0207693_10041863 Ga0207693_100418635 111
74 3300025916 Ga0207663_10275867 Ga0207663_102758672 111
75 3300025928 Ga0207700_10193962 Ga0207700_101939622 111
76 3300025929 Ga0207664_10002398 Ga0207664_1000239812 111
77 3300027671 Ga0209588_1229230 Ga0209588_12292302 111
78 3300037853 Ga0436364_0731702 Ga0436364_0731702_551_904 111
79 3300039450 Ga0436363_0660717 Ga0436363_0660717_45_398 111
80 3300005435 Ga0070714_100730257 Ga0070714_1007302572 112
81 3300005985 Ga0081539_10184408 Ga0081539_101844082 112
82 3300025942 Ga0207689_10511008 Ga0207689_105110082 112
83 3300046517 Ga0495630_0262702 Ga0495630_0262702_452_814 112
84 3300046678 Ga0495599_0166504 Ga0495599_0166504_41_403 112
85 3300005338 Ga0068868_100242163 Ga0068868_1002421633 113
86 3300005354 Ga0070675_100844610 Ga0070675_1008446102 113
87 3300005456 Ga0070678_100567890 Ga0070678_1005678902 113
88 3300005457 Ga0070662_101162242 Ga0070662_1011622422 113
89 3300005544 Ga0070686_100460688 Ga0070686_1004606882 113
90 3300005564 Ga0070664_100859371 Ga0070664_1008593711 113
91 3300005577 Ga0068857_100906072 Ga0068857_1009060722 113
92 3300005618 Ga0068864_100611038 Ga0068864_1006110382 113
93 3300011119 Ga0105246_10844507 Ga0105246_108445072 113
94 3300013297 Ga0157378_10727701 Ga0157378_107277012 113
95 3300013308 Ga0157375_10402962 Ga0157375_104029622 113
96 3300025926 Ga0207659_10992707 Ga0207659_109927072 113
97 3300025933 Ga0207706_11151246 Ga0207706_111512461 113
98 3300025936 Ga0207670_10082384 Ga0207670_100823843 113
99 3300026088 Ga0207641_10893079 Ga0207641_108930792 113
100 3300026095 Ga0207676_10481057 Ga0207676_104810572 113
101 3300026121 Ga0207683_10496904 Ga0207683_104969042 113
102 3300044719 Ga0466971_0207219 Ga0466971_0207219_279_635 113
103 3300046463 Ga0495653_0748320 Ga0495653_0748320_29_385 113
104 3300048911 Ga0496108_0475101 Ga0496108_0475101_297_698 113
105 3300005437 Ga0070710_10110023 Ga0070710_101100232 114
106 3300005439 Ga0070711_100425451 Ga0070711_1004254512 114
107 3300006175 Ga0070712_100032518 Ga0070712_1000325183 114
108 3300009176 Ga0105242_10899249 Ga0105242_108992492 114
109 3300011119 Ga0105246_10069132 Ga0105246_100691323 114
110 3300025898 Ga0207692_10091916 Ga0207692_100919164 114
111 3300025915 Ga0207693_10073831 Ga0207693_100738313 114
112 3300025916 Ga0207663_10487931 Ga0207663_104879312 114
113 3300025929 Ga0207664_10282912 Ga0207664_102829122 114
114 3300025944 Ga0207661_10376657 Ga0207661_103766572 114
115 3300025986 Ga0207658_10160943 Ga0207658_101609433 114
116 3300026023 Ga0207677_10209905 Ga0207677_102099052 114
117 3300028654 Ga0265322_10012148 Ga0265322_100121483 114
118 3300032126 Ga0307415_101704642 Ga0307415_1017046422 114
119 3300035172 Ga0373955_0187489 Ga0373955_0187489_543_953 114
120 3300037466 Ga0395898_0845471 Ga0395898_0845471_117_470 114
121 3300039447 Ga0436361_1006166 Ga0436361_1006166_160_528 114
122 3300050511 nmdc:mga08y16_60466_c1 nmdc:mga08y16_60466_c1_1289_1666 114
123 iso_pu_bacteria 2902792274 2902794586 114
124 3300005343 Ga0070687_101317826 Ga0070687_1013178261 115
125 3300005356 Ga0070674_100436357 Ga0070674_1004363572 115
126 3300005436 Ga0070713_100573788 Ga0070713_1005737882 115
127 3300006028 Ga0070717_10133495 Ga0070717_101334952 115
128 3300006028 Ga0070717_10215727 Ga0070717_102157272 115
129 3300006175 Ga0070712_100333417 Ga0070712_1003334171 115
130 3300007265 Ga0099794_10232037 Ga0099794_102320371 115
131 3300013307 Ga0157372_12408752 Ga0157372_124087522 115
132 3300021384 Ga0213876_10297070 Ga0213876_102970702 115
133 3300025908 Ga0207643_10878524 Ga0207643_108785242 115
134 3300025918 Ga0207662_10412841 Ga0207662_104128412 115
135 3300026121 Ga0207683_10321318 Ga0207683_103213181 115
136 3300039437 Ga0436365_0274842 Ga0436365_0274842_41_397 115
137 3300039437 Ga0436365_1803159 Ga0436365_1803159_116_475 115
138 3300044719 Ga0466971_0653254 Ga0466971_0653254_71_433 115
139 3300005434 Ga0070709_10028810 Ga0070709_100288103 116
140 3300005436 Ga0070713_100323660 Ga0070713_1003236602 116
141 3300005436 Ga0070713_100592023 Ga0070713_1005920232 116
142 3300005437 Ga0070710_10249046 Ga0070710_102490462 116
143 3300005439 Ga0070711_100013342 Ga0070711_1000133423 116
144 3300005439 Ga0070711_101064194 Ga0070711_1010641942 116
145 3300005455 Ga0070663_100448047 Ga0070663_1004480471 116
146 3300005467 Ga0070706_100563986 Ga0070706_1005639862 116
147 3300005530 Ga0070679_100368759 Ga0070679_1003687591 116
148 3300005548 Ga0070665_100208055 Ga0070665_1002080553 116
149 3300006028 Ga0070717_10080331 Ga0070717_100803313 116
150 3300006163 Ga0070715_10158032 Ga0070715_101580322 116
151 3300006175 Ga0070712_101179353 Ga0070712_1011793532 116
152 3300009148 Ga0105243_10592473 Ga0105243_105924733 116
153 3300022467 Ga0224712_10186804 Ga0224712_101868042 116
154 3300025906 Ga0207699_10039554 Ga0207699_100395543 116
155 3300025910 Ga0207684_10279757 Ga0207684_102797572 116
156 3300025915 Ga0207693_10251621 Ga0207693_102516212 116
157 3300025915 Ga0207693_10981765 Ga0207693_109817652 116
158 3300025916 Ga0207663_10017879 Ga0207663_100178794 116
159 3300025916 Ga0207663_10721660 Ga0207663_107216602 116
160 3300025928 Ga0207700_10025003 Ga0207700_100250032 116
161 3300025928 Ga0207700_10044839 Ga0207700_100448393 116
162 3300025928 Ga0207700_10402204 Ga0207700_104022041 116
163 3300025929 Ga0207664_10025223 Ga0207664_100252233 116
164 3300025929 Ga0207664_10194144 Ga0207664_101941443 116
165 3300025939 Ga0207665_10352660 Ga0207665_103526602 116
166 3300028379 Ga0268266_10436691 Ga0268266_104366912 116
167 3300028800 Ga0265338_10000911 Ga0265338_1000091131 116
168 3300034816 Ga0373930_0073705 Ga0373930_0073705_236_640 116
169 3300035084 Ga0373928_0019732 Ga0373928_0019732_641_1045 116
170 3300035092 Ga0373952_0024052 Ga0373952_0024052_353_799 116
171 3300035112 Ga0373932_0245935 Ga0373932_0245935_202_606 116
172 3300035691 Ga0373931_0845081 Ga0373931_0845081_144_548 116
173 3300035692 Ga0373935_0584807 Ga0373935_0584807_363_743 116
174 3300046477 Ga0495664_0244205 Ga0495664_0244205_448_828 116
175 3300046535 Ga0495586_0465864 Ga0495586_0465864_46_414 116
176 3300047471 Ga0495684_0633855 Ga0495684_0633855_56_436 116
177 3300048903 Ga0496100_0366552 Ga0496100_0366552_206_610 116
178 3300048904 Ga0496101_1576247 Ga0496101_1576247_10_414 116
179 3300048907 Ga0496104_0264162 Ga0496104_0264162_387_791 116
180 3300048913 Ga0496110_0397510 Ga0496110_0397510_195_641 116
181 3300048916 Ga0496113_0436223 Ga0496113_0436223_261_665 116
182 3300048917 Ga0496114_0013670 Ga0496114_0013670_237_641 116
183 3300048918 Ga0496115_0233440 Ga0496115_0233440_852_1256 116
184 3300048929 Ga0496126_0024577 Ga0496126_0024577_3018_3386 116
185 3300005337 Ga0070682_100884637 Ga0070682_1008846371 117
186 3300005338 Ga0068868_100581055 Ga0068868_1005810552 117
187 3300005339 Ga0070660_100313786 Ga0070660_1003137862 117
188 3300005366 Ga0070659_100030882 Ga0070659_1000308823 117
189 3300005436 Ga0070713_100263862 Ga0070713_1002638623 117
190 3300005436 Ga0070713_101498763 Ga0070713_1014987632 117
191 3300005455 Ga0070663_100122415 Ga0070663_1001224153 117
192 3300005456 Ga0070678_100503563 Ga0070678_1005035632 117
193 3300005456 Ga0070678_101035630 Ga0070678_1010356301 117
194 3300005535 Ga0070684_100238972 Ga0070684_1002389721 117
195 3300005535 Ga0070684_101307283 Ga0070684_1013072832 117
196 3300005548 Ga0070665_100150342 Ga0070665_1001503422 117
197 3300005564 Ga0070664_100131133 Ga0070664_1001311332 117
198 3300005577 Ga0068857_100769685 Ga0068857_1007696851 117
199 3300005617 Ga0068859_101562035 Ga0068859_1015620352 117
200 3300005618 Ga0068864_100189578 Ga0068864_1001895783 117
201 3300005834 Ga0068851_10098824 Ga0068851_100988242 117
202 3300005840 Ga0068870_10410050 Ga0068870_104100502 117
203 3300005842 Ga0068858_100766011 Ga0068858_1007660111 117
204 3300006358 Ga0068871_100709426 Ga0068871_1007094261 117
205 3300006931 Ga0097620_101562085 Ga0097620_1015620851 117
206 3300009094 Ga0111539_12256436 Ga0111539_122564362 117
207 3300009098 Ga0105245_10779848 Ga0105245_107798482 117
208 3300009101 Ga0105247_10383658 Ga0105247_103836581 117
209 3300009147 Ga0114129_11021087 Ga0114129_110210872 117
210 3300009176 Ga0105242_10569302 Ga0105242_105693021 117
211 3300009553 Ga0105249_12494479 Ga0105249_124944792 117
212 3300010375 Ga0105239_10870195 Ga0105239_108701952 117
213 3300010375 Ga0105239_11816212 Ga0105239_118162122 117
214 3300011119 Ga0105246_11488007 Ga0105246_114880071 117
215 3300013105 Ga0157369_11501494 Ga0157369_115014941 117
216 3300014325 Ga0163163_10362961 Ga0163163_103629612 117
217 3300014497 Ga0182008_10988643 Ga0182008_109886432 117
218 3300014745 Ga0157377_10184400 Ga0157377_101844002 117
219 3300014968 Ga0157379_10690337 Ga0157379_106903372 117
220 3300025899 Ga0207642_10234247 Ga0207642_102342472 117
221 3300025900 Ga0207710_10596490 Ga0207710_105964901 117
222 3300025908 Ga0207643_10370237 Ga0207643_103702371 117
223 3300025919 Ga0207657_10152361 Ga0207657_101523613 117
224 3300025922 Ga0207646_10088665 Ga0207646_100886654 117
225 3300025925 Ga0207650_11523366 Ga0207650_115233662 117
226 3300025927 Ga0207687_10197693 Ga0207687_101976932 117
227 3300025928 Ga0207700_10009263 Ga0207700_100092638 117
228 3300025928 Ga0207700_10464388 Ga0207700_104643882 117
229 3300025936 Ga0207670_10096131 Ga0207670_100961313 117
230 3300025945 Ga0207679_11156040 Ga0207679_111560401 117
231 3300025949 Ga0207667_10458925 Ga0207667_104589252 117
232 3300025961 Ga0207712_11431061 Ga0207712_114310612 117
233 3300026023 Ga0207677_10327913 Ga0207677_103279132 117
234 3300026035 Ga0207703_10458548 Ga0207703_104585482 117
235 3300026067 Ga0207678_10104558 Ga0207678_101045583 117
236 3300026067 Ga0207678_11438847 Ga0207678_114388472 117
237 3300026078 Ga0207702_11046008 Ga0207702_110460082 117
238 3300026088 Ga0207641_10264833 Ga0207641_102648331 117
239 3300026095 Ga0207676_10379543 Ga0207676_103795432 117
240 3300026121 Ga0207683_10224995 Ga0207683_102249952 117
241 3300028379 Ga0268266_10094489 Ga0268266_100944893 117
242 3300028379 Ga0268266_10561420 Ga0268266_105614201 117
243 3300028381 Ga0268264_11088194 Ga0268264_110881942 117
244 3300035725 Ga0373947_0871213 Ga0373947_0871213_145_498 117
245 3300044658 Ga0466972_0179580 Ga0466972_0179580_123_488 117
246 3300044901 Ga0466960_0026340 Ga0466960_0026340_273_635 117
247 3300045976 Ga0466967_0744873 Ga0466967_0744873_118_492 117
248 3300048907 Ga0496104_1562008 Ga0496104_1562008_89_454 117
249 3300048909 Ga0496106_0309783 Ga0496106_0309783_806_1171 117
250 3300048911 Ga0496108_0190165 Ga0496108_0190165_179_544 117
251 3300048912 Ga0496109_1063842 Ga0496109_1063842_208_573 117
252 3300048916 Ga0496113_1418373 Ga0496113_1418373_133_498 117
253 iso_pu_bacteria 2870721527 2870729125 117
254 3300005329 Ga0070683_100796339 Ga0070683_1007963391 118
255 3300005337 Ga0070682_100319565 Ga0070682_1003195652 118
256 3300005437 Ga0070710_10190195 Ga0070710_101901952 118
257 3300005614 Ga0068856_100042296 Ga0068856_1000422965 118
258 3300005937 Ga0081455_10012740 Ga0081455_100127402 118
259 3300006163 Ga0070715_10001007 Ga0070715_100010077 118
260 3300006173 Ga0070716_100028331 Ga0070716_1000283314 118
261 3300006173 Ga0070716_100080873 Ga0070716_1000808732 118
262 3300006175 Ga0070712_100453204 Ga0070712_1004532042 118
263 3300006237 Ga0097621_100388232 Ga0097621_1003882323 118
264 3300013306 Ga0163162_10704482 Ga0163162_107044821 118
265 3300013307 Ga0157372_12481884 Ga0157372_124818842 118
266 3300014968 Ga0157379_10696713 Ga0157379_106967131 118
267 3300014969 Ga0157376_10958946 Ga0157376_109589462 118
268 3300022467 Ga0224712_10096279 Ga0224712_100962793 118
269 3300025898 Ga0207692_10040645 Ga0207692_100406453 118
270 3300025905 Ga0207685_10077184 Ga0207685_100771843 118
271 3300025915 Ga0207693_10002838 Ga0207693_100028384 118
272 3300025916 Ga0207663_10092844 Ga0207663_100928442 118
273 3300025917 Ga0207660_11715109 Ga0207660_117151091 118
274 3300025928 Ga0207700_10126999 Ga0207700_101269992 118
275 3300025929 Ga0207664_10062607 Ga0207664_100626074 118
276 3300025939 Ga0207665_10004471 Ga0207665_100044714 118
277 3300025939 Ga0207665_10005230 Ga0207665_100052307 118
278 3300025944 Ga0207661_10992529 Ga0207661_109925292 118
279 3300025945 Ga0207679_10293152 Ga0207679_102931522 118
280 3300035083 Ga0373926_0003730 Ga0373926_0003730_4023_4409 118
281 3300035086 Ga0373934_0135914 Ga0373934_0135914_37_423 118
282 3300035089 Ga0373944_0005260 Ga0373944_0005260_623_1009 118
283 3300035113 Ga0373936_0000206 Ga0373936_0000206_17647_18033 118
284 3300035116 Ga0373945_0001919 Ga0373945_0001919_4612_4998 118
285 3300035170 Ga0373943_0001364 Ga0373943_0001364_4681_5067 118
286 3300035171 Ga0373946_0000123 Ga0373946_0000123_6072_6458 118
287 3300035172 Ga0373955_0072561 Ga0373955_0072561_857_1243 118
288 3300035207 Ga0373942_0020587 Ga0373942_0020587_585_971 118
289 3300035692 Ga0373935_0005609 Ga0373935_0005609_1164_1550 118
290 3300035695 Ga0373927_0001451 Ga0373927_0001451_5733_6119 118
291 3300035725 Ga0373947_0000510 Ga0373947_0000510_15148_15534 118
292 3300036401 Ga0373937_0046204 Ga0373937_0046204_866_1252 118
293 3300036401 Ga0373937_1798970 Ga0373937_1798970_138_521 118
294 3300037068 Ga0373925_0000879 Ga0373925_0000879_11486_11872 118
295 3300037853 Ga0436364_1302603 Ga0436364_1302603_210_575 118
296 3300039437 Ga0436365_0985376 Ga0436365_0985376_107_493 118
297 3300039437 Ga0436365_1026192 Ga0436365_1026192_89_445 118
298 3300039450 Ga0436363_0682306 Ga0436363_0682306_342_728 118
299 3300042016 Ga0439463_025845 Ga0439463_025845_823_1194 118
300 3300044694 Ga0466963_0871806 Ga0466963_0871806_175_555 118
301 3300044842 Ga0466957_1288038 Ga0466957_1288038_120_500 118
302 3300046459 Ga0495629_0122290 Ga0495629_0122290_154_540 118
303 3300046462 Ga0495651_0012138 Ga0495651_0012138_4848_5234 118
304 3300046463 Ga0495653_0019577 Ga0495653_0019577_422_808 118
305 3300046476 Ga0495662_0008779 Ga0495662_0008779_615_1001 118
306 3300046477 Ga0495664_0001416 Ga0495664_0001416_8959_9345 118
307 3300046511 Ga0495608_0217297 Ga0495608_0217297_450_836 118
308 3300046514 Ga0495618_0038322 Ga0495618_0038322_613_999 118
309 3300046516 Ga0495628_0068577 Ga0495628_0068577_851_1237 118
310 3300046517 Ga0495630_0001678 Ga0495630_0001678_76_462 118
311 3300046529 Ga0495652_0014642 Ga0495652_0014642_925_1311 118
312 3300046531 Ga0495665_0027230 Ga0495665_0027230_906_1292 118
313 3300046533 Ga0495640_0155963 Ga0495640_0155963_382_768 118
314 3300046543 Ga0495645_0321713 Ga0495645_0321713_87_473 118
315 3300046559 Ga0495667_0002066 Ga0495667_0002066_4154_4540 118
316 3300046642 Ga0495634_0047852 Ga0495634_0047852_1826_2212 118
317 3300046663 Ga0495635_0002813 Ga0495635_0002813_8232_8618 118
318 3300046675 Ga0495657_0016729 Ga0495657_0016729_1414_1800 118
319 3300046678 Ga0495599_0007609 Ga0495599_0007609_4154_4540 118
320 3300046681 Ga0495647_0156642 Ga0495647_0156642_517_903 118
321 3300046683 Ga0495658_0700943 Ga0495658_0700943_176_562 118
322 3300047315 Ga0495581_0020561 Ga0495581_0020561_679_1065 118
323 3300047319 Ga0495674_0002794 Ga0495674_0002794_13337_13723 118
324 3300047321 Ga0495676_0007451 Ga0495676_0007451_5948_6334 118
325 3300047322 Ga0495680_0015795 Ga0495680_0015795_2484_2870 118
326 3300047471 Ga0495684_0006613 Ga0495684_0006613_4452_4838 118
327 3300047673 Ga0495593_0159897 Ga0495593_0159897_533_919 118
328 3300048904 Ga0496101_0225368 Ga0496101_0225368_874_1236 118
329 3300048905 Ga0496102_0111722 Ga0496102_0111722_1397_1759 118
330 3300048906 Ga0496103_0370228 Ga0496103_0370228_124_486 118
331 3300048907 Ga0496104_0005163 Ga0496104_0005163_2962_3324 118
332 3300048908 Ga0496105_0004718 Ga0496105_0004718_1988_2350 118
333 3300048910 Ga0496107_0171160 Ga0496107_0171160_415_777 118
334 3300048911 Ga0496108_0004974 Ga0496108_0004974_8279_8641 118
335 3300048912 Ga0496109_0010814 Ga0496109_0010814_5132_5494 118
336 3300048914 Ga0496111_0755443 Ga0496111_0755443_306_692 118
337 3300048915 Ga0496112_0223500 Ga0496112_0223500_554_916 118
338 3300048916 Ga0496113_0004041 Ga0496113_0004041_3634_3996 118
339 3300048918 Ga0496115_0022786 Ga0496115_0022786_2255_2617 118
340 3300050507 nmdc:mga05p37_945656_c1 nmdc:mga05p37_945656_c1_13_384 118
341 3300050510 nmdc:mga06r32_792933_c1 nmdc:mga06r32_792933_c1_66_437 118
342 3300050512 nmdc:mga0n895_2164801_c1 nmdc:mga0n895_2164801_c1_115_486 118
343 3300050513 nmdc:mga0rr50_1868136_c1 nmdc:mga0rr50_1868136_c1_26_388 118
344 3300053078 Ga0495612_0112953 Ga0495612_0112953_464_850 118
345 iso_pu_bacteria 3002998708 3003002236 118
346 3300005434 Ga0070709_10096367 Ga0070709_100963673 119
347 3300005436 Ga0070713_100030293 Ga0070713_1000302934 119
348 3300005436 Ga0070713_100614444 Ga0070713_1006144442 119
349 3300005439 Ga0070711_100025647 Ga0070711_1000256474 119
350 3300005841 Ga0068863_100657588 Ga0068863_1006575882 119
351 3300006028 Ga0070717_11232435 Ga0070717_112324352 119
352 3300006173 Ga0070716_100449537 Ga0070716_1004495372 119
353 3300009147 Ga0114129_10679304 Ga0114129_106793042 119
354 3300009177 Ga0105248_10592881 Ga0105248_105928812 119
355 3300021388 Ga0213875_10121738 Ga0213875_101217382 119
356 3300025928 Ga0207700_10291651 Ga0207700_102916512 119
357 3300026078 Ga0207702_10022811 Ga0207702_100228114 119
358 3300026088 Ga0207641_10178236 Ga0207641_101782362 119
359 3300037853 Ga0436364_1340274 Ga0436364_1340274_6090_6449 119
360 3300046529 Ga0495652_0169601 Ga0495652_0169601_1052_1450 119
361 3300053136 Ga0500559_0336106 Ga0500559_0336106_276_635 119
362 3300005440 Ga0070705_100127804 Ga0070705_1001278042 120
363 3300005471 Ga0070698_101397775 Ga0070698_1013977752 120
364 3300005614 Ga0068856_100158753 Ga0068856_1001587532 120
365 3300025928 Ga0207700_11096223 Ga0207700_110962232 120
366 3300037853 Ga0436364_0493666 Ga0436364_0493666_1164_1526 120
367 3300060353 Ga0501082_1616419 Ga0501082_1616419_184_552 120
368 3300005435 Ga0070714_100000937 Ga0070714_10000093717 121
369 3300005436 Ga0070713_100031660 Ga0070713_1000316602 121
370 3300005467 Ga0070706_101152073 Ga0070706_1011520731 121
371 3300006028 Ga0070717_10011647 Ga0070717_100116474 121
372 3300006871 Ga0075434_100008238 Ga0075434_1000082382 121
373 3300007076 Ga0075435_100132301 Ga0075435_1001323012 121
374 3300013105 Ga0157369_10290741 Ga0157369_102907413 121
375 3300017792 Ga0163161_10986533 Ga0163161_109865332 121
376 3300021384 Ga0213876_10025335 Ga0213876_100253353 121
377 3300025929 Ga0207664_10001327 Ga0207664_100013272 121
378 3300039437 Ga0436365_1268655 Ga0436365_1268655_22091_22456 121
379 3300044658 Ga0466972_0125251 Ga0466972_0125251_433_798 121
380 3300044684 Ga0466966_0284844 Ga0466966_0284844_100_465 121
381 3300044693 Ga0466961_0002925 Ga0466961_0002925_9724_10089 121
382 3300044694 Ga0466963_0135203 Ga0466963_0135203_848_1216 121
383 3300044719 Ga0466971_0091915 Ga0466971_0091915_109_474 121
384 3300044719 Ga0466971_0157557 Ga0466971_0157557_29_397 121
385 3300044765 Ga0466970_0270861 Ga0466970_0270861_575_940 121
386 3300044842 Ga0466957_0283700 Ga0466957_0283700_294_662 121
387 3300044842 Ga0466957_0309464 Ga0466957_0309464_130_495 121
388 3300045049 Ga0466959_0534964 Ga0466959_0534964_76_444 121
389 3300045836 Ga0466958_0060893 Ga0466958_0060893_333_698 121
390 3300045976 Ga0466967_0473759 Ga0466967_0473759_776_1144 121
391 3300048904 Ga0496101_0348623 Ga0496101_0348623_669_1043 121
392 3300048905 Ga0496102_0249595 Ga0496102_0249595_805_1179 121
393 3300048907 Ga0496104_0181582 Ga0496104_0181582_262_636 121
394 3300048908 Ga0496105_0012672 Ga0496105_0012672_484_858 121
395 3300048909 Ga0496106_0029465 Ga0496106_0029465_2860_3234 121
396 3300048911 Ga0496108_0085639 Ga0496108_0085639_1560_1934 121
397 3300048912 Ga0496109_0044183 Ga0496109_0044183_3074_3448 121
398 3300048913 Ga0496110_0097105 Ga0496110_0097105_1758_2132 121
399 3300048914 Ga0496111_0024913 Ga0496111_0024913_700_1074 121
400 3300048917 Ga0496114_0370529 Ga0496114_0370529_262_636 121
401 3300050512 nmdc:mga0n895_2169_c1 nmdc:mga0n895_2169_c1_3244_3645 121
402 3300050513 nmdc:mga0rr50_220574_c1 nmdc:mga0rr50_220574_c1_931_1332 121
403 3300061719 Ga0466962_0114843 Ga0466962_0114843_586_951 121
404 3300002459 JGI24751J29686_10003182 JGI24751J29686_100031821 122
405 3300005327 Ga0070658_10040464 Ga0070658_100404645 122
406 3300005328 Ga0070676_10331454 Ga0070676_103314542 122
407 3300005329 Ga0070683_100052373 Ga0070683_1000523735 122
408 3300005329 Ga0070683_101308524 Ga0070683_1013085242 122
409 3300005330 Ga0070690_101437926 Ga0070690_1014379262 122
410 3300005331 Ga0070670_100255372 Ga0070670_1002553723 122
411 3300005334 Ga0068869_100110630 Ga0068869_1001106303 122
412 3300005335 Ga0070666_10614291 Ga0070666_106142912 122
413 3300005336 Ga0070680_100711232 Ga0070680_1007112322 122
414 3300005337 Ga0070682_100025511 Ga0070682_1000255113 122
415 3300005338 Ga0068868_100557480 Ga0068868_1005574802 122
416 3300005338 Ga0068868_101424320 Ga0068868_1014243202 122
417 3300005340 Ga0070689_100116724 Ga0070689_1001167243 122
418 3300005341 Ga0070691_10026408 Ga0070691_100264082 122
419 3300005344 Ga0070661_100151274 Ga0070661_1001512742 122
420 3300005345 Ga0070692_10013899 Ga0070692_100138995 122
421 3300005354 Ga0070675_100124838 Ga0070675_1001248383 122
422 3300005355 Ga0070671_100005402 Ga0070671_1000054022 122
423 3300005364 Ga0070673_100314174 Ga0070673_1003141742 122
424 3300005364 Ga0070673_100318813 Ga0070673_1003188132 122
425 3300005365 Ga0070688_100100420 Ga0070688_1001004203 122
426 3300005366 Ga0070659_100394351 Ga0070659_1003943512 122
427 3300005367 Ga0070667_100435226 Ga0070667_1004352262 122
428 3300005367 Ga0070667_101851071 Ga0070667_1018510712 122
429 3300005434 Ga0070709_10337100 Ga0070709_103371002 122
430 3300005434 Ga0070709_10400314 Ga0070709_104003142 122
431 3300005435 Ga0070714_100392814 Ga0070714_1003928141 122
432 3300005435 Ga0070714_100624457 Ga0070714_1006244572 122
433 3300005436 Ga0070713_100156458 Ga0070713_1001564582 122
434 3300005439 Ga0070711_100710542 Ga0070711_1007105422 122
435 3300005440 Ga0070705_100611013 Ga0070705_1006110132 122
436 3300005441 Ga0070700_100033987 Ga0070700_1000339873 122
437 3300005455 Ga0070663_100016494 Ga0070663_1000164945 122
438 3300005456 Ga0070678_101122991 Ga0070678_1011229912 122
439 3300005457 Ga0070662_100511848 Ga0070662_1005118482 122
440 3300005458 Ga0070681_10032437 Ga0070681_100324373 122
441 3300005466 Ga0070685_10231754 Ga0070685_102317542 122
442 3300005467 Ga0070706_100297573 Ga0070706_1002975731 122
443 3300005467 Ga0070706_100872534 Ga0070706_1008725342 122
444 3300005468 Ga0070707_100005889 Ga0070707_10000588916 122
445 3300005468 Ga0070707_100020582 Ga0070707_1000205829 122
446 3300005468 Ga0070707_101950411 Ga0070707_1019504111 122
447 3300005471 Ga0070698_100384244 Ga0070698_1003842442 122
448 3300005530 Ga0070679_100034523 Ga0070679_1000345235 122
449 3300005530 Ga0070679_100174074 Ga0070679_1001740741 122
450 3300005535 Ga0070684_100114599 Ga0070684_1001145993 122
451 3300005535 Ga0070684_100611980 Ga0070684_1006119802 122
452 3300005535 Ga0070684_102158659 Ga0070684_1021586591 122
453 3300005544 Ga0070686_100644652 Ga0070686_1006446522 122
454 3300005545 Ga0070695_101069987 Ga0070695_1010699872 122
455 3300005547 Ga0070693_100348721 Ga0070693_1003487212 122
456 3300005548 Ga0070665_100019562 Ga0070665_1000195623 122
457 3300005549 Ga0070704_100507319 Ga0070704_1005073191 122
458 3300005563 Ga0068855_100573435 Ga0068855_1005734352 122
459 3300005564 Ga0070664_100572186 Ga0070664_1005721862 122
460 3300005564 Ga0070664_100892212 Ga0070664_1008922122 122
461 3300005564 Ga0070664_102166292 Ga0070664_1021662921 122
462 3300005577 Ga0068857_100926014 Ga0068857_1009260142 122
463 3300005614 Ga0068856_101427183 Ga0068856_1014271832 122
464 3300005615 Ga0070702_100000699 Ga0070702_1000006992 122
465 3300005615 Ga0070702_100326675 Ga0070702_1003266752 122
466 3300005615 Ga0070702_100876734 Ga0070702_1008767341 122
467 3300005616 Ga0068852_100017058 Ga0068852_1000170585 122
468 3300005617 Ga0068859_100355094 Ga0068859_1003550943 122
469 3300005617 Ga0068859_102774994 Ga0068859_1027749941 122
470 3300005618 Ga0068864_100180116 Ga0068864_1001801162 122
471 3300005618 Ga0068864_100295598 Ga0068864_1002955982 122
472 3300005618 Ga0068864_100497376 Ga0068864_1004973761 122
473 3300005834 Ga0068851_10018753 Ga0068851_100187534 122
474 3300005840 Ga0068870_10037245 Ga0068870_100372452 122
475 3300005841 Ga0068863_100014461 Ga0068863_1000144613 122
476 3300005841 Ga0068863_100225369 Ga0068863_1002253692 122
477 3300005841 Ga0068863_100588458 Ga0068863_1005884582 122
478 3300005842 Ga0068858_100007085 Ga0068858_1000070855 122
479 3300005844 Ga0068862_100930876 Ga0068862_1009308762 122
480 3300005983 Ga0081540_1000130 Ga0081540_100013021 122
481 3300006058 Ga0075432_10078620 Ga0075432_100786202 122
482 3300006175 Ga0070712_100818426 Ga0070712_1008184262 122
483 3300006237 Ga0097621_100012139 Ga0097621_1000121395 122
484 3300006358 Ga0068871_100114640 Ga0068871_1001146402 122
485 3300006358 Ga0068871_100463449 Ga0068871_1004634492 122
486 3300006844 Ga0075428_100712971 Ga0075428_1007129712 122
487 3300006847 Ga0075431_100340777 Ga0075431_1003407772 122
488 3300006852 Ga0075433_10030854 Ga0075433_100308545 122
489 3300006871 Ga0075434_100028027 Ga0075434_1000280275 122
490 3300006880 Ga0075429_100327577 Ga0075429_1003275773 122
491 3300006914 Ga0075436_100119535 Ga0075436_1001195354 122
492 3300006914 Ga0075436_100451878 Ga0075436_1004518782 122
493 3300006931 Ga0097620_100355098 Ga0097620_1003550982 122
494 3300006931 Ga0097620_102774409 Ga0097620_1027744092 122
495 3300007076 Ga0075435_100085064 Ga0075435_1000850643 122
496 3300009094 Ga0111539_10066323 Ga0111539_100663232 122
497 3300009094 Ga0111539_10614608 Ga0111539_106146082 122
498 3300009098 Ga0105245_10012353 Ga0105245_100123532 122
499 3300009098 Ga0105245_10306220 Ga0105245_103062203 122
500 3300009098 Ga0105245_10864737 Ga0105245_108647371 122
501 3300009101 Ga0105247_10269257 Ga0105247_102692571 122
502 3300009101 Ga0105247_10645988 Ga0105247_106459882 122
503 3300009101 Ga0105247_10916399 Ga0105247_109163992 122
504 3300009147 Ga0114129_10385042 Ga0114129_103850423 122
505 3300009174 Ga0105241_10008085 Ga0105241_100080855 122
506 3300009174 Ga0105241_10501419 Ga0105241_105014192 122
507 3300009177 Ga0105248_10493782 Ga0105248_104937821 122
508 3300009545 Ga0105237_10158460 Ga0105237_101584602 122
509 3300009551 Ga0105238_10026472 Ga0105238_100264723 122
510 3300009553 Ga0105249_10275336 Ga0105249_102753362 122
511 3300010375 Ga0105239_10417257 Ga0105239_104172572 122
512 3300010375 Ga0105239_12530365 Ga0105239_125303652 122
513 3300011119 Ga0105246_10004526 Ga0105246_100045266 122
514 3300011119 Ga0105246_10687854 Ga0105246_106878542 122
515 3300013102 Ga0157371_10086727 Ga0157371_100867273 122
516 3300013104 Ga0157370_10024014 Ga0157370_100240142 122
517 3300013104 Ga0157370_10309511 Ga0157370_103095112 122
518 3300013105 Ga0157369_10059476 Ga0157369_100594765 122
519 3300013105 Ga0157369_10586110 Ga0157369_105861102 122
520 3300013296 Ga0157374_10015605 Ga0157374_100156056 122
521 3300013296 Ga0157374_10565468 Ga0157374_105654682 122
522 3300013296 Ga0157374_11097550 Ga0157374_110975502 122
523 3300013306 Ga0163162_10800267 Ga0163162_108002672 122
524 3300013306 Ga0163162_10814133 Ga0163162_108141332 122
525 3300013308 Ga0157375_10138437 Ga0157375_101384373 122
526 3300013308 Ga0157375_10262065 Ga0157375_102620652 122
527 3300013308 Ga0157375_10291180 Ga0157375_102911803 122
528 3300014325 Ga0163163_10277423 Ga0163163_102774232 122
529 3300014325 Ga0163163_10486663 Ga0163163_104866632 122
530 3300014325 Ga0163163_10541370 Ga0163163_105413702 122
531 3300014325 Ga0163163_10561257 Ga0163163_105612572 122
532 3300014325 Ga0163163_10961725 Ga0163163_109617252 122
533 3300014325 Ga0163163_11424862 Ga0163163_114248622 122
534 3300014326 Ga0157380_10627038 Ga0157380_106270381 122
535 3300014326 Ga0157380_10662032 Ga0157380_106620322 122
536 3300014497 Ga0182008_10262034 Ga0182008_102620342 122
537 3300014745 Ga0157377_10063184 Ga0157377_100631842 122
538 3300014745 Ga0157377_11070178 Ga0157377_110701781 122
539 3300014969 Ga0157376_11133679 Ga0157376_111336792 122
540 3300014969 Ga0157376_11436643 Ga0157376_114366432 122
541 3300017792 Ga0163161_10391681 Ga0163161_103916811 122
542 3300020069 Ga0197907_10462210 Ga0197907_104622102 122
543 3300020081 Ga0206354_11300942 Ga0206354_113009423 122
544 3300020082 Ga0206353_10100621 Ga0206353_101006213 122
545 3300020082 Ga0206353_10237056 Ga0206353_102370562 122
546 3300021388 Ga0213875_10000104 Ga0213875_1000010416 122
547 3300022467 Ga0224712_10104518 Ga0224712_101045182 122
548 3300025321 Ga0207656_10025425 Ga0207656_100254252 122
549 3300025898 Ga0207692_10001780 Ga0207692_100017803 122
550 3300025898 Ga0207692_10271138 Ga0207692_102711382 122
551 3300025900 Ga0207710_10274048 Ga0207710_102740481 122
552 3300025901 Ga0207688_10013216 Ga0207688_100132163 122
553 3300025903 Ga0207680_10290077 Ga0207680_102900771 122
554 3300025903 Ga0207680_10292423 Ga0207680_102924232 122
555 3300025904 Ga0207647_10057082 Ga0207647_100570822 122
556 3300025905 Ga0207685_10008461 Ga0207685_100084615 122
557 3300025906 Ga0207699_10017496 Ga0207699_100174962 122
558 3300025906 Ga0207699_10252090 Ga0207699_102520902 122
559 3300025906 Ga0207699_10373324 Ga0207699_103733242 122
560 3300025907 Ga0207645_10303888 Ga0207645_103038882 122
561 3300025908 Ga0207643_10000196 Ga0207643_100001962 122
562 3300025909 Ga0207705_10229386 Ga0207705_102293862 122
563 3300025910 Ga0207684_10377861 Ga0207684_103778611 122
564 3300025911 Ga0207654_10017240 Ga0207654_100172402 122
565 3300025912 Ga0207707_10036983 Ga0207707_100369835 122
566 3300025914 Ga0207671_10173318 Ga0207671_101733183 122
567 3300025915 Ga0207693_10657585 Ga0207693_106575851 122
568 3300025917 Ga0207660_10741866 Ga0207660_107418662 122
569 3300025918 Ga0207662_11333249 Ga0207662_113332492 122
570 3300025919 Ga0207657_10051547 Ga0207657_100515473 122
571 3300025920 Ga0207649_10206430 Ga0207649_102064302 122
572 3300025921 Ga0207652_10309723 Ga0207652_103097233 122
573 3300025922 Ga0207646_10174644 Ga0207646_101746443 122
574 3300025922 Ga0207646_10182493 Ga0207646_101824932 122
575 3300025925 Ga0207650_10015635 Ga0207650_100156352 122
576 3300025926 Ga0207659_10012749 Ga0207659_100127495 122
577 3300025926 Ga0207659_10497983 Ga0207659_104979832 122
578 3300025926 Ga0207659_10847512 Ga0207659_108475122 122
579 3300025927 Ga0207687_10172821 Ga0207687_101728213 122
580 3300025927 Ga0207687_10258370 Ga0207687_102583702 122
581 3300025928 Ga0207700_10001069 Ga0207700_100010693 122
582 3300025929 Ga0207664_10417760 Ga0207664_104177602 122
583 3300025931 Ga0207644_10013239 Ga0207644_100132393 122
584 3300025932 Ga0207690_10374532 Ga0207690_103745322 122
585 3300025933 Ga0207706_10171732 Ga0207706_101717322 122
586 3300025934 Ga0207686_10841877 Ga0207686_108418772 122
587 3300025935 Ga0207709_10631566 Ga0207709_106315662 122
588 3300025940 Ga0207691_10154496 Ga0207691_101544962 122
589 3300025940 Ga0207691_10677181 Ga0207691_106771812 122
590 3300025941 Ga0207711_10697514 Ga0207711_106975142 122
591 3300025942 Ga0207689_10001658 Ga0207689_100016584 122
592 3300025942 Ga0207689_10666031 Ga0207689_106660311 122
593 3300025942 Ga0207689_11676632 Ga0207689_116766321 122
594 3300025944 Ga0207661_10019838 Ga0207661_100198383 122
595 3300025944 Ga0207661_10328861 Ga0207661_103288613 122
596 3300025944 Ga0207661_10882785 Ga0207661_108827852 122
597 3300025945 Ga0207679_10004949 Ga0207679_100049492 122
598 3300025945 Ga0207679_10533408 Ga0207679_105334082 122
599 3300025949 Ga0207667_10302014 Ga0207667_103020142 122
600 3300025960 Ga0207651_10490902 Ga0207651_104909022 122
601 3300025961 Ga0207712_10147227 Ga0207712_101472273 122
602 3300025972 Ga0207668_11835155 Ga0207668_118351552 122
603 3300025981 Ga0207640_10164234 Ga0207640_101642343 122
604 3300026023 Ga0207677_10144765 Ga0207677_101447652 122
605 3300026023 Ga0207677_10412372 Ga0207677_104123722 122
606 3300026023 Ga0207677_11586313 Ga0207677_115863132 122
607 3300026035 Ga0207703_10105533 Ga0207703_101055333 122
608 3300026041 Ga0207639_11619761 Ga0207639_116197611 122
609 3300026067 Ga0207678_10000794 Ga0207678_1000079415 122
610 3300026075 Ga0207708_10012630 Ga0207708_100126305 122
611 3300026078 Ga0207702_10020495 Ga0207702_100204955 122
612 3300026088 Ga0207641_10511129 Ga0207641_105111292 122
613 3300026095 Ga0207676_10000651 Ga0207676_1000065122 122
614 3300026095 Ga0207676_10622093 Ga0207676_106220932 122
615 3300026095 Ga0207676_11211410 Ga0207676_112114102 122
616 3300026121 Ga0207683_10010407 Ga0207683_100104076 122
617 3300026121 Ga0207683_10029666 Ga0207683_100296667 122
618 3300026142 Ga0207698_10009693 Ga0207698_100096935 122
619 3300027907 Ga0207428_10037356 Ga0207428_100373563 122
620 3300028379 Ga0268266_10430738 Ga0268266_104307382 122
621 3300028380 Ga0268265_10629585 Ga0268265_106295852 122
622 3300028381 Ga0268264_10056594 Ga0268264_100565943 122
623 3300035086 Ga0373934_0000161 Ga0373934_0000161_9763_10131 122
624 3300035111 Ga0373923_0017856 Ga0373923_0017856_231_599 122
625 3300035113 Ga0373936_0008494 Ga0373936_0008494_1084_1491 122
626 3300035113 Ga0373936_0431587 Ga0373936_0431587_74_442 122
627 3300035115 Ga0373941_0426801 Ga0373941_0426801_66_458 122
628 3300035117 Ga0373953_0000035 Ga0373953_0000035_5247_5615 122
629 3300035118 Ga0373954_0006506 Ga0373954_0006506_3047_3415 122
630 3300035118 Ga0373954_0201926 Ga0373954_0201926_11_418 122
631 3300035119 Ga0373956_0000318 Ga0373956_0000318_13087_13455 122
632 3300035119 Ga0373956_0007792 Ga0373956_0007792_283_690 122
633 3300035120 Ga0373957_0000039 Ga0373957_0000039_30434_30802 122
634 3300035170 Ga0373943_0026256 Ga0373943_0026256_2225_2632 122
635 3300035171 Ga0373946_0083161 Ga0373946_0083161_831_1238 122
636 3300035172 Ga0373955_0000124 Ga0373955_0000124_2140_2508 122
637 3300035410 Ga0373924_0000479 Ga0373924_0000479_8341_8709 122
638 3300035410 Ga0373924_0035869 Ga0373924_0035869_379_786 122
639 3300035691 Ga0373931_0069736 Ga0373931_0069736_1258_1626 122
640 3300035692 Ga0373935_0168854 Ga0373935_0168854_114_521 122
641 3300035692 Ga0373935_0433572 Ga0373935_0433572_488_865 122
642 3300035695 Ga0373927_0064620 Ga0373927_0064620_1691_2098 122
643 3300035724 Ga0373933_0000069 Ga0373933_0000069_34381_34749 122
644 3300035724 Ga0373933_0023254 Ga0373933_0023254_2876_3283 122
645 3300035725 Ga0373947_1160396 Ga0373947_1160396_44_421 122
646 3300036401 Ga0373937_0000168 Ga0373937_0000168_35065_35433 122
647 3300036401 Ga0373937_0324361 Ga0373937_0324361_367_735 122
648 3300037068 Ga0373925_0002965 Ga0373925_0002965_9336_9719 122
649 3300037853 Ga0436364_0153646 Ga0436364_0153646_29_415 122
650 3300037853 Ga0436364_1079797 Ga0436364_1079797_348_734 122
651 3300037853 Ga0436364_1497153 Ga0436364_1497153_52998_53381 122
652 3300039437 Ga0436365_1931865 Ga0436365_1931865_1248_1631 122
653 3300039453 Ga0436362_0768964 Ga0436362_0768964_89_466 122
654 3300041507 Ga0451851_1363798 Ga0451851_1363798_127_510 122
655 3300042012 Ga0439455_0221766 Ga0439455_0221766_160_528 122
656 3300042016 Ga0439463_104456 Ga0439463_104456_264_632 122
657 3300042157 Ga0439458_0049023 Ga0439458_0049023_93_461 122
658 3300042438 Ga0439459_0002078 Ga0439459_0002078_326_694 122
659 3300044684 Ga0466966_0085686 Ga0466966_0085686_1300_1677 122
660 3300044693 Ga0466961_0164307 Ga0466961_0164307_195_572 122
661 3300045049 Ga0466959_0071971 Ga0466959_0071971_2105_2482 122
662 3300045976 Ga0466967_0256960 Ga0466967_0256960_390_812 122
663 3300046454 Ga0495592_0000144 Ga0495592_0000144_28235_28603 122
664 3300046455 Ga0495603_0238032 Ga0495603_0238032_122_505 122
665 3300046455 Ga0495603_0515673 Ga0495603_0515673_266_649 122
666 3300046459 Ga0495629_0016555 Ga0495629_0016555_1895_2302 122
667 3300046462 Ga0495651_0000100 Ga0495651_0000100_28235_28603 122
668 3300046463 Ga0495653_0000436 Ga0495653_0000436_7468_7836 122
669 3300046463 Ga0495653_0043967 Ga0495653_0043967_34_441 122
670 3300046472 Ga0495580_0068952 Ga0495580_0068952_28_435 122
671 3300046475 Ga0495639_0042213 Ga0495639_0042213_1267_1674 122
672 3300046477 Ga0495664_0070271 Ga0495664_0070271_963_1361 122
673 3300046511 Ga0495608_0000093 Ga0495608_0000093_56194_56562 122
674 3300046511 Ga0495608_0009607 Ga0495608_0009607_776_1183 122
675 3300046516 Ga0495628_0000308 Ga0495628_0000308_29913_30281 122
676 3300046516 Ga0495628_0725202 Ga0495628_0725202_29_427 122
677 3300046517 Ga0495630_0028951 Ga0495630_0028951_3396_3803 122
678 3300046517 Ga0495630_0176284 Ga0495630_0176284_943_1326 122
679 3300046523 Ga0495644_0163044 Ga0495644_0163044_348_728 122
680 3300046526 Ga0495666_0466604 Ga0495666_0466604_66_449 122
681 3300046529 Ga0495652_0000126 Ga0495652_0000126_55720_56088 122
682 3300046529 Ga0495652_0092705 Ga0495652_0092705_302_709 122
683 3300046531 Ga0495665_0076751 Ga0495665_0076751_663_1070 122
684 3300046536 Ga0495587_0000104 Ga0495587_0000104_28235_28603 122
685 3300046536 Ga0495587_0017950 Ga0495587_0017950_1013_1420 122
686 3300046543 Ga0495645_0111347 Ga0495645_0111347_191_589 122
687 3300046559 Ga0495667_0000097 Ga0495667_0000097_34381_34749 122
688 3300046642 Ga0495634_0150733 Ga0495634_0150733_223_606 122
689 3300046674 Ga0495588_0187321 Ga0495588_0187321_637_1020 122
690 3300046675 Ga0495657_0000325 Ga0495657_0000325_7648_8016 122
691 3300046675 Ga0495657_0022596 Ga0495657_0022596_11_418 122
692 3300046678 Ga0495599_0000214 Ga0495599_0000214_13287_13655 122
693 3300046678 Ga0495599_0310325 Ga0495599_0310325_304_702 122
694 3300046679 Ga0495623_0000090 Ga0495623_0000090_28222_28590 122
695 3300046680 Ga0495646_0032866 Ga0495646_0032866_2642_3049 122
696 3300046680 Ga0495646_0266648 Ga0495646_0266648_401_769 122
697 3300046681 Ga0495647_0144672 Ga0495647_0144672_52_459 122
698 3300046689 Ga0495613_0532616 Ga0495613_0532616_345_728 122
699 3300046690 Ga0495624_0072175 Ga0495624_0072175_616_1023 122
700 3300046690 Ga0495624_0327526 Ga0495624_0327526_104_481 122
701 3300046694 Ga0495649_0248720 Ga0495649_0248720_384_755 122
702 3300046809 Ga0495600_0010254 Ga0495600_0010254_1388_1756 122
703 3300046809 Ga0495600_0106319 Ga0495600_0106319_537_944 122
704 3300047315 Ga0495581_0025904 Ga0495581_0025904_234_641 122
705 3300047317 Ga0495604_0000135 Ga0495604_0000135_34381_34749 122
706 3300047317 Ga0495604_0026803 Ga0495604_0026803_3557_3964 122
707 3300047320 Ga0495672_0353707 Ga0495672_0353707_246_617 122
708 3300047321 Ga0495676_0243463 Ga0495676_0243463_513_920 122
709 3300047322 Ga0495680_0000156 Ga0495680_0000156_34659_35027 122
710 3300047322 Ga0495680_0030252 Ga0495680_0030252_2044_2451 122
711 3300047444 Ga0495675_0000102 Ga0495675_0000102_55974_56342 122
712 3300047444 Ga0495675_0039238 Ga0495675_0039238_500_907 122
713 3300047471 Ga0495684_0137566 Ga0495684_0137566_1192_1599 122
714 3300048088 Ga0495602_0005662 Ga0495602_0005662_451_819 122
715 3300048088 Ga0495602_0010831 Ga0495602_0010831_6580_6987 122
716 3300048089 Ga0495614_0086249 Ga0495614_0086249_407_814 122
717 3300048903 Ga0496100_0111409 Ga0496100_0111409_1440_1808 122
718 3300048904 Ga0496101_0197182 Ga0496101_0197182_882_1250 122
719 3300048904 Ga0496101_1029557 Ga0496101_1029557_222_605 122
720 3300048904 Ga0496101_1119315 Ga0496101_1119315_16_384 122
721 3300048907 Ga0496104_0030892 Ga0496104_0030892_381_749 122
722 3300048907 Ga0496104_0033506 Ga0496104_0033506_316_699 122
723 3300048908 Ga0496105_0021444 Ga0496105_0021444_3381_3749 122
724 3300048908 Ga0496105_1099946 Ga0496105_1099946_34_417 122
725 3300048909 Ga0496106_0086654 Ga0496106_0086654_1341_1709 122
726 3300048909 Ga0496106_0611718 Ga0496106_0611718_445_813 122
727 3300048909 Ga0496106_1044624 Ga0496106_1044624_181_564 122
728 3300048910 Ga0496107_0611012 Ga0496107_0611012_133_501 122
729 3300048911 Ga0496108_0136338 Ga0496108_0136338_554_958 122
730 3300048911 Ga0496108_0166408 Ga0496108_0166408_678_1046 122
731 3300048911 Ga0496108_0219703 Ga0496108_0219703_655_1038 122
732 3300048911 Ga0496108_0293786 Ga0496108_0293786_561_944 122
733 3300048911 Ga0496108_0297186 Ga0496108_0297186_621_1004 122
734 3300048912 Ga0496109_0057455 Ga0496109_0057455_1148_1531 122
735 3300048912 Ga0496109_0077768 Ga0496109_0077768_128_496 122
736 3300048912 Ga0496109_0138011 Ga0496109_0138011_257_640 122
737 3300048912 Ga0496109_0295637 Ga0496109_0295637_281_664 122
738 3300048912 Ga0496109_0727120 Ga0496109_0727120_93_476 122
739 3300048912 Ga0496109_1254922 Ga0496109_1254922_74_451 122
740 3300048913 Ga0496110_0124840 Ga0496110_0124840_683_1066 122
741 3300048913 Ga0496110_0293254 Ga0496110_0293254_434_802 122
742 3300048913 Ga0496110_1005325 Ga0496110_1005325_288_671 122
743 3300048914 Ga0496111_0170329 Ga0496111_0170329_1200_1583 122
744 3300048914 Ga0496111_0266597 Ga0496111_0266597_381_749 122
745 3300048914 Ga0496111_0807125 Ga0496111_0807125_117_494 122
746 3300048915 Ga0496112_0059896 Ga0496112_0059896_2957_3325 122
747 3300048915 Ga0496112_0150354 Ga0496112_0150354_401_784 122
748 3300048915 Ga0496112_0330872 Ga0496112_0330872_827_1210 122
749 3300048915 Ga0496112_0345562 Ga0496112_0345562_337_720 122
750 3300048915 Ga0496112_1327847 Ga0496112_1327847_221_589 122
751 3300048916 Ga0496113_0029533 Ga0496113_0029533_1320_1703 122
752 3300048916 Ga0496113_0045489 Ga0496113_0045489_2708_3091 122
753 3300048916 Ga0496113_0052594 Ga0496113_0052594_2459_2842 122
754 3300048916 Ga0496113_0098468 Ga0496113_0098468_1351_1719 122
755 3300048916 Ga0496113_0893121 Ga0496113_0893121_20_397 122
756 3300048917 Ga0496114_0031385 Ga0496114_0031385_464_832 122
757 3300048917 Ga0496114_0521928 Ga0496114_0521928_583_966 122
758 3300048917 Ga0496114_0573201 Ga0496114_0573201_133_516 122
759 3300048917 Ga0496114_1224364 Ga0496114_1224364_194_577 122
760 3300048917 Ga0496114_1262293 Ga0496114_1262293_189_557 122
761 3300048918 Ga0496115_0034857 Ga0496115_0034857_2816_3184 122
762 3300050507 nmdc:mga05p37_839899_c1 nmdc:mga05p37_839899_c1_459_827 122
763 3300050508 nmdc:mga09592_626685_c1 nmdc:mga09592_626685_c1_44_412 122
764 3300050511 nmdc:mga08y16_168979_c1 nmdc:mga08y16_168979_c1_1479_1847 122
765 3300050512 nmdc:mga0n895_10213_c1 nmdc:mga0n895_10213_c1_7478_7846 122
766 3300050513 nmdc:mga0rr50_2398_c1 nmdc:mga0rr50_2398_c1_4266_4634 122
767 3300050513 nmdc:mga0rr50_865846_c1 nmdc:mga0rr50_865846_c1_68_451 122
768 3300050514 nmdc:mga08x19_16151_c1 nmdc:mga08x19_16151_c1_876_1244 122
769 3300050514 nmdc:mga08x19_648448_c1 nmdc:mga08x19_648448_c1_199_579 122
770 3300050515 nmdc:mga0a205_39305_c1 nmdc:mga0a205_39305_c1_3623_3991 122
771 3300053077 Ga0495601_0035979 Ga0495601_0035979_2096_2503 122
772 3300053084 Ga0495595_0001660 Ga0495595_0001660_6912_7280 122
773 3300053085 Ga0495619_0022864 Ga0495619_0022864_1486_1893 122
774 3300053085 Ga0495619_0576728 Ga0495619_0576728_352_720 122
775 3300059424 Ga0590075_002138 Ga0590075_002138_2108_2491 122
776 3300059426 Ga0590077_004008 Ga0590077_004008_1948_2331 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9493 21 78
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9428 19 77
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9413 7 101
1sfu-assembly1.cif.gz_B crystal structure of the viral zalpha domain bound to left-handed z-dna 0.9358 33 77
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9344 24 77
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 21 76 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9493 21 78 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 19 77 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 23 77 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 21 78 1.10.10.10
ID Description Score Start End GO Terms
AF-K0EXS7-F1-model_v4 ArsR family transcriptional regulator 0.9969 5 100 GO:0003700
AF-A0A4R2HTP3-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9868 5 100 GO:0003677
GO:0003700
AF-A0A366LQW3-F1-model_v4 Transcriptional regulator 0.9862 2 97 GO:0003700
AF-A0A6N7FUD8-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.982 11 100 GO:0003700
AF-A0A2W2C315-F1-model_v4 Transcriptional regulator 0.9808 3 101 GO:0003700

Feature Viewer

pLDDT pTM Quality
89.62 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map