F480318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 338 | 772 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1000395|Ga0265337_100039523 |
| Length | 118 |
| Sequence | MPPPDGAAAGALAWGTGAPGTGAGHIEAVAEQVFIALADPSRRAILAALAGAGPATAALLTEAGLVTAEPGERRRVRYRLHSAPMRVAQQFLAALARDWDGPLGALKDHLDKQAGAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 2 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 243 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 244 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 245 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 246 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 1.16 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 10.82 |
| Rhizosphere | 85.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10003182 | 3300002459 | Bacteria | 3309 |
| 2 | Ga0070658_10040464 | 3300005327 | Bacteria | 3760 |
| 3 | Ga0070658_11657079 | 3300005327 | Bacteria | 554 |
| 4 | Ga0070676_10331454 | 3300005328 | Bacteria | 1041 |
| 5 | Ga0070683_100052373 | 3300005329 | Bacteria | 3781 |
| 6 | Ga0070683_100796339 | 3300005329 | Bacteria | 906 |
| 7 | Ga0070683_101308524 | 3300005329 | Bacteria | 696 |
| 8 | Ga0070690_101437926 | 3300005330 | Bacteria | 556 |
| 9 | Ga0070670_100255372 | 3300005331 | Bacteria | 1527 |
| 10 | Ga0068869_100110630 | 3300005334 | Bacteria | 2089 |
| 11 | Ga0070666_10614291 | 3300005335 | Bacteria | 794 |
| 12 | Ga0070680_100711232 | 3300005336 | Bacteria | 864 |
| 13 | Ga0070682_100025511 | 3300005337 | Bacteria | 3528 |
| 14 | Ga0070682_100319565 | 3300005337 | Bacteria | 1146 |
| 15 | Ga0070682_100884637 | 3300005337 | Bacteria | 733 |
| 16 | Ga0068868_100242163 | 3300005338 | Bacteria | 1516 |
| 17 | Ga0068868_100557480 | 3300005338 | Bacteria | 1010 |
| 18 | Ga0068868_100581055 | 3300005338 | Bacteria | 990 |
| 19 | Ga0068868_101424320 | 3300005338 | Bacteria | 647 |
| 20 | Ga0070660_100313786 | 3300005339 | Bacteria | 1287 |
| 21 | Ga0070689_100116724 | 3300005340 | Bacteria | 2128 |
| 22 | Ga0070691_10026408 | 3300005341 | Bacteria | 2706 |
| 23 | Ga0070687_101317826 | 3300005343 | Bacteria | 537 |
| 24 | Ga0070661_100151274 | 3300005344 | Bacteria | 1754 |
| 25 | Ga0070692_10013899 | 3300005345 | Bacteria | 3763 |
| 26 | Ga0070675_100124838 | 3300005354 | Bacteria | 2189 |
| 27 | Ga0070675_100844610 | 3300005354 | Bacteria | 838 |
| 28 | Ga0070671_100005402 | 3300005355 | Bacteria | 10189 |
| 29 | Ga0070674_100436357 | 3300005356 | Bacteria | 1078 |
| 30 | Ga0070673_100314174 | 3300005364 | Bacteria | 1383 |
| 31 | Ga0070673_100318813 | 3300005364 | Bacteria | 1373 |
| 32 | Ga0070673_101752924 | 3300005364 | Bacteria | 588 |
| 33 | Ga0070688_100100420 | 3300005365 | Bacteria | 1907 |
| 34 | Ga0070659_100030882 | 3300005366 | Bacteria | 4147 |
| 35 | Ga0070659_100394351 | 3300005366 | Bacteria | 1168 |
| 36 | Ga0070667_100435226 | 3300005367 | Bacteria | 1197 |
| 37 | Ga0070667_101851071 | 3300005367 | Bacteria | 568 |
| 38 | Ga0070709_10028810 | 3300005434 | Bacteria | 3315 |
| 39 | Ga0070709_10096367 | 3300005434 | Bacteria | 1961 |
| 40 | Ga0070709_10337100 | 3300005434 | Bacteria | 1111 |
| 41 | Ga0070709_10400314 | 3300005434 | Bacteria | 1025 |
| 42 | Ga0070714_100000937 | 3300005435 | Bacteria | 20745 |
| 43 | Ga0070714_100136993 | 3300005435 | Bacteria | 2193 |
| 44 | Ga0070714_100392814 | 3300005435 | Bacteria | 1310 |
| 45 | Ga0070714_100624457 | 3300005435 | Bacteria | 1036 |
| 46 | Ga0070714_100659508 | 3300005435 | Bacteria | 1008 |
| 47 | Ga0070714_100730257 | 3300005435 | Bacteria | 956 |
| 48 | Ga0070714_101139138 | 3300005435 | Bacteria | 761 |
| 49 | Ga0070713_100021731 | 3300005436 | Bacteria | 4943 |
| 50 | Ga0070713_100030293 | 3300005436 | Bacteria | 4296 |
| 51 | Ga0070713_100031660 | 3300005436 | Bacteria | 4216 |
| 52 | Ga0070713_100156458 | 3300005436 | Bacteria | 2032 |
| 53 | Ga0070713_100175596 | 3300005436 | Bacteria | 1922 |
| 54 | Ga0070713_100263862 | 3300005436 | Bacteria | 1575 |
| 55 | Ga0070713_100323660 | 3300005436 | Bacteria | 1424 |
| 56 | Ga0070713_100573788 | 3300005436 | Bacteria | 1070 |
| 57 | Ga0070713_100592023 | 3300005436 | Bacteria | 1053 |
| 58 | Ga0070713_100614444 | 3300005436 | Bacteria | 1033 |
| 59 | Ga0070713_101002666 | 3300005436 | Bacteria | 806 |
| 60 | Ga0070713_101498763 | 3300005436 | Bacteria | 654 |
| 61 | Ga0070710_10110023 | 3300005437 | Bacteria | 1654 |
| 62 | Ga0070710_10190195 | 3300005437 | Bacteria | 1290 |
| 63 | Ga0070710_10249046 | 3300005437 | Bacteria | 1141 |
| 64 | Ga0070711_100013342 | 3300005439 | Bacteria | 5159 |
| 65 | Ga0070711_100025647 | 3300005439 | Bacteria | 3858 |
| 66 | Ga0070711_100243365 | 3300005439 | Bacteria | 1407 |
| 67 | Ga0070711_100425451 | 3300005439 | Bacteria | 1083 |
| 68 | Ga0070711_100710542 | 3300005439 | Bacteria | 847 |
| 69 | Ga0070711_101064194 | 3300005439 | Bacteria | 696 |
| 70 | Ga0070705_100127804 | 3300005440 | Bacteria | 1653 |
| 71 | Ga0070705_100611013 | 3300005440 | Bacteria | 845 |
| 72 | Ga0070700_100033987 | 3300005441 | Bacteria | 3075 |
| 73 | Ga0070663_100016494 | 3300005455 | Bacteria | 4800 |
| 74 | Ga0070663_100122415 | 3300005455 | Bacteria | 1966 |
| 75 | Ga0070663_100448047 | 3300005455 | Bacteria | 1063 |
| 76 | Ga0070678_100503563 | 3300005456 | Bacteria | 1069 |
| 77 | Ga0070678_100567890 | 3300005456 | Bacteria | 1009 |
| 78 | Ga0070678_101035630 | 3300005456 | Bacteria | 756 |
| 79 | Ga0070678_101122991 | 3300005456 | Bacteria | 726 |
| 80 | Ga0070662_100511848 | 3300005457 | Bacteria | 1002 |
| 81 | Ga0070662_101162242 | 3300005457 | Bacteria | 663 |
| 82 | Ga0070681_10032437 | 3300005458 | Bacteria | 5242 |
| 83 | Ga0070685_10231754 | 3300005466 | Bacteria | 1215 |
| 84 | Ga0070706_100297573 | 3300005467 | Bacteria | 1506 |
| 85 | Ga0070706_100563986 | 3300005467 | Bacteria | 1059 |
| 86 | Ga0070706_100872534 | 3300005467 | Bacteria | 832 |
| 87 | Ga0070706_101152073 | 3300005467 | Unclassified | 713 |
| 88 | Ga0070707_100005889 | 3300005468 | Bacteria | 11433 |
| 89 | Ga0070707_100020582 | 3300005468 | Bacteria | 6225 |
| 90 | Ga0070707_101950411 | 3300005468 | Bacteria | 555 |
| 91 | Ga0070698_100384244 | 3300005471 | Bacteria | 1337 |
| 92 | Ga0070698_101397775 | 3300005471 | Bacteria | 651 |
| 93 | Ga0070679_100034523 | 3300005530 | Bacteria | 5013 |
| 94 | Ga0070679_100174074 | 3300005530 | Bacteria | 2125 |
| 95 | Ga0070679_100368759 | 3300005530 | Bacteria | 1383 |
| 96 | Ga0070684_100114599 | 3300005535 | Bacteria | 2420 |
| 97 | Ga0070684_100238972 | 3300005535 | Bacteria | 1659 |
| 98 | Ga0070684_100611980 | 3300005535 | Bacteria | 1013 |
| 99 | Ga0070684_101307283 | 3300005535 | Bacteria | 682 |
| 100 | Ga0070684_102158659 | 3300005535 | Bacteria | 525 |
| 101 | Ga0070686_100460688 | 3300005544 | Bacteria | 979 |
| 102 | Ga0070686_100644652 | 3300005544 | Bacteria | 839 |
| 103 | Ga0070695_101069987 | 3300005545 | Bacteria | 659 |
| 104 | Ga0070693_100348721 | 3300005547 | Bacteria | 1012 |
| 105 | Ga0070665_100019562 | 3300005548 | Bacteria | 6797 |
| 106 | Ga0070665_100150342 | 3300005548 | Bacteria | 2331 |
| 107 | Ga0070665_100208055 | 3300005548 | Bacteria | 1957 |
| 108 | Ga0070704_100507319 | 3300005549 | Bacteria | 1048 |
| 109 | Ga0068855_100573435 | 3300005563 | Bacteria | 1219 |
| 110 | Ga0070664_100131133 | 3300005564 | Bacteria | 2201 |
| 111 | Ga0070664_100572186 | 3300005564 | Bacteria | 1046 |
| 112 | Ga0070664_100859371 | 3300005564 | Bacteria | 850 |
| 113 | Ga0070664_100892212 | 3300005564 | Bacteria | 833 |
| 114 | Ga0070664_102166292 | 3300005564 | Bacteria | 527 |
| 115 | Ga0068857_100769685 | 3300005577 | Bacteria | 918 |
| 116 | Ga0068857_100906072 | 3300005577 | Bacteria | 846 |
| 117 | Ga0068857_100926014 | 3300005577 | Bacteria | 836 |
| 118 | Ga0068854_101810018 | 3300005578 | Bacteria | 560 |
| 119 | Ga0068856_100042296 | 3300005614 | Bacteria | 4482 |
| 120 | Ga0068856_100158753 | 3300005614 | Bacteria | 2272 |
| 121 | Ga0068856_101427183 | 3300005614 | Bacteria | 706 |
| 122 | Ga0070702_100000699 | 3300005615 | Bacteria | 12654 |
| 123 | Ga0070702_100326675 | 3300005615 | Bacteria | 1071 |
| 124 | Ga0070702_100876734 | 3300005615 | Bacteria | 701 |
| 125 | Ga0068852_100017058 | 3300005616 | Bacteria | 5687 |
| 126 | Ga0068859_100355094 | 3300005617 | Bacteria | 1561 |
| 127 | Ga0068859_101562035 | 3300005617 | Bacteria | 729 |
| 128 | Ga0068859_102774994 | 3300005617 | Bacteria | 538 |
| 129 | Ga0068864_100180116 | 3300005618 | Bacteria | 1932 |
| 130 | Ga0068864_100189578 | 3300005618 | Bacteria | 1884 |
| 131 | Ga0068864_100295598 | 3300005618 | Bacteria | 1515 |
| 132 | Ga0068864_100497376 | 3300005618 | Bacteria | 1172 |
| 133 | Ga0068864_100511097 | 3300005618 | Bacteria | 1157 |
| 134 | Ga0068864_100611038 | 3300005618 | Bacteria | 1059 |
| 135 | Ga0068851_10018753 | 3300005834 | Bacteria | 3338 |
| 136 | Ga0068851_10098824 | 3300005834 | Bacteria | 1546 |
| 137 | Ga0068870_10037245 | 3300005840 | Bacteria | 2506 |
| 138 | Ga0068870_10410050 | 3300005840 | Bacteria | 884 |
| 139 | Ga0068863_100014461 | 3300005841 | Bacteria | 7602 |
| 140 | Ga0068863_100225369 | 3300005841 | Bacteria | 1807 |
| 141 | Ga0068863_100588458 | 3300005841 | Bacteria | 1101 |
| 142 | Ga0068863_100657588 | 3300005841 | Bacteria | 1040 |
| 143 | Ga0068858_100007085 | 3300005842 | Bacteria | 10884 |
| 144 | Ga0068858_100766011 | 3300005842 | Bacteria | 941 |
| 145 | Ga0068862_100930876 | 3300005844 | Bacteria | 856 |
| 146 | Ga0081455_10012740 | 3300005937 | Bacteria | 8365 |
| 147 | Ga0081540_1000130 | 3300005983 | Bacteria | 80050 |
| 148 | Ga0081540_1018759 | 3300005983 | Bacteria | 4229 |
| 149 | Ga0081539_10184408 | 3300005985 | Bacteria | 976 |
| 150 | Ga0070717_10011647 | 3300006028 | Bacteria | 6689 |
| 151 | Ga0070717_10080331 | 3300006028 | Bacteria | 2736 |
| 152 | Ga0070717_10133495 | 3300006028 | Bacteria | 2137 |
| 153 | Ga0070717_10215727 | 3300006028 | Bacteria | 1685 |
| 154 | Ga0070717_10218010 | 3300006028 | Bacteria | 1676 |
| 155 | Ga0070717_10247061 | 3300006028 | Bacteria | 1575 |
| 156 | Ga0070717_10354842 | 3300006028 | Bacteria | 1312 |
| 157 | Ga0070717_11232435 | 3300006028 | Bacteria | 681 |
| 158 | Ga0075432_10078620 | 3300006058 | Bacteria | 1193 |
| 159 | Ga0070715_10001007 | 3300006163 | Bacteria | 7919 |
| 160 | Ga0070715_10158032 | 3300006163 | Bacteria | 1117 |
| 161 | Ga0070716_100028331 | 3300006173 | Bacteria | 3017 |
| 162 | Ga0070716_100080873 | 3300006173 | Bacteria | 1938 |
| 163 | Ga0070716_100449537 | 3300006173 | Bacteria | 939 |
| 164 | Ga0070712_100032518 | 3300006175 | Bacteria | 3523 |
| 165 | Ga0070712_100049959 | 3300006175 | Bacteria | 2907 |
| 166 | Ga0070712_100290209 | 3300006175 | Bacteria | 1320 |
| 167 | Ga0070712_100333417 | 3300006175 | Bacteria | 1237 |
| 168 | Ga0070712_100453204 | 3300006175 | Bacteria | 1068 |
| 169 | Ga0070712_100818426 | 3300006175 | Bacteria | 800 |
| 170 | Ga0070712_101179353 | 3300006175 | Bacteria | 666 |
| 171 | Ga0075367_10798380 | 3300006178 | Bacteria | 601 |
| 172 | Ga0097621_100012139 | 3300006237 | Bacteria | 6374 |
| 173 | Ga0097621_100388232 | 3300006237 | Bacteria | 1248 |
| 174 | Ga0068871_100114640 | 3300006358 | Bacteria | 2271 |
| 175 | Ga0068871_100463449 | 3300006358 | Bacteria | 1138 |
| 176 | Ga0068871_100709426 | 3300006358 | Bacteria | 922 |
| 177 | Ga0075428_100712971 | 3300006844 | Bacteria | 1068 |
| 178 | Ga0075430_101391243 | 3300006846 | Bacteria | 577 |
| 179 | Ga0075431_100340777 | 3300006847 | Bacteria | 1509 |
| 180 | Ga0075433_10030854 | 3300006852 | Bacteria | 4577 |
| 181 | Ga0075434_100008238 | 3300006871 | Bacteria | 9678 |
| 182 | Ga0075434_100028027 | 3300006871 | Bacteria | 5531 |
| 183 | Ga0075429_100327577 | 3300006880 | Bacteria | 1340 |
| 184 | Ga0068865_101285523 | 3300006881 | Bacteria | 650 |
| 185 | Ga0075436_100119535 | 3300006914 | Bacteria | 1843 |
| 186 | Ga0075436_100451878 | 3300006914 | Bacteria | 936 |
| 187 | Ga0097620_100355098 | 3300006931 | Bacteria | 1561 |
| 188 | Ga0097620_101562085 | 3300006931 | Bacteria | 729 |
| 189 | Ga0097620_102774409 | 3300006931 | Bacteria | 538 |
| 190 | Ga0075435_100085064 | 3300007076 | Bacteria | 2603 |
| 191 | Ga0075435_100132301 | 3300007076 | Bacteria | 2087 |
| 192 | Ga0099794_10227437 | 3300007265 | Bacteria | 959 |
| 193 | Ga0099794_10232037 | 3300007265 | Bacteria | 950 |
| 194 | Ga0111539_10066323 | 3300009094 | Bacteria | 4264 |
| 195 | Ga0111539_10614608 | 3300009094 | Bacteria | 1266 |
| 196 | Ga0111539_12256436 | 3300009094 | Bacteria | 631 |
| 197 | Ga0105245_10012353 | 3300009098 | Bacteria | 7430 |
| 198 | Ga0105245_10171636 | 3300009098 | Bacteria | 2066 |
| 199 | Ga0105245_10306220 | 3300009098 | Bacteria | 1561 |
| 200 | Ga0105245_10779848 | 3300009098 | Bacteria | 993 |
| 201 | Ga0105245_10864737 | 3300009098 | Bacteria | 945 |
| 202 | Ga0105247_10269257 | 3300009101 | Bacteria | 1171 |
| 203 | Ga0105247_10383658 | 3300009101 | Bacteria | 997 |
| 204 | Ga0105247_10645988 | 3300009101 | Bacteria | 790 |
| 205 | Ga0105247_10916399 | 3300009101 | Bacteria | 678 |
| 206 | Ga0114129_10385042 | 3300009147 | Bacteria | 1851 |
| 207 | Ga0114129_10679304 | 3300009147 | Bacteria | 1326 |
| 208 | Ga0114129_11021087 | 3300009147 | Bacteria | 1040 |
| 209 | Ga0105243_10592473 | 3300009148 | Bacteria | 1066 |
| 210 | Ga0105241_10008085 | 3300009174 | Bacteria | 7738 |
| 211 | Ga0105241_10501419 | 3300009174 | Bacteria | 1082 |
| 212 | Ga0105242_10569302 | 3300009176 | Bacteria | 1089 |
| 213 | Ga0105242_10899249 | 3300009176 | Bacteria | 885 |
| 214 | Ga0105248_10493782 | 3300009177 | Bacteria | 1380 |
| 215 | Ga0105248_10592881 | 3300009177 | Bacteria | 1250 |
| 216 | Ga0105237_10158460 | 3300009545 | Bacteria | 2261 |
| 217 | Ga0105238_10026472 | 3300009551 | Bacteria | 5914 |
| 218 | Ga0105249_10115493 | 3300009553 | Bacteria | 2543 |
| 219 | Ga0105249_10275336 | 3300009553 | Bacteria | 1678 |
| 220 | Ga0105249_12494479 | 3300009553 | Bacteria | 589 |
| 221 | Ga0105239_10417257 | 3300010375 | Bacteria | 1520 |
| 222 | Ga0105239_10870195 | 3300010375 | Bacteria | 1034 |
| 223 | Ga0105239_11816212 | 3300010375 | Bacteria | 706 |
| 224 | Ga0105239_12530365 | 3300010375 | Bacteria | 598 |
| 225 | Ga0105246_10004526 | 3300011119 | Bacteria | 8457 |
| 226 | Ga0105246_10069132 | 3300011119 | Bacteria | 2479 |
| 227 | Ga0105246_10687854 | 3300011119 | Bacteria | 895 |
| 228 | Ga0105246_10771941 | 3300011119 | Bacteria | 850 |
| 229 | Ga0105246_10844507 | 3300011119 | Bacteria | 816 |
| 230 | Ga0105246_11488007 | 3300011119 | Bacteria | 635 |
| 231 | Ga0157320_1004200 | 3300012481 | Bacteria | 909 |
| 232 | Ga0157329_1001096 | 3300012491 | Bacteria | 1295 |
| 233 | Ga0157371_10086727 | 3300013102 | Bacteria | 2217 |
| 234 | Ga0157370_10024014 | 3300013104 | Bacteria | 6045 |
| 235 | Ga0157370_10309511 | 3300013104 | Bacteria | 1458 |
| 236 | Ga0157369_10059476 | 3300013105 | Bacteria | 4120 |
| 237 | Ga0157369_10290741 | 3300013105 | Bacteria | 1701 |
| 238 | Ga0157369_10586110 | 3300013105 | Bacteria | 1152 |
| 239 | Ga0157369_11501494 | 3300013105 | Bacteria | 685 |
| 240 | Ga0157374_10015605 | 3300013296 | Bacteria | 6667 |
| 241 | Ga0157374_10565468 | 3300013296 | Unclassified | 1145 |
| 242 | Ga0157374_11097550 | 3300013296 | Bacteria | 816 |
| 243 | Ga0157378_10727701 | 3300013297 | Bacteria | 1013 |
| 244 | Ga0163162_10704482 | 3300013306 | Bacteria | 1131 |
| 245 | Ga0163162_10800267 | 3300013306 | Bacteria | 1060 |
| 246 | Ga0163162_10814133 | 3300013306 | Bacteria | 1051 |
| 247 | Ga0157372_10993195 | 3300013307 | Bacteria | 972 |
| 248 | Ga0157372_12408752 | 3300013307 | Bacteria | 604 |
| 249 | Ga0157372_12481884 | 3300013307 | Bacteria | 595 |
| 250 | Ga0157375_10138437 | 3300013308 | Bacteria | 2559 |
| 251 | Ga0157375_10262065 | 3300013308 | Bacteria | 1890 |
| 252 | Ga0157375_10291180 | 3300013308 | Bacteria | 1796 |
| 253 | Ga0157375_10402962 | 3300013308 | Bacteria | 1535 |
| 254 | Ga0163163_10277423 | 3300014325 | Bacteria | 1727 |
| 255 | Ga0163163_10362961 | 3300014325 | Bacteria | 1505 |
| 256 | Ga0163163_10486663 | 3300014325 | Bacteria | 1295 |
| 257 | Ga0163163_10541370 | 3300014325 | Bacteria | 1226 |
| 258 | Ga0163163_10561257 | 3300014325 | Bacteria | 1204 |
| 259 | Ga0163163_10961725 | 3300014325 | Bacteria | 917 |
| 260 | Ga0163163_11424862 | 3300014325 | Bacteria | 754 |
| 261 | Ga0157380_10627038 | 3300014326 | Bacteria | 1068 |
| 262 | Ga0157380_10662032 | 3300014326 | Bacteria | 1043 |
| 263 | Ga0182008_10262034 | 3300014497 | Bacteria | 894 |
| 264 | Ga0182008_10988643 | 3300014497 | Bacteria | 501 |
| 265 | Ga0157377_10063184 | 3300014745 | Bacteria | 2120 |
| 266 | Ga0157377_10184400 | 3300014745 | Bacteria | 1315 |
| 267 | Ga0157377_11070178 | 3300014745 | Bacteria | 616 |
| 268 | Ga0157379_10690337 | 3300014968 | Bacteria | 958 |
| 269 | Ga0157379_10696713 | 3300014968 | Bacteria | 953 |
| 270 | Ga0157376_10958946 | 3300014969 | Bacteria | 876 |
| 271 | Ga0157376_11133679 | 3300014969 | Bacteria | 809 |
| 272 | Ga0157376_11436643 | 3300014969 | Bacteria | 722 |
| 273 | Ga0163161_10391681 | 3300017792 | Bacteria | 1112 |
| 274 | Ga0163161_10986533 | 3300017792 | Bacteria | 718 |
| 275 | Ga0197907_10462210 | 3300020069 | Bacteria | 920 |
| 276 | Ga0197907_10610233 | 3300020069 | Bacteria | 1020 |
| 277 | Ga0206354_10888142 | 3300020081 | Bacteria | 660 |
| 278 | Ga0206354_11300942 | 3300020081 | Bacteria | 1133 |
| 279 | Ga0206353_10100621 | 3300020082 | Bacteria | 2382 |
| 280 | Ga0206353_10237056 | 3300020082 | Bacteria | 2163 |
| 281 | Ga0213876_10025335 | 3300021384 | Bacteria | 3130 |
| 282 | Ga0213876_10297070 | 3300021384 | Bacteria | 858 |
| 283 | Ga0213875_10000104 | 3300021388 | Bacteria | 96500 |
| 284 | Ga0213875_10121738 | 3300021388 | Bacteria | 1219 |
| 285 | Ga0224712_10096279 | 3300022467 | Bacteria | 1248 |
| 286 | Ga0224712_10104518 | 3300022467 | Bacteria | 1206 |
| 287 | Ga0224712_10186804 | 3300022467 | Bacteria | 936 |
| 288 | Ga0207656_10025425 | 3300025321 | Bacteria | 2403 |
| 289 | Ga0207692_10001780 | 3300025898 | Bacteria | 8175 |
| 290 | Ga0207692_10040645 | 3300025898 | Bacteria | 2296 |
| 291 | Ga0207692_10091916 | 3300025898 | Bacteria | 1647 |
| 292 | Ga0207692_10271138 | 3300025898 | Bacteria | 1023 |
| 293 | Ga0207692_10740146 | 3300025898 | Bacteria | 640 |
| 294 | Ga0207642_10234247 | 3300025899 | Bacteria | 1033 |
| 295 | Ga0207710_10274048 | 3300025900 | Bacteria | 848 |
| 296 | Ga0207710_10596490 | 3300025900 | Bacteria | 577 |
| 297 | Ga0207688_10013216 | 3300025901 | Bacteria | 4488 |
| 298 | Ga0207680_10290077 | 3300025903 | Bacteria | 1138 |
| 299 | Ga0207680_10292423 | 3300025903 | Bacteria | 1134 |
| 300 | Ga0207647_10057082 | 3300025904 | Bacteria | 2394 |
| 301 | Ga0207685_10008461 | 3300025905 | Bacteria | 2931 |
| 302 | Ga0207685_10077184 | 3300025905 | Bacteria | 1368 |
| 303 | Ga0207699_10017496 | 3300025906 | Bacteria | 3775 |
| 304 | Ga0207699_10039554 | 3300025906 | Bacteria | 2710 |
| 305 | Ga0207699_10252090 | 3300025906 | Bacteria | 1217 |
| 306 | Ga0207699_10373324 | 3300025906 | Bacteria | 1011 |
| 307 | Ga0207645_10303888 | 3300025907 | Bacteria | 1062 |
| 308 | Ga0207643_10000196 | 3300025908 | Bacteria | 41902 |
| 309 | Ga0207643_10128165 | 3300025908 | Bacteria | 1508 |
| 310 | Ga0207643_10370237 | 3300025908 | Bacteria | 902 |
| 311 | Ga0207643_10878524 | 3300025908 | Bacteria | 581 |
| 312 | Ga0207705_10229386 | 3300025909 | Bacteria | 1412 |
| 313 | Ga0207684_10279757 | 3300025910 | Bacteria | 1439 |
| 314 | Ga0207684_10377861 | 3300025910 | Bacteria | 1219 |
| 315 | Ga0207654_10017240 | 3300025911 | Bacteria | 3772 |
| 316 | Ga0207707_10036983 | 3300025912 | Bacteria | 4266 |
| 317 | Ga0207671_10173318 | 3300025914 | Bacteria | 1676 |
| 318 | Ga0207693_10002838 | 3300025915 | Bacteria | 15009 |
| 319 | Ga0207693_10041863 | 3300025915 | Bacteria | 3606 |
| 320 | Ga0207693_10073831 | 3300025915 | Bacteria | 2670 |
| 321 | Ga0207693_10251621 | 3300025915 | Bacteria | 1386 |
| 322 | Ga0207693_10657585 | 3300025915 | Bacteria | 814 |
| 323 | Ga0207693_10981765 | 3300025915 | Bacteria | 645 |
| 324 | Ga0207663_10017879 | 3300025916 | Bacteria | 3960 |
| 325 | Ga0207663_10092844 | 3300025916 | Bacteria | 2007 |
| 326 | Ga0207663_10275867 | 3300025916 | Bacteria | 1247 |
| 327 | Ga0207663_10487931 | 3300025916 | Bacteria | 955 |
| 328 | Ga0207663_10721660 | 3300025916 | Bacteria | 790 |
| 329 | Ga0207660_10741866 | 3300025917 | Bacteria | 801 |
| 330 | Ga0207660_11715109 | 3300025917 | Bacteria | 505 |
| 331 | Ga0207662_10412841 | 3300025918 | Bacteria | 917 |
| 332 | Ga0207662_11333249 | 3300025918 | Bacteria | 510 |
| 333 | Ga0207657_10051547 | 3300025919 | Bacteria | 3577 |
| 334 | Ga0207657_10152361 | 3300025919 | Bacteria | 1882 |
| 335 | Ga0207649_10206430 | 3300025920 | Bacteria | 1391 |
| 336 | Ga0207652_10309723 | 3300025921 | Bacteria | 1425 |
| 337 | Ga0207646_10088665 | 3300025922 | Bacteria | 2768 |
| 338 | Ga0207646_10174644 | 3300025922 | Bacteria | 1940 |
| 339 | Ga0207646_10182493 | 3300025922 | Bacteria | 1895 |
| 340 | Ga0207650_10015635 | 3300025925 | Bacteria | 5289 |
| 341 | Ga0207650_11523366 | 3300025925 | Bacteria | 568 |
| 342 | Ga0207659_10012749 | 3300025926 | Bacteria | 5365 |
| 343 | Ga0207659_10497983 | 3300025926 | Bacteria | 1031 |
| 344 | Ga0207659_10847512 | 3300025926 | Bacteria | 786 |
| 345 | Ga0207659_10992707 | 3300025926 | Bacteria | 722 |
| 346 | Ga0207687_10101756 | 3300025927 | Bacteria | 2115 |
| 347 | Ga0207687_10172821 | 3300025927 | Bacteria | 1668 |
| 348 | Ga0207687_10197693 | 3300025927 | Bacteria | 1569 |
| 349 | Ga0207687_10258370 | 3300025927 | Bacteria | 1388 |
| 350 | Ga0207700_10001069 | 3300025928 | Bacteria | 15781 |
| 351 | Ga0207700_10009263 | 3300025928 | Bacteria | 6142 |
| 352 | Ga0207700_10025003 | 3300025928 | Bacteria | 4141 |
| 353 | Ga0207700_10044839 | 3300025928 | Bacteria | 3258 |
| 354 | Ga0207700_10057544 | 3300025928 | Bacteria | 2932 |
| 355 | Ga0207700_10126999 | 3300025928 | Bacteria | 2076 |
| 356 | Ga0207700_10193962 | 3300025928 | Bacteria | 1708 |
| 357 | Ga0207700_10291651 | 3300025928 | Bacteria | 1406 |
| 358 | Ga0207700_10402204 | 3300025928 | Bacteria | 1200 |
| 359 | Ga0207700_10464388 | 3300025928 | Bacteria | 1117 |
| 360 | Ga0207700_11096223 | 3300025928 | Bacteria | 712 |
| 361 | Ga0207664_10001327 | 3300025929 | Bacteria | 16297 |
| 362 | Ga0207664_10002398 | 3300025929 | Bacteria | 12393 |
| 363 | Ga0207664_10016121 | 3300025929 | Bacteria | 5444 |
| 364 | Ga0207664_10025223 | 3300025929 | Bacteria | 4475 |
| 365 | Ga0207664_10062607 | 3300025929 | Bacteria | 2971 |
| 366 | Ga0207664_10194144 | 3300025929 | Bacteria | 1749 |
| 367 | Ga0207664_10282912 | 3300025929 | Bacteria | 1456 |
| 368 | Ga0207664_10417760 | 3300025929 | Bacteria | 1194 |
| 369 | Ga0207664_10709559 | 3300025929 | Bacteria | 904 |
| 370 | Ga0207644_10013239 | 3300025931 | Bacteria | 5495 |
| 371 | Ga0207690_10374532 | 3300025932 | Bacteria | 1130 |
| 372 | Ga0207706_10171732 | 3300025933 | Bacteria | 1905 |
| 373 | Ga0207706_11151246 | 3300025933 | Bacteria | 646 |
| 374 | Ga0207686_10841877 | 3300025934 | Bacteria | 737 |
| 375 | Ga0207709_10631566 | 3300025935 | Bacteria | 851 |
| 376 | Ga0207670_10082384 | 3300025936 | Bacteria | 2254 |
| 377 | Ga0207670_10096131 | 3300025936 | Bacteria | 2106 |
| 378 | Ga0207669_11936021 | 3300025937 | Bacteria | 504 |
| 379 | Ga0207704_10789613 | 3300025938 | Bacteria | 792 |
| 380 | Ga0207665_10004471 | 3300025939 | Bacteria | 9286 |
| 381 | Ga0207665_10005230 | 3300025939 | Bacteria | 8667 |
| 382 | Ga0207665_10352660 | 3300025939 | Bacteria | 1111 |
| 383 | Ga0207691_10154496 | 3300025940 | Bacteria | 2016 |
| 384 | Ga0207691_10677181 | 3300025940 | Bacteria | 870 |
| 385 | Ga0207711_10697514 | 3300025941 | Bacteria | 947 |
| 386 | Ga0207689_10001658 | 3300025942 | Bacteria | 21104 |
| 387 | Ga0207689_10511008 | 3300025942 | Bacteria | 1007 |
| 388 | Ga0207689_10666031 | 3300025942 | Bacteria | 877 |
| 389 | Ga0207689_11676632 | 3300025942 | Bacteria | 527 |
| 390 | Ga0207661_10019838 | 3300025944 | Bacteria | 5016 |
| 391 | Ga0207661_10328861 | 3300025944 | Bacteria | 1375 |
| 392 | Ga0207661_10376657 | 3300025944 | Bacteria | 1284 |
| 393 | Ga0207661_10882785 | 3300025944 | Bacteria | 823 |
| 394 | Ga0207661_10992529 | 3300025944 | Bacteria | 773 |
| 395 | Ga0207661_11514822 | 3300025944 | Bacteria | 614 |
| 396 | Ga0207679_10004949 | 3300025945 | Bacteria | 8311 |
| 397 | Ga0207679_10293152 | 3300025945 | Bacteria | 1399 |
| 398 | Ga0207679_10533408 | 3300025945 | Bacteria | 1051 |
| 399 | Ga0207679_11156040 | 3300025945 | Bacteria | 710 |
| 400 | Ga0207667_10302014 | 3300025949 | Bacteria | 1636 |
| 401 | Ga0207667_10458925 | 3300025949 | Bacteria | 1294 |
| 402 | Ga0207651_10490902 | 3300025960 | Bacteria | 1060 |
| 403 | Ga0207712_10147227 | 3300025961 | Bacteria | 1815 |
| 404 | Ga0207712_11431061 | 3300025961 | Bacteria | 619 |
| 405 | Ga0207668_11835155 | 3300025972 | Bacteria | 547 |
| 406 | Ga0207640_10164234 | 3300025981 | Bacteria | 1647 |
| 407 | Ga0207658_10160943 | 3300025986 | Bacteria | 1840 |
| 408 | Ga0207677_10119703 | 3300026023 | Bacteria | 1978 |
| 409 | Ga0207677_10144765 | 3300026023 | Bacteria | 1825 |
| 410 | Ga0207677_10209905 | 3300026023 | Bacteria | 1554 |
| 411 | Ga0207677_10327913 | 3300026023 | Bacteria | 1275 |
| 412 | Ga0207677_10412372 | 3300026023 | Bacteria | 1148 |
| 413 | Ga0207677_11586313 | 3300026023 | Bacteria | 606 |
| 414 | Ga0207703_10105533 | 3300026035 | Bacteria | 2395 |
| 415 | Ga0207703_10458548 | 3300026035 | Bacteria | 1192 |
| 416 | Ga0207639_11619761 | 3300026041 | Bacteria | 607 |
| 417 | Ga0207678_10000794 | 3300026067 | Bacteria | 28950 |
| 418 | Ga0207678_10104558 | 3300026067 | Bacteria | 2416 |
| 419 | Ga0207678_11438847 | 3300026067 | Bacteria | 609 |
| 420 | Ga0207708_10012630 | 3300026075 | Bacteria | 6299 |
| 421 | Ga0207702_10020495 | 3300026078 | Bacteria | 5474 |
| 422 | Ga0207702_10022811 | 3300026078 | Bacteria | 5192 |
| 423 | Ga0207702_11046008 | 3300026078 | Bacteria | 810 |
| 424 | Ga0207641_10178236 | 3300026088 | Bacteria | 1945 |
| 425 | Ga0207641_10264833 | 3300026088 | Bacteria | 1611 |
| 426 | Ga0207641_10511129 | 3300026088 | Bacteria | 1167 |
| 427 | Ga0207641_10893079 | 3300026088 | Bacteria | 882 |
| 428 | Ga0207676_10000651 | 3300026095 | Bacteria | 27828 |
| 429 | Ga0207676_10379543 | 3300026095 | Bacteria | 1315 |
| 430 | Ga0207676_10481057 | 3300026095 | Bacteria | 1176 |
| 431 | Ga0207676_10622093 | 3300026095 | Bacteria | 1039 |
| 432 | Ga0207676_10938944 | 3300026095 | Bacteria | 850 |
| 433 | Ga0207676_11211410 | 3300026095 | Bacteria | 748 |
| 434 | Ga0207683_10010407 | 3300026121 | Bacteria | 7933 |
| 435 | Ga0207683_10029666 | 3300026121 | Bacteria | 4737 |
| 436 | Ga0207683_10224995 | 3300026121 | Bacteria | 1710 |
| 437 | Ga0207683_10321318 | 3300026121 | Bacteria | 1418 |
| 438 | Ga0207683_10496904 | 3300026121 | Bacteria | 1126 |
| 439 | Ga0207698_10009693 | 3300026142 | Bacteria | 6150 |
| 440 | Ga0207698_10617004 | 3300026142 | Bacteria | 1071 |
| 441 | Ga0209588_1229230 | 3300027671 | Bacteria | 572 |
| 442 | Ga0207428_10037356 | 3300027907 | Bacteria | 3951 |
| 443 | Ga0268266_10094489 | 3300028379 | Bacteria | 2624 |
| 444 | Ga0268266_10430738 | 3300028379 | Bacteria | 1251 |
| 445 | Ga0268266_10436691 | 3300028379 | Bacteria | 1243 |
| 446 | Ga0268266_10561420 | 3300028379 | Bacteria | 1094 |
| 447 | Ga0268265_10629585 | 3300028380 | Bacteria | 1029 |
| 448 | Ga0268264_10056594 | 3300028381 | Bacteria | 3278 |
| 449 | Ga0268264_11088194 | 3300028381 | Bacteria | 808 |
| 450 | Ga0265337_1000395 | 3300028556 | Bacteria | 23441 |
| 451 | Ga0265326_10008675 | 3300028558 | Bacteria | 3057 |
| 452 | Ga0265319_1003518 | 3300028563 | Bacteria | 8135 |
| 453 | Ga0265334_10000389 | 3300028573 | Bacteria | 23222 |
| 454 | Ga0265318_10012538 | 3300028577 | Bacteria | 3604 |
| 455 | Ga0265323_10015922 | 3300028653 | Bacteria | 2946 |
| 456 | Ga0265322_10012148 | 3300028654 | Bacteria | 2490 |
| 457 | Ga0265338_10000375 | 3300028800 | Bacteria | 79976 |
| 458 | Ga0265338_10000911 | 3300028800 | Bacteria | 49821 |
| 459 | Ga0265324_10008124 | 3300029957 | Bacteria | 4195 |
| 460 | Ga0265332_10010288 | 3300031238 | Bacteria | 4164 |
| 461 | Ga0265320_10001205 | 3300031240 | Bacteria | 19014 |
| 462 | Ga0265325_10018874 | 3300031241 | Bacteria | 3821 |
| 463 | Ga0265329_10097639 | 3300031242 | Bacteria | 934 |
| 464 | Ga0265340_10003267 | 3300031247 | Bacteria | 9198 |
| 465 | Ga0265339_10025516 | 3300031249 | Bacteria | 3392 |
| 466 | Ga0265316_10072731 | 3300031344 | Bacteria | 2648 |
| 467 | Ga0307408_100341465 | 3300031548 | Bacteria | 1267 |
| 468 | Ga0265313_10023978 | 3300031595 | Bacteria | 3272 |
| 469 | Ga0265314_10013101 | 3300031711 | Bacteria | 6718 |
| 470 | Ga0265342_10001780 | 3300031712 | Bacteria | 19620 |
| 471 | Ga0307406_10345601 | 3300031901 | Bacteria | 1160 |
| 472 | Ga0307415_101704642 | 3300032126 | Bacteria | 608 |
| 473 | Ga0373930_0073705 | 3300034816 | Bacteria | 780 |
| 474 | Ga0373926_0003730 | 3300035083 | Bacteria | 4958 |
| 475 | Ga0373928_0019732 | 3300035084 | Bacteria | 1409 |
| 476 | Ga0373934_0000161 | 3300035086 | Bacteria | 24391 |
| 477 | Ga0373934_0135914 | 3300035086 | Bacteria | 1004 |
| 478 | Ga0373944_0005260 | 3300035089 | Bacteria | 3403 |
| 479 | Ga0373952_0024052 | 3300035092 | Bacteria | 1305 |
| 480 | Ga0373923_0017856 | 3300035111 | Bacteria | 2720 |
| 481 | Ga0373932_0245935 | 3300035112 | Bacteria | 651 |
| 482 | Ga0373936_0000206 | 3300035113 | Bacteria | 19595 |
| 483 | Ga0373936_0008494 | 3300035113 | Bacteria | 3868 |
| 484 | Ga0373936_0431587 | 3300035113 | Bacteria | 607 |
| 485 | Ga0373941_0426801 | 3300035115 | Bacteria | 553 |
| 486 | Ga0373945_0001919 | 3300035116 | Bacteria | 6451 |
| 487 | Ga0373953_0000035 | 3300035117 | Bacteria | 35807 |
| 488 | Ga0373954_0006506 | 3300035118 | Bacteria | 5093 |
| 489 | Ga0373954_0201926 | 3300035118 | Bacteria | 977 |
| 490 | Ga0373956_0000318 | 3300035119 | Bacteria | 19456 |
| 491 | Ga0373956_0007792 | 3300035119 | Bacteria | 4321 |
| 492 | Ga0373957_0000039 | 3300035120 | Bacteria | 34100 |
| 493 | Ga0373943_0001364 | 3300035170 | Bacteria | 11010 |
| 494 | Ga0373943_0026256 | 3300035170 | Bacteria | 2728 |
| 495 | Ga0373943_0103898 | 3300035170 | Bacteria | 1490 |
| 496 | Ga0373946_0000123 | 3300035171 | Bacteria | 22784 |
| 497 | Ga0373946_0083161 | 3300035171 | Bacteria | 1405 |
| 498 | Ga0373955_0000124 | 3300035172 | Bacteria | 30735 |
| 499 | Ga0373955_0072561 | 3300035172 | Bacteria | 1928 |
| 500 | Ga0373955_0187489 | 3300035172 | Bacteria | 1229 |
| 501 | Ga0373942_0020587 | 3300035207 | Bacteria | 1658 |
| 502 | Ga0373924_0000479 | 3300035410 | Bacteria | 12217 |
| 503 | Ga0373924_0035869 | 3300035410 | Bacteria | 2012 |
| 504 | Ga0373931_0069736 | 3300035691 | Bacteria | 1916 |
| 505 | Ga0373931_0502728 | 3300035691 | Bacteria | 782 |
| 506 | Ga0373931_0845081 | 3300035691 | Bacteria | 612 |
| 507 | Ga0373935_0005609 | 3300035692 | Bacteria | 7402 |
| 508 | Ga0373935_0128916 | 3300035692 | Bacteria | 1698 |
| 509 | Ga0373935_0168854 | 3300035692 | Bacteria | 1495 |
| 510 | Ga0373935_0433572 | 3300035692 | Bacteria | 947 |
| 511 | Ga0373935_0584807 | 3300035692 | Bacteria | 816 |
| 512 | Ga0373927_0001451 | 3300035695 | Bacteria | 17876 |
| 513 | Ga0373927_0064620 | 3300035695 | Bacteria | 2367 |
| 514 | Ga0373927_0626322 | 3300035695 | Bacteria | 711 |
| 515 | Ga0373933_0000069 | 3300035724 | Bacteria | 62983 |
| 516 | Ga0373933_0023254 | 3300035724 | Bacteria | 3538 |
| 517 | Ga0373947_0000510 | 3300035725 | Bacteria | 22565 |
| 518 | Ga0373947_0871213 | 3300035725 | Bacteria | 615 |
| 519 | Ga0373947_1160396 | 3300035725 | Bacteria | 526 |
| 520 | Ga0373937_0000168 | 3300036401 | Bacteria | 63667 |
| 521 | Ga0373937_0046204 | 3300036401 | Bacteria | 3981 |
| 522 | Ga0373937_0324361 | 3300036401 | Bacteria | 1457 |
| 523 | Ga0373937_1798970 | 3300036401 | Bacteria | 559 |
| 524 | Ga0373925_0000879 | 3300037068 | Bacteria | 27479 |
| 525 | Ga0373925_0002965 | 3300037068 | Bacteria | 13400 |
| 526 | Ga0395898_0845471 | 3300037466 | Bacteria | 854 |
| 527 | Ga0436364_0153646 | 3300037853 | Bacteria | 589 |
| 528 | Ga0436364_0493666 | 3300037853 | Bacteria | 3729 |
| 529 | Ga0436364_0731702 | 3300037853 | Bacteria | 1052 |
| 530 | Ga0436364_1079797 | 3300037853 | Bacteria | 1932 |
| 531 | Ga0436364_1302603 | 3300037853 | Bacteria | 592 |
| 532 | Ga0436364_1340274 | 3300037853 | Bacteria | 7133 |
| 533 | Ga0436364_1497153 | 3300037853 | Bacteria | 67687 |
| 534 | Ga0436365_0274842 | 3300039437 | Bacteria | 818 |
| 535 | Ga0436365_0985376 | 3300039437 | Bacteria | 1253 |
| 536 | Ga0436365_1026192 | 3300039437 | Bacteria | 608 |
| 537 | Ga0436365_1268655 | 3300039437 | Bacteria | 26104 |
| 538 | Ga0436365_1803159 | 3300039437 | Bacteria | 5030 |
| 539 | Ga0436365_1931865 | 3300039437 | Bacteria | 6692 |
| 540 | Ga0436361_1006166 | 3300039447 | Bacteria | 638 |
| 541 | Ga0436363_0660717 | 3300039450 | Bacteria | 606 |
| 542 | Ga0436363_0682306 | 3300039450 | Bacteria | 851 |
| 543 | Ga0436362_0768964 | 3300039453 | Bacteria | 671 |
| 544 | Ga0451851_1363798 | 3300041507 | Bacteria | 523 |
| 545 | Ga0439455_0221766 | 3300042012 | Bacteria | 550 |
| 546 | Ga0439463_025845 | 3300042016 | Bacteria | 1474 |
| 547 | Ga0439463_104456 | 3300042016 | Bacteria | 731 |
| 548 | Ga0439458_0049023 | 3300042157 | Bacteria | 1039 |
| 549 | Ga0439459_0002078 | 3300042438 | Bacteria | 3053 |
| 550 | Ga0466972_0125251 | 3300044658 | Bacteria | 1211 |
| 551 | Ga0466972_0179580 | 3300044658 | Bacteria | 993 |
| 552 | Ga0466966_0085686 | 3300044684 | Bacteria | 1959 |
| 553 | Ga0466966_0284844 | 3300044684 | Bacteria | 994 |
| 554 | Ga0466961_0002925 | 3300044693 | Bacteria | 10609 |
| 555 | Ga0466961_0164307 | 3300044693 | Bacteria | 1383 |
| 556 | Ga0466963_0135203 | 3300044694 | Bacteria | 1705 |
| 557 | Ga0466963_0871806 | 3300044694 | Bacteria | 635 |
| 558 | Ga0466971_0091915 | 3300044719 | Bacteria | 1390 |
| 559 | Ga0466971_0157557 | 3300044719 | Bacteria | 1062 |
| 560 | Ga0466971_0207219 | 3300044719 | Bacteria | 927 |
| 561 | Ga0466971_0653254 | 3300044719 | Bacteria | 527 |
| 562 | Ga0466970_0270861 | 3300044765 | Bacteria | 954 |
| 563 | Ga0466957_0283700 | 3300044842 | Bacteria | 1109 |
| 564 | Ga0466957_0309464 | 3300044842 | Bacteria | 1063 |
| 565 | Ga0466957_1288038 | 3300044842 | Bacteria | 530 |
| 566 | Ga0466960_0026340 | 3300044901 | Bacteria | 2641 |
| 567 | Ga0466959_0071971 | 3300045049 | Bacteria | 2503 |
| 568 | Ga0466959_0534964 | 3300045049 | Bacteria | 791 |
| 569 | Ga0466958_0060893 | 3300045836 | Bacteria | 2298 |
| 570 | Ga0466967_0256960 | 3300045976 | Bacteria | 1670 |
| 571 | Ga0466967_0473759 | 3300045976 | Bacteria | 1226 |
| 572 | Ga0466967_0744873 | 3300045976 | Bacteria | 972 |
| 573 | Ga0495592_0000144 | 3300046454 | Bacteria | 62983 |
| 574 | Ga0495603_0238032 | 3300046455 | Bacteria | 1049 |
| 575 | Ga0495603_0515673 | 3300046455 | Bacteria | 685 |
| 576 | Ga0495629_0016555 | 3300046459 | Bacteria | 5292 |
| 577 | Ga0495629_0122290 | 3300046459 | Bacteria | 1813 |
| 578 | Ga0495651_0000100 | 3300046462 | Bacteria | 62983 |
| 579 | Ga0495651_0012138 | 3300046462 | Bacteria | 6631 |
| 580 | Ga0495653_0000436 | 3300046463 | Bacteria | 32860 |
| 581 | Ga0495653_0019577 | 3300046463 | Bacteria | 5488 |
| 582 | Ga0495653_0043967 | 3300046463 | Bacteria | 3469 |
| 583 | Ga0495653_0748320 | 3300046463 | Bacteria | 591 |
| 584 | Ga0495580_0068952 | 3300046472 | Bacteria | 2472 |
| 585 | Ga0495639_0042213 | 3300046475 | Bacteria | 2056 |
| 586 | Ga0495662_0008779 | 3300046476 | Bacteria | 4971 |
| 587 | Ga0495664_0001416 | 3300046477 | Bacteria | 12712 |
| 588 | Ga0495664_0070271 | 3300046477 | Bacteria | 2091 |
| 589 | Ga0495664_0244205 | 3300046477 | Bacteria | 1086 |
| 590 | Ga0495608_0000093 | 3300046511 | Bacteria | 64243 |
| 591 | Ga0495608_0009607 | 3300046511 | Bacteria | 6752 |
| 592 | Ga0495608_0217297 | 3300046511 | Bacteria | 1200 |
| 593 | Ga0495618_0038322 | 3300046514 | Bacteria | 3012 |
| 594 | Ga0495628_0000308 | 3300046516 | Bacteria | 43976 |
| 595 | Ga0495628_0068577 | 3300046516 | Bacteria | 2767 |
| 596 | Ga0495628_0725202 | 3300046516 | Bacteria | 700 |
| 597 | Ga0495630_0001678 | 3300046517 | Bacteria | 15421 |
| 598 | Ga0495630_0028951 | 3300046517 | Bacteria | 4116 |
| 599 | Ga0495630_0176284 | 3300046517 | Bacteria | 1629 |
| 600 | Ga0495630_0262702 | 3300046517 | Bacteria | 1319 |
| 601 | Ga0495644_0163044 | 3300046523 | Bacteria | 855 |
| 602 | Ga0495666_0466604 | 3300046526 | Bacteria | 565 |
| 603 | Ga0495652_0000126 | 3300046529 | Bacteria | 84302 |
| 604 | Ga0495652_0014642 | 3300046529 | Bacteria | 7032 |
| 605 | Ga0495652_0092705 | 3300046529 | Bacteria | 2467 |
| 606 | Ga0495652_0169601 | 3300046529 | Bacteria | 1686 |
| 607 | Ga0495665_0027230 | 3300046531 | Bacteria | 3069 |
| 608 | Ga0495665_0076751 | 3300046531 | Bacteria | 1758 |
| 609 | Ga0495640_0155963 | 3300046533 | Bacteria | 1465 |
| 610 | Ga0495586_0465864 | 3300046535 | Bacteria | 729 |
| 611 | Ga0495587_0000104 | 3300046536 | Bacteria | 63667 |
| 612 | Ga0495587_0017950 | 3300046536 | Bacteria | 4387 |
| 613 | Ga0495645_0111347 | 3300046543 | Bacteria | 1936 |
| 614 | Ga0495645_0321713 | 3300046543 | Bacteria | 1004 |
| 615 | Ga0495667_0000097 | 3300046559 | Bacteria | 62983 |
| 616 | Ga0495667_0002066 | 3300046559 | Bacteria | 13331 |
| 617 | Ga0495634_0047852 | 3300046642 | Bacteria | 2880 |
| 618 | Ga0495634_0150733 | 3300046642 | Bacteria | 1471 |
| 619 | Ga0495635_0002813 | 3300046663 | Bacteria | 11939 |
| 620 | Ga0495588_0187321 | 3300046674 | Bacteria | 1093 |
| 621 | Ga0495657_0000325 | 3300046675 | Bacteria | 43650 |
| 622 | Ga0495657_0016729 | 3300046675 | Bacteria | 5336 |
| 623 | Ga0495657_0022596 | 3300046675 | Bacteria | 4502 |
| 624 | Ga0495599_0000214 | 3300046678 | Bacteria | 37089 |
| 625 | Ga0495599_0007609 | 3300046678 | Bacteria | 6578 |
| 626 | Ga0495599_0166504 | 3300046678 | Bacteria | 1361 |
| 627 | Ga0495599_0310325 | 3300046678 | Bacteria | 951 |
| 628 | Ga0495623_0000090 | 3300046679 | Bacteria | 53800 |
| 629 | Ga0495646_0032866 | 3300046680 | Bacteria | 3226 |
| 630 | Ga0495646_0266648 | 3300046680 | Bacteria | 913 |
| 631 | Ga0495647_0144672 | 3300046681 | Bacteria | 1016 |
| 632 | Ga0495647_0156642 | 3300046681 | Bacteria | 979 |
| 633 | Ga0495658_0700943 | 3300046683 | Bacteria | 648 |
| 634 | Ga0495613_0532616 | 3300046689 | Bacteria | 788 |
| 635 | Ga0495624_0072175 | 3300046690 | Bacteria | 2148 |
| 636 | Ga0495624_0327526 | 3300046690 | Bacteria | 922 |
| 637 | Ga0495649_0248720 | 3300046694 | Bacteria | 914 |
| 638 | Ga0495600_0010254 | 3300046809 | Bacteria | 5809 |
| 639 | Ga0495600_0106319 | 3300046809 | Bacteria | 1828 |
| 640 | Ga0495581_0020561 | 3300047315 | Bacteria | 3830 |
| 641 | Ga0495581_0025904 | 3300047315 | Bacteria | 3401 |
| 642 | Ga0495581_0193518 | 3300047315 | Bacteria | 1190 |
| 643 | Ga0495604_0000135 | 3300047317 | Bacteria | 62983 |
| 644 | Ga0495604_0026803 | 3300047317 | Bacteria | 4586 |
| 645 | Ga0495674_0002794 | 3300047319 | Bacteria | 16941 |
| 646 | Ga0495672_0353707 | 3300047320 | Bacteria | 682 |
| 647 | Ga0495676_0007451 | 3300047321 | Bacteria | 10039 |
| 648 | Ga0495676_0243463 | 3300047321 | Bacteria | 1230 |
| 649 | Ga0495680_0000156 | 3300047322 | Bacteria | 69379 |
| 650 | Ga0495680_0015795 | 3300047322 | Bacteria | 6499 |
| 651 | Ga0495680_0030252 | 3300047322 | Bacteria | 4423 |
| 652 | Ga0495675_0000102 | 3300047444 | Bacteria | 61796 |
| 653 | Ga0495675_0039238 | 3300047444 | Bacteria | 3016 |
| 654 | Ga0495684_0006613 | 3300047471 | Bacteria | 8991 |
| 655 | Ga0495684_0137566 | 3300047471 | Bacteria | 1832 |
| 656 | Ga0495684_0633855 | 3300047471 | Bacteria | 717 |
| 657 | Ga0495593_0159897 | 3300047673 | Bacteria | 1137 |
| 658 | Ga0495602_0005662 | 3300048088 | Bacteria | 13101 |
| 659 | Ga0495602_0010831 | 3300048088 | Bacteria | 9450 |
| 660 | Ga0495614_0086249 | 3300048089 | Bacteria | 1363 |
| 661 | Ga0496100_0111409 | 3300048903 | Bacteria | 1902 |
| 662 | Ga0496100_0366552 | 3300048903 | Bacteria | 1091 |
| 663 | Ga0496101_0197182 | 3300048904 | Bacteria | 1555 |
| 664 | Ga0496101_0225368 | 3300048904 | Bacteria | 1456 |
| 665 | Ga0496101_0348623 | 3300048904 | Bacteria | 1163 |
| 666 | Ga0496101_1029557 | 3300048904 | Bacteria | 647 |
| 667 | Ga0496101_1119315 | 3300048904 | Bacteria | 618 |
| 668 | Ga0496101_1576247 | 3300048904 | Bacteria | 510 |
| 669 | Ga0496102_0111722 | 3300048905 | Bacteria | 2548 |
| 670 | Ga0496102_0249595 | 3300048905 | Unclassified | 1673 |
| 671 | Ga0496102_0381263 | 3300048905 | Bacteria | 1327 |
| 672 | Ga0496103_0370228 | 3300048906 | Bacteria | 921 |
| 673 | Ga0496104_0005163 | 3300048907 | Bacteria | 11409 |
| 674 | Ga0496104_0030892 | 3300048907 | Bacteria | 4980 |
| 675 | Ga0496104_0033506 | 3300048907 | Bacteria | 4786 |
| 676 | Ga0496104_0181582 | 3300048907 | Unclassified | 2014 |
| 677 | Ga0496104_0264162 | 3300048907 | Bacteria | 1633 |
| 678 | Ga0496104_1562008 | 3300048907 | Bacteria | 563 |
| 679 | Ga0496105_0004718 | 3300048908 | Bacteria | 10285 |
| 680 | Ga0496105_0012672 | 3300048908 | Bacteria | 6679 |
| 681 | Ga0496105_0021444 | 3300048908 | Bacteria | 5227 |
| 682 | Ga0496105_1099946 | 3300048908 | Bacteria | 590 |
| 683 | Ga0496106_0029465 | 3300048909 | Bacteria | 4091 |
| 684 | Ga0496106_0086654 | 3300048909 | Bacteria | 2412 |
| 685 | Ga0496106_0309783 | 3300048909 | Bacteria | 1267 |
| 686 | Ga0496106_0611718 | 3300048909 | Bacteria | 872 |
| 687 | Ga0496106_1044624 | 3300048909 | Bacteria | 641 |
| 688 | Ga0496107_0171160 | 3300048910 | Bacteria | 1612 |
| 689 | Ga0496107_0611012 | 3300048910 | Bacteria | 805 |
| 690 | Ga0496108_0004974 | 3300048911 | Bacteria | 10742 |
| 691 | Ga0496108_0085639 | 3300048911 | Bacteria | 2675 |
| 692 | Ga0496108_0136338 | 3300048911 | Bacteria | 2112 |
| 693 | Ga0496108_0166408 | 3300048911 | Bacteria | 1906 |
| 694 | Ga0496108_0190165 | 3300048911 | Bacteria | 1779 |
| 695 | Ga0496108_0191970 | 3300048911 | Bacteria | 1770 |
| 696 | Ga0496108_0219703 | 3300048911 | Bacteria | 1651 |
| 697 | Ga0496108_0293786 | 3300048911 | Bacteria | 1415 |
| 698 | Ga0496108_0297186 | 3300048911 | Bacteria | 1406 |
| 699 | Ga0496108_0475101 | 3300048911 | Bacteria | 1092 |
| 700 | Ga0496109_0010814 | 3300048912 | Bacteria | 7813 |
| 701 | Ga0496109_0044183 | 3300048912 | Bacteria | 4041 |
| 702 | Ga0496109_0057455 | 3300048912 | Bacteria | 3552 |
| 703 | Ga0496109_0077768 | 3300048912 | Bacteria | 3053 |
| 704 | Ga0496109_0138011 | 3300048912 | Bacteria | 2279 |
| 705 | Ga0496109_0295637 | 3300048912 | Bacteria | 1527 |
| 706 | Ga0496109_0727120 | 3300048912 | Bacteria | 930 |
| 707 | Ga0496109_1063842 | 3300048912 | Bacteria | 746 |
| 708 | Ga0496109_1254922 | 3300048912 | Bacteria | 677 |
| 709 | Ga0496110_0095540 | 3300048913 | Bacteria | 2662 |
| 710 | Ga0496110_0097105 | 3300048913 | Bacteria | 2640 |
| 711 | Ga0496110_0124840 | 3300048913 | Bacteria | 2322 |
| 712 | Ga0496110_0293254 | 3300048913 | Bacteria | 1481 |
| 713 | Ga0496110_0397510 | 3300048913 | Bacteria | 1256 |
| 714 | Ga0496110_1005325 | 3300048913 | Bacteria | 741 |
| 715 | Ga0496111_0024913 | 3300048914 | Bacteria | 4220 |
| 716 | Ga0496111_0170329 | 3300048914 | Bacteria | 1618 |
| 717 | Ga0496111_0238732 | 3300048914 | Bacteria | 1350 |
| 718 | Ga0496111_0266597 | 3300048914 | Bacteria | 1270 |
| 719 | Ga0496111_0755443 | 3300048914 | Bacteria | 705 |
| 720 | Ga0496111_0807125 | 3300048914 | Bacteria | 679 |
| 721 | Ga0496112_0059896 | 3300048915 | Bacteria | 3751 |
| 722 | Ga0496112_0150354 | 3300048915 | Bacteria | 2296 |
| 723 | Ga0496112_0223500 | 3300048915 | Bacteria | 1838 |
| 724 | Ga0496112_0330872 | 3300048915 | Bacteria | 1467 |
| 725 | Ga0496112_0345562 | 3300048915 | Bacteria | 1431 |
| 726 | Ga0496112_1327847 | 3300048915 | Bacteria | 634 |
| 727 | Ga0496113_0004041 | 3300048916 | Bacteria | 8932 |
| 728 | Ga0496113_0029533 | 3300048916 | Bacteria | 3961 |
| 729 | Ga0496113_0045489 | 3300048916 | Bacteria | 3256 |
| 730 | Ga0496113_0052594 | 3300048916 | Bacteria | 3043 |
| 731 | Ga0496113_0098468 | 3300048916 | Bacteria | 2263 |
| 732 | Ga0496113_0436223 | 3300048916 | Bacteria | 1052 |
| 733 | Ga0496113_0893121 | 3300048916 | Bacteria | 703 |
| 734 | Ga0496113_1418373 | 3300048916 | Bacteria | 538 |
| 735 | Ga0496114_0013670 | 3300048917 | Bacteria | 6508 |
| 736 | Ga0496114_0031385 | 3300048917 | Bacteria | 4373 |
| 737 | Ga0496114_0370529 | 3300048917 | Bacteria | 1267 |
| 738 | Ga0496114_0521928 | 3300048917 | Bacteria | 1050 |
| 739 | Ga0496114_0573201 | 3300048917 | Bacteria | 996 |
| 740 | Ga0496114_1224364 | 3300048917 | Bacteria | 637 |
| 741 | Ga0496114_1262293 | 3300048917 | Bacteria | 625 |
| 742 | Ga0496115_0022786 | 3300048918 | Bacteria | 4856 |
| 743 | Ga0496115_0034857 | 3300048918 | Bacteria | 3978 |
| 744 | Ga0496115_0233440 | 3300048918 | Bacteria | 1516 |
| 745 | Ga0496126_0024577 | 3300048929 | Bacteria | 5813 |
| 746 | nmdc:mga06z11_674686_c1 | 3300050494 | Bacteria | 629 |
| 747 | nmdc:mga05p37_839899_c1 | 3300050507 | Bacteria | 999 |
| 748 | nmdc:mga05p37_945656_c1 | 3300050507 | Bacteria | 923 |
| 749 | nmdc:mga09592_626685_c1 | 3300050508 | Bacteria | 920 |
| 750 | nmdc:mga06r32_792933_c1 | 3300050510 | Bacteria | 908 |
| 751 | nmdc:mga08y16_168979_c1 | 3300050511 | Bacteria | 2272 |
| 752 | nmdc:mga08y16_60466_c1 | 3300050511 | Bacteria | 3956 |
| 753 | nmdc:mga0n895_10213_c1 | 3300050512 | Bacteria | 8271 |
| 754 | nmdc:mga0n895_2164801_c1 | 3300050512 | Bacteria | 512 |
| 755 | nmdc:mga0n895_2169_c1 | 3300050512 | Bacteria | 15180 |
| 756 | nmdc:mga0rr50_1868136_c1 | 3300050513 | Bacteria | 505 |
| 757 | nmdc:mga0rr50_220574_c1 | 3300050513 | Bacteria | 1566 |
| 758 | nmdc:mga0rr50_2398_c1 | 3300050513 | Bacteria | 10546 |
| 759 | nmdc:mga0rr50_865846_c1 | 3300050513 | Bacteria | 770 |
| 760 | nmdc:mga08x19_16151_c1 | 3300050514 | Bacteria | 4549 |
| 761 | nmdc:mga08x19_648448_c1 | 3300050514 | Bacteria | 749 |
| 762 | nmdc:mga0a205_39305_c1 | 3300050515 | Bacteria | 4554 |
| 763 | Ga0495601_0035979 | 3300053077 | Bacteria | 3091 |
| 764 | Ga0495612_0112953 | 3300053078 | Bacteria | 1164 |
| 765 | Ga0495595_0001660 | 3300053084 | Bacteria | 8704 |
| 766 | Ga0495619_0022864 | 3300053085 | Bacteria | 4003 |
| 767 | Ga0495619_0576728 | 3300053085 | Bacteria | 771 |
| 768 | Ga0500559_0336106 | 3300053136 | Bacteria | 707 |
| 769 | Ga0590075_002138 | 3300059424 | Bacteria | 4751 |
| 770 | Ga0590077_004008 | 3300059426 | Bacteria | 3035 |
| 771 | Ga0501082_1616419 | 3300060353 | Bacteria | 566 |
| 772 | Ga0466962_0114843 | 3300061719 | Bacteria | 1297 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1000395 | Ga0265337_100039523 | 96 |
| 2 | 3300028558 | Ga0265326_10008675 | Ga0265326_100086753 | 96 |
| 3 | 3300028563 | Ga0265319_1003518 | Ga0265319_10035188 | 96 |
| 4 | 3300028573 | Ga0265334_10000389 | Ga0265334_100003893 | 96 |
| 5 | 3300028577 | Ga0265318_10012538 | Ga0265318_100125383 | 96 |
| 6 | 3300028653 | Ga0265323_10015922 | Ga0265323_100159222 | 96 |
| 7 | 3300028800 | Ga0265338_10000375 | Ga0265338_1000037536 | 96 |
| 8 | 3300029957 | Ga0265324_10008124 | Ga0265324_100081242 | 96 |
| 9 | 3300031238 | Ga0265332_10010288 | Ga0265332_100102882 | 96 |
| 10 | 3300031240 | Ga0265320_10001205 | Ga0265320_1000120520 | 96 |
| 11 | 3300031241 | Ga0265325_10018874 | Ga0265325_100188744 | 96 |
| 12 | 3300031242 | Ga0265329_10097639 | Ga0265329_100976392 | 96 |
| 13 | 3300031247 | Ga0265340_10003267 | Ga0265340_100032679 | 96 |
| 14 | 3300031249 | Ga0265339_10025516 | Ga0265339_100255163 | 96 |
| 15 | 3300031344 | Ga0265316_10072731 | Ga0265316_100727312 | 96 |
| 16 | 3300031595 | Ga0265313_10023978 | Ga0265313_100239782 | 96 |
| 17 | 3300031711 | Ga0265314_10013101 | Ga0265314_100131016 | 96 |
| 18 | 3300031712 | Ga0265342_10001780 | Ga0265342_100017808 | 96 |
| 19 | 3300031548 | Ga0307408_100341465 | Ga0307408_1003414652 | 104 |
| 20 | 3300031901 | Ga0307406_10345601 | Ga0307406_103456012 | 104 |
| 21 | iso_pu_bacteria | 2791354901 | 2791915934 | 107 |
| 22 | 3300005436 | Ga0070713_101002666 | Ga0070713_1010026662 | 108 |
| 23 | 3300005983 | Ga0081540_1018759 | Ga0081540_10187594 | 108 |
| 24 | 3300006178 | Ga0075367_10798380 | Ga0075367_107983802 | 108 |
| 25 | 3300006846 | Ga0075430_101391243 | Ga0075430_1013912432 | 108 |
| 26 | 3300035170 | Ga0373943_0103898 | Ga0373943_0103898_839_1192 | 108 |
| 27 | 3300035692 | Ga0373935_0128916 | Ga0373935_0128916_210_563 | 108 |
| 28 | 3300035695 | Ga0373927_0626322 | Ga0373927_0626322_159_512 | 108 |
| 29 | 3300047315 | Ga0495581_0193518 | Ga0495581_0193518_777_1130 | 108 |
| 30 | 3300050494 | nmdc:mga06z11_674686_c1 | nmdc:mga06z11_674686_c1_55_423 | 108 |
| 31 | 3300005327 | Ga0070658_11657079 | Ga0070658_116570791 | 109 |
| 32 | 3300005364 | Ga0070673_101752924 | Ga0070673_1017529242 | 109 |
| 33 | 3300005436 | Ga0070713_100175596 | Ga0070713_1001755963 | 109 |
| 34 | 3300005578 | Ga0068854_101810018 | Ga0068854_1018100181 | 109 |
| 35 | 3300005618 | Ga0068864_100511097 | Ga0068864_1005110972 | 109 |
| 36 | 3300006028 | Ga0070717_10218010 | Ga0070717_102180103 | 109 |
| 37 | 3300006175 | Ga0070712_100290209 | Ga0070712_1002902093 | 109 |
| 38 | 3300006881 | Ga0068865_101285523 | Ga0068865_1012855232 | 109 |
| 39 | 3300009098 | Ga0105245_10171636 | Ga0105245_101716363 | 109 |
| 40 | 3300009553 | Ga0105249_10115493 | Ga0105249_101154934 | 109 |
| 41 | 3300011119 | Ga0105246_10771941 | Ga0105246_107719412 | 109 |
| 42 | 3300012481 | Ga0157320_1004200 | Ga0157320_10042002 | 109 |
| 43 | 3300012491 | Ga0157329_1001096 | Ga0157329_10010962 | 109 |
| 44 | 3300013307 | Ga0157372_10993195 | Ga0157372_109931952 | 109 |
| 45 | 3300025908 | Ga0207643_10128165 | Ga0207643_101281654 | 109 |
| 46 | 3300025927 | Ga0207687_10101756 | Ga0207687_101017562 | 109 |
| 47 | 3300025928 | Ga0207700_10057544 | Ga0207700_100575442 | 109 |
| 48 | 3300025929 | Ga0207664_10016121 | Ga0207664_100161214 | 109 |
| 49 | 3300025938 | Ga0207704_10789613 | Ga0207704_107896132 | 109 |
| 50 | 3300025944 | Ga0207661_11514822 | Ga0207661_115148221 | 109 |
| 51 | 3300026023 | Ga0207677_10119703 | Ga0207677_101197032 | 109 |
| 52 | 3300026142 | Ga0207698_10617004 | Ga0207698_106170042 | 109 |
| 53 | 3300035691 | Ga0373931_0502728 | Ga0373931_0502728_148_501 | 109 |
| 54 | 3300048905 | Ga0496102_0381263 | Ga0496102_0381263_361_738 | 109 |
| 55 | 3300048911 | Ga0496108_0191970 | Ga0496108_0191970_447_800 | 109 |
| 56 | 3300048913 | Ga0496110_0095540 | Ga0496110_0095540_401_754 | 109 |
| 57 | 3300048914 | Ga0496111_0238732 | Ga0496111_0238732_720_1073 | 109 |
| 58 | 3300005435 | Ga0070714_100659508 | Ga0070714_1006595081 | 110 |
| 59 | 3300006028 | Ga0070717_10247061 | Ga0070717_102470613 | 110 |
| 60 | 3300020081 | Ga0206354_10888142 | Ga0206354_108881422 | 110 |
| 61 | 3300025929 | Ga0207664_10709559 | Ga0207664_107095592 | 110 |
| 62 | 3300025937 | Ga0207669_11936021 | Ga0207669_119360211 | 110 |
| 63 | 3300026095 | Ga0207676_10938944 | Ga0207676_109389442 | 110 |
| 64 | 3300005435 | Ga0070714_100136993 | Ga0070714_1001369932 | 111 |
| 65 | 3300005435 | Ga0070714_101139138 | Ga0070714_1011391382 | 111 |
| 66 | 3300005436 | Ga0070713_100021731 | Ga0070713_1000217312 | 111 |
| 67 | 3300005439 | Ga0070711_100243365 | Ga0070711_1002433652 | 111 |
| 68 | 3300006028 | Ga0070717_10354842 | Ga0070717_103548422 | 111 |
| 69 | 3300006175 | Ga0070712_100049959 | Ga0070712_1000499591 | 111 |
| 70 | 3300007265 | Ga0099794_10227437 | Ga0099794_102274372 | 111 |
| 71 | 3300020069 | Ga0197907_10610233 | Ga0197907_106102332 | 111 |
| 72 | 3300025898 | Ga0207692_10740146 | Ga0207692_107401462 | 111 |
| 73 | 3300025915 | Ga0207693_10041863 | Ga0207693_100418635 | 111 |
| 74 | 3300025916 | Ga0207663_10275867 | Ga0207663_102758672 | 111 |
| 75 | 3300025928 | Ga0207700_10193962 | Ga0207700_101939622 | 111 |
| 76 | 3300025929 | Ga0207664_10002398 | Ga0207664_1000239812 | 111 |
| 77 | 3300027671 | Ga0209588_1229230 | Ga0209588_12292302 | 111 |
| 78 | 3300037853 | Ga0436364_0731702 | Ga0436364_0731702_551_904 | 111 |
| 79 | 3300039450 | Ga0436363_0660717 | Ga0436363_0660717_45_398 | 111 |
| 80 | 3300005435 | Ga0070714_100730257 | Ga0070714_1007302572 | 112 |
| 81 | 3300005985 | Ga0081539_10184408 | Ga0081539_101844082 | 112 |
| 82 | 3300025942 | Ga0207689_10511008 | Ga0207689_105110082 | 112 |
| 83 | 3300046517 | Ga0495630_0262702 | Ga0495630_0262702_452_814 | 112 |
| 84 | 3300046678 | Ga0495599_0166504 | Ga0495599_0166504_41_403 | 112 |
| 85 | 3300005338 | Ga0068868_100242163 | Ga0068868_1002421633 | 113 |
| 86 | 3300005354 | Ga0070675_100844610 | Ga0070675_1008446102 | 113 |
| 87 | 3300005456 | Ga0070678_100567890 | Ga0070678_1005678902 | 113 |
| 88 | 3300005457 | Ga0070662_101162242 | Ga0070662_1011622422 | 113 |
| 89 | 3300005544 | Ga0070686_100460688 | Ga0070686_1004606882 | 113 |
| 90 | 3300005564 | Ga0070664_100859371 | Ga0070664_1008593711 | 113 |
| 91 | 3300005577 | Ga0068857_100906072 | Ga0068857_1009060722 | 113 |
| 92 | 3300005618 | Ga0068864_100611038 | Ga0068864_1006110382 | 113 |
| 93 | 3300011119 | Ga0105246_10844507 | Ga0105246_108445072 | 113 |
| 94 | 3300013297 | Ga0157378_10727701 | Ga0157378_107277012 | 113 |
| 95 | 3300013308 | Ga0157375_10402962 | Ga0157375_104029622 | 113 |
| 96 | 3300025926 | Ga0207659_10992707 | Ga0207659_109927072 | 113 |
| 97 | 3300025933 | Ga0207706_11151246 | Ga0207706_111512461 | 113 |
| 98 | 3300025936 | Ga0207670_10082384 | Ga0207670_100823843 | 113 |
| 99 | 3300026088 | Ga0207641_10893079 | Ga0207641_108930792 | 113 |
| 100 | 3300026095 | Ga0207676_10481057 | Ga0207676_104810572 | 113 |
| 101 | 3300026121 | Ga0207683_10496904 | Ga0207683_104969042 | 113 |
| 102 | 3300044719 | Ga0466971_0207219 | Ga0466971_0207219_279_635 | 113 |
| 103 | 3300046463 | Ga0495653_0748320 | Ga0495653_0748320_29_385 | 113 |
| 104 | 3300048911 | Ga0496108_0475101 | Ga0496108_0475101_297_698 | 113 |
| 105 | 3300005437 | Ga0070710_10110023 | Ga0070710_101100232 | 114 |
| 106 | 3300005439 | Ga0070711_100425451 | Ga0070711_1004254512 | 114 |
| 107 | 3300006175 | Ga0070712_100032518 | Ga0070712_1000325183 | 114 |
| 108 | 3300009176 | Ga0105242_10899249 | Ga0105242_108992492 | 114 |
| 109 | 3300011119 | Ga0105246_10069132 | Ga0105246_100691323 | 114 |
| 110 | 3300025898 | Ga0207692_10091916 | Ga0207692_100919164 | 114 |
| 111 | 3300025915 | Ga0207693_10073831 | Ga0207693_100738313 | 114 |
| 112 | 3300025916 | Ga0207663_10487931 | Ga0207663_104879312 | 114 |
| 113 | 3300025929 | Ga0207664_10282912 | Ga0207664_102829122 | 114 |
| 114 | 3300025944 | Ga0207661_10376657 | Ga0207661_103766572 | 114 |
| 115 | 3300025986 | Ga0207658_10160943 | Ga0207658_101609433 | 114 |
| 116 | 3300026023 | Ga0207677_10209905 | Ga0207677_102099052 | 114 |
| 117 | 3300028654 | Ga0265322_10012148 | Ga0265322_100121483 | 114 |
| 118 | 3300032126 | Ga0307415_101704642 | Ga0307415_1017046422 | 114 |
| 119 | 3300035172 | Ga0373955_0187489 | Ga0373955_0187489_543_953 | 114 |
| 120 | 3300037466 | Ga0395898_0845471 | Ga0395898_0845471_117_470 | 114 |
| 121 | 3300039447 | Ga0436361_1006166 | Ga0436361_1006166_160_528 | 114 |
| 122 | 3300050511 | nmdc:mga08y16_60466_c1 | nmdc:mga08y16_60466_c1_1289_1666 | 114 |
| 123 | iso_pu_bacteria | 2902792274 | 2902794586 | 114 |
| 124 | 3300005343 | Ga0070687_101317826 | Ga0070687_1013178261 | 115 |
| 125 | 3300005356 | Ga0070674_100436357 | Ga0070674_1004363572 | 115 |
| 126 | 3300005436 | Ga0070713_100573788 | Ga0070713_1005737882 | 115 |
| 127 | 3300006028 | Ga0070717_10133495 | Ga0070717_101334952 | 115 |
| 128 | 3300006028 | Ga0070717_10215727 | Ga0070717_102157272 | 115 |
| 129 | 3300006175 | Ga0070712_100333417 | Ga0070712_1003334171 | 115 |
| 130 | 3300007265 | Ga0099794_10232037 | Ga0099794_102320371 | 115 |
| 131 | 3300013307 | Ga0157372_12408752 | Ga0157372_124087522 | 115 |
| 132 | 3300021384 | Ga0213876_10297070 | Ga0213876_102970702 | 115 |
| 133 | 3300025908 | Ga0207643_10878524 | Ga0207643_108785242 | 115 |
| 134 | 3300025918 | Ga0207662_10412841 | Ga0207662_104128412 | 115 |
| 135 | 3300026121 | Ga0207683_10321318 | Ga0207683_103213181 | 115 |
| 136 | 3300039437 | Ga0436365_0274842 | Ga0436365_0274842_41_397 | 115 |
| 137 | 3300039437 | Ga0436365_1803159 | Ga0436365_1803159_116_475 | 115 |
| 138 | 3300044719 | Ga0466971_0653254 | Ga0466971_0653254_71_433 | 115 |
| 139 | 3300005434 | Ga0070709_10028810 | Ga0070709_100288103 | 116 |
| 140 | 3300005436 | Ga0070713_100323660 | Ga0070713_1003236602 | 116 |
| 141 | 3300005436 | Ga0070713_100592023 | Ga0070713_1005920232 | 116 |
| 142 | 3300005437 | Ga0070710_10249046 | Ga0070710_102490462 | 116 |
| 143 | 3300005439 | Ga0070711_100013342 | Ga0070711_1000133423 | 116 |
| 144 | 3300005439 | Ga0070711_101064194 | Ga0070711_1010641942 | 116 |
| 145 | 3300005455 | Ga0070663_100448047 | Ga0070663_1004480471 | 116 |
| 146 | 3300005467 | Ga0070706_100563986 | Ga0070706_1005639862 | 116 |
| 147 | 3300005530 | Ga0070679_100368759 | Ga0070679_1003687591 | 116 |
| 148 | 3300005548 | Ga0070665_100208055 | Ga0070665_1002080553 | 116 |
| 149 | 3300006028 | Ga0070717_10080331 | Ga0070717_100803313 | 116 |
| 150 | 3300006163 | Ga0070715_10158032 | Ga0070715_101580322 | 116 |
| 151 | 3300006175 | Ga0070712_101179353 | Ga0070712_1011793532 | 116 |
| 152 | 3300009148 | Ga0105243_10592473 | Ga0105243_105924733 | 116 |
| 153 | 3300022467 | Ga0224712_10186804 | Ga0224712_101868042 | 116 |
| 154 | 3300025906 | Ga0207699_10039554 | Ga0207699_100395543 | 116 |
| 155 | 3300025910 | Ga0207684_10279757 | Ga0207684_102797572 | 116 |
| 156 | 3300025915 | Ga0207693_10251621 | Ga0207693_102516212 | 116 |
| 157 | 3300025915 | Ga0207693_10981765 | Ga0207693_109817652 | 116 |
| 158 | 3300025916 | Ga0207663_10017879 | Ga0207663_100178794 | 116 |
| 159 | 3300025916 | Ga0207663_10721660 | Ga0207663_107216602 | 116 |
| 160 | 3300025928 | Ga0207700_10025003 | Ga0207700_100250032 | 116 |
| 161 | 3300025928 | Ga0207700_10044839 | Ga0207700_100448393 | 116 |
| 162 | 3300025928 | Ga0207700_10402204 | Ga0207700_104022041 | 116 |
| 163 | 3300025929 | Ga0207664_10025223 | Ga0207664_100252233 | 116 |
| 164 | 3300025929 | Ga0207664_10194144 | Ga0207664_101941443 | 116 |
| 165 | 3300025939 | Ga0207665_10352660 | Ga0207665_103526602 | 116 |
| 166 | 3300028379 | Ga0268266_10436691 | Ga0268266_104366912 | 116 |
| 167 | 3300028800 | Ga0265338_10000911 | Ga0265338_1000091131 | 116 |
| 168 | 3300034816 | Ga0373930_0073705 | Ga0373930_0073705_236_640 | 116 |
| 169 | 3300035084 | Ga0373928_0019732 | Ga0373928_0019732_641_1045 | 116 |
| 170 | 3300035092 | Ga0373952_0024052 | Ga0373952_0024052_353_799 | 116 |
| 171 | 3300035112 | Ga0373932_0245935 | Ga0373932_0245935_202_606 | 116 |
| 172 | 3300035691 | Ga0373931_0845081 | Ga0373931_0845081_144_548 | 116 |
| 173 | 3300035692 | Ga0373935_0584807 | Ga0373935_0584807_363_743 | 116 |
| 174 | 3300046477 | Ga0495664_0244205 | Ga0495664_0244205_448_828 | 116 |
| 175 | 3300046535 | Ga0495586_0465864 | Ga0495586_0465864_46_414 | 116 |
| 176 | 3300047471 | Ga0495684_0633855 | Ga0495684_0633855_56_436 | 116 |
| 177 | 3300048903 | Ga0496100_0366552 | Ga0496100_0366552_206_610 | 116 |
| 178 | 3300048904 | Ga0496101_1576247 | Ga0496101_1576247_10_414 | 116 |
| 179 | 3300048907 | Ga0496104_0264162 | Ga0496104_0264162_387_791 | 116 |
| 180 | 3300048913 | Ga0496110_0397510 | Ga0496110_0397510_195_641 | 116 |
| 181 | 3300048916 | Ga0496113_0436223 | Ga0496113_0436223_261_665 | 116 |
| 182 | 3300048917 | Ga0496114_0013670 | Ga0496114_0013670_237_641 | 116 |
| 183 | 3300048918 | Ga0496115_0233440 | Ga0496115_0233440_852_1256 | 116 |
| 184 | 3300048929 | Ga0496126_0024577 | Ga0496126_0024577_3018_3386 | 116 |
| 185 | 3300005337 | Ga0070682_100884637 | Ga0070682_1008846371 | 117 |
| 186 | 3300005338 | Ga0068868_100581055 | Ga0068868_1005810552 | 117 |
| 187 | 3300005339 | Ga0070660_100313786 | Ga0070660_1003137862 | 117 |
| 188 | 3300005366 | Ga0070659_100030882 | Ga0070659_1000308823 | 117 |
| 189 | 3300005436 | Ga0070713_100263862 | Ga0070713_1002638623 | 117 |
| 190 | 3300005436 | Ga0070713_101498763 | Ga0070713_1014987632 | 117 |
| 191 | 3300005455 | Ga0070663_100122415 | Ga0070663_1001224153 | 117 |
| 192 | 3300005456 | Ga0070678_100503563 | Ga0070678_1005035632 | 117 |
| 193 | 3300005456 | Ga0070678_101035630 | Ga0070678_1010356301 | 117 |
| 194 | 3300005535 | Ga0070684_100238972 | Ga0070684_1002389721 | 117 |
| 195 | 3300005535 | Ga0070684_101307283 | Ga0070684_1013072832 | 117 |
| 196 | 3300005548 | Ga0070665_100150342 | Ga0070665_1001503422 | 117 |
| 197 | 3300005564 | Ga0070664_100131133 | Ga0070664_1001311332 | 117 |
| 198 | 3300005577 | Ga0068857_100769685 | Ga0068857_1007696851 | 117 |
| 199 | 3300005617 | Ga0068859_101562035 | Ga0068859_1015620352 | 117 |
| 200 | 3300005618 | Ga0068864_100189578 | Ga0068864_1001895783 | 117 |
| 201 | 3300005834 | Ga0068851_10098824 | Ga0068851_100988242 | 117 |
| 202 | 3300005840 | Ga0068870_10410050 | Ga0068870_104100502 | 117 |
| 203 | 3300005842 | Ga0068858_100766011 | Ga0068858_1007660111 | 117 |
| 204 | 3300006358 | Ga0068871_100709426 | Ga0068871_1007094261 | 117 |
| 205 | 3300006931 | Ga0097620_101562085 | Ga0097620_1015620851 | 117 |
| 206 | 3300009094 | Ga0111539_12256436 | Ga0111539_122564362 | 117 |
| 207 | 3300009098 | Ga0105245_10779848 | Ga0105245_107798482 | 117 |
| 208 | 3300009101 | Ga0105247_10383658 | Ga0105247_103836581 | 117 |
| 209 | 3300009147 | Ga0114129_11021087 | Ga0114129_110210872 | 117 |
| 210 | 3300009176 | Ga0105242_10569302 | Ga0105242_105693021 | 117 |
| 211 | 3300009553 | Ga0105249_12494479 | Ga0105249_124944792 | 117 |
| 212 | 3300010375 | Ga0105239_10870195 | Ga0105239_108701952 | 117 |
| 213 | 3300010375 | Ga0105239_11816212 | Ga0105239_118162122 | 117 |
| 214 | 3300011119 | Ga0105246_11488007 | Ga0105246_114880071 | 117 |
| 215 | 3300013105 | Ga0157369_11501494 | Ga0157369_115014941 | 117 |
| 216 | 3300014325 | Ga0163163_10362961 | Ga0163163_103629612 | 117 |
| 217 | 3300014497 | Ga0182008_10988643 | Ga0182008_109886432 | 117 |
| 218 | 3300014745 | Ga0157377_10184400 | Ga0157377_101844002 | 117 |
| 219 | 3300014968 | Ga0157379_10690337 | Ga0157379_106903372 | 117 |
| 220 | 3300025899 | Ga0207642_10234247 | Ga0207642_102342472 | 117 |
| 221 | 3300025900 | Ga0207710_10596490 | Ga0207710_105964901 | 117 |
| 222 | 3300025908 | Ga0207643_10370237 | Ga0207643_103702371 | 117 |
| 223 | 3300025919 | Ga0207657_10152361 | Ga0207657_101523613 | 117 |
| 224 | 3300025922 | Ga0207646_10088665 | Ga0207646_100886654 | 117 |
| 225 | 3300025925 | Ga0207650_11523366 | Ga0207650_115233662 | 117 |
| 226 | 3300025927 | Ga0207687_10197693 | Ga0207687_101976932 | 117 |
| 227 | 3300025928 | Ga0207700_10009263 | Ga0207700_100092638 | 117 |
| 228 | 3300025928 | Ga0207700_10464388 | Ga0207700_104643882 | 117 |
| 229 | 3300025936 | Ga0207670_10096131 | Ga0207670_100961313 | 117 |
| 230 | 3300025945 | Ga0207679_11156040 | Ga0207679_111560401 | 117 |
| 231 | 3300025949 | Ga0207667_10458925 | Ga0207667_104589252 | 117 |
| 232 | 3300025961 | Ga0207712_11431061 | Ga0207712_114310612 | 117 |
| 233 | 3300026023 | Ga0207677_10327913 | Ga0207677_103279132 | 117 |
| 234 | 3300026035 | Ga0207703_10458548 | Ga0207703_104585482 | 117 |
| 235 | 3300026067 | Ga0207678_10104558 | Ga0207678_101045583 | 117 |
| 236 | 3300026067 | Ga0207678_11438847 | Ga0207678_114388472 | 117 |
| 237 | 3300026078 | Ga0207702_11046008 | Ga0207702_110460082 | 117 |
| 238 | 3300026088 | Ga0207641_10264833 | Ga0207641_102648331 | 117 |
| 239 | 3300026095 | Ga0207676_10379543 | Ga0207676_103795432 | 117 |
| 240 | 3300026121 | Ga0207683_10224995 | Ga0207683_102249952 | 117 |
| 241 | 3300028379 | Ga0268266_10094489 | Ga0268266_100944893 | 117 |
| 242 | 3300028379 | Ga0268266_10561420 | Ga0268266_105614201 | 117 |
| 243 | 3300028381 | Ga0268264_11088194 | Ga0268264_110881942 | 117 |
| 244 | 3300035725 | Ga0373947_0871213 | Ga0373947_0871213_145_498 | 117 |
| 245 | 3300044658 | Ga0466972_0179580 | Ga0466972_0179580_123_488 | 117 |
| 246 | 3300044901 | Ga0466960_0026340 | Ga0466960_0026340_273_635 | 117 |
| 247 | 3300045976 | Ga0466967_0744873 | Ga0466967_0744873_118_492 | 117 |
| 248 | 3300048907 | Ga0496104_1562008 | Ga0496104_1562008_89_454 | 117 |
| 249 | 3300048909 | Ga0496106_0309783 | Ga0496106_0309783_806_1171 | 117 |
| 250 | 3300048911 | Ga0496108_0190165 | Ga0496108_0190165_179_544 | 117 |
| 251 | 3300048912 | Ga0496109_1063842 | Ga0496109_1063842_208_573 | 117 |
| 252 | 3300048916 | Ga0496113_1418373 | Ga0496113_1418373_133_498 | 117 |
| 253 | iso_pu_bacteria | 2870721527 | 2870729125 | 117 |
| 254 | 3300005329 | Ga0070683_100796339 | Ga0070683_1007963391 | 118 |
| 255 | 3300005337 | Ga0070682_100319565 | Ga0070682_1003195652 | 118 |
| 256 | 3300005437 | Ga0070710_10190195 | Ga0070710_101901952 | 118 |
| 257 | 3300005614 | Ga0068856_100042296 | Ga0068856_1000422965 | 118 |
| 258 | 3300005937 | Ga0081455_10012740 | Ga0081455_100127402 | 118 |
| 259 | 3300006163 | Ga0070715_10001007 | Ga0070715_100010077 | 118 |
| 260 | 3300006173 | Ga0070716_100028331 | Ga0070716_1000283314 | 118 |
| 261 | 3300006173 | Ga0070716_100080873 | Ga0070716_1000808732 | 118 |
| 262 | 3300006175 | Ga0070712_100453204 | Ga0070712_1004532042 | 118 |
| 263 | 3300006237 | Ga0097621_100388232 | Ga0097621_1003882323 | 118 |
| 264 | 3300013306 | Ga0163162_10704482 | Ga0163162_107044821 | 118 |
| 265 | 3300013307 | Ga0157372_12481884 | Ga0157372_124818842 | 118 |
| 266 | 3300014968 | Ga0157379_10696713 | Ga0157379_106967131 | 118 |
| 267 | 3300014969 | Ga0157376_10958946 | Ga0157376_109589462 | 118 |
| 268 | 3300022467 | Ga0224712_10096279 | Ga0224712_100962793 | 118 |
| 269 | 3300025898 | Ga0207692_10040645 | Ga0207692_100406453 | 118 |
| 270 | 3300025905 | Ga0207685_10077184 | Ga0207685_100771843 | 118 |
| 271 | 3300025915 | Ga0207693_10002838 | Ga0207693_100028384 | 118 |
| 272 | 3300025916 | Ga0207663_10092844 | Ga0207663_100928442 | 118 |
| 273 | 3300025917 | Ga0207660_11715109 | Ga0207660_117151091 | 118 |
| 274 | 3300025928 | Ga0207700_10126999 | Ga0207700_101269992 | 118 |
| 275 | 3300025929 | Ga0207664_10062607 | Ga0207664_100626074 | 118 |
| 276 | 3300025939 | Ga0207665_10004471 | Ga0207665_100044714 | 118 |
| 277 | 3300025939 | Ga0207665_10005230 | Ga0207665_100052307 | 118 |
| 278 | 3300025944 | Ga0207661_10992529 | Ga0207661_109925292 | 118 |
| 279 | 3300025945 | Ga0207679_10293152 | Ga0207679_102931522 | 118 |
| 280 | 3300035083 | Ga0373926_0003730 | Ga0373926_0003730_4023_4409 | 118 |
| 281 | 3300035086 | Ga0373934_0135914 | Ga0373934_0135914_37_423 | 118 |
| 282 | 3300035089 | Ga0373944_0005260 | Ga0373944_0005260_623_1009 | 118 |
| 283 | 3300035113 | Ga0373936_0000206 | Ga0373936_0000206_17647_18033 | 118 |
| 284 | 3300035116 | Ga0373945_0001919 | Ga0373945_0001919_4612_4998 | 118 |
| 285 | 3300035170 | Ga0373943_0001364 | Ga0373943_0001364_4681_5067 | 118 |
| 286 | 3300035171 | Ga0373946_0000123 | Ga0373946_0000123_6072_6458 | 118 |
| 287 | 3300035172 | Ga0373955_0072561 | Ga0373955_0072561_857_1243 | 118 |
| 288 | 3300035207 | Ga0373942_0020587 | Ga0373942_0020587_585_971 | 118 |
| 289 | 3300035692 | Ga0373935_0005609 | Ga0373935_0005609_1164_1550 | 118 |
| 290 | 3300035695 | Ga0373927_0001451 | Ga0373927_0001451_5733_6119 | 118 |
| 291 | 3300035725 | Ga0373947_0000510 | Ga0373947_0000510_15148_15534 | 118 |
| 292 | 3300036401 | Ga0373937_0046204 | Ga0373937_0046204_866_1252 | 118 |
| 293 | 3300036401 | Ga0373937_1798970 | Ga0373937_1798970_138_521 | 118 |
| 294 | 3300037068 | Ga0373925_0000879 | Ga0373925_0000879_11486_11872 | 118 |
| 295 | 3300037853 | Ga0436364_1302603 | Ga0436364_1302603_210_575 | 118 |
| 296 | 3300039437 | Ga0436365_0985376 | Ga0436365_0985376_107_493 | 118 |
| 297 | 3300039437 | Ga0436365_1026192 | Ga0436365_1026192_89_445 | 118 |
| 298 | 3300039450 | Ga0436363_0682306 | Ga0436363_0682306_342_728 | 118 |
| 299 | 3300042016 | Ga0439463_025845 | Ga0439463_025845_823_1194 | 118 |
| 300 | 3300044694 | Ga0466963_0871806 | Ga0466963_0871806_175_555 | 118 |
| 301 | 3300044842 | Ga0466957_1288038 | Ga0466957_1288038_120_500 | 118 |
| 302 | 3300046459 | Ga0495629_0122290 | Ga0495629_0122290_154_540 | 118 |
| 303 | 3300046462 | Ga0495651_0012138 | Ga0495651_0012138_4848_5234 | 118 |
| 304 | 3300046463 | Ga0495653_0019577 | Ga0495653_0019577_422_808 | 118 |
| 305 | 3300046476 | Ga0495662_0008779 | Ga0495662_0008779_615_1001 | 118 |
| 306 | 3300046477 | Ga0495664_0001416 | Ga0495664_0001416_8959_9345 | 118 |
| 307 | 3300046511 | Ga0495608_0217297 | Ga0495608_0217297_450_836 | 118 |
| 308 | 3300046514 | Ga0495618_0038322 | Ga0495618_0038322_613_999 | 118 |
| 309 | 3300046516 | Ga0495628_0068577 | Ga0495628_0068577_851_1237 | 118 |
| 310 | 3300046517 | Ga0495630_0001678 | Ga0495630_0001678_76_462 | 118 |
| 311 | 3300046529 | Ga0495652_0014642 | Ga0495652_0014642_925_1311 | 118 |
| 312 | 3300046531 | Ga0495665_0027230 | Ga0495665_0027230_906_1292 | 118 |
| 313 | 3300046533 | Ga0495640_0155963 | Ga0495640_0155963_382_768 | 118 |
| 314 | 3300046543 | Ga0495645_0321713 | Ga0495645_0321713_87_473 | 118 |
| 315 | 3300046559 | Ga0495667_0002066 | Ga0495667_0002066_4154_4540 | 118 |
| 316 | 3300046642 | Ga0495634_0047852 | Ga0495634_0047852_1826_2212 | 118 |
| 317 | 3300046663 | Ga0495635_0002813 | Ga0495635_0002813_8232_8618 | 118 |
| 318 | 3300046675 | Ga0495657_0016729 | Ga0495657_0016729_1414_1800 | 118 |
| 319 | 3300046678 | Ga0495599_0007609 | Ga0495599_0007609_4154_4540 | 118 |
| 320 | 3300046681 | Ga0495647_0156642 | Ga0495647_0156642_517_903 | 118 |
| 321 | 3300046683 | Ga0495658_0700943 | Ga0495658_0700943_176_562 | 118 |
| 322 | 3300047315 | Ga0495581_0020561 | Ga0495581_0020561_679_1065 | 118 |
| 323 | 3300047319 | Ga0495674_0002794 | Ga0495674_0002794_13337_13723 | 118 |
| 324 | 3300047321 | Ga0495676_0007451 | Ga0495676_0007451_5948_6334 | 118 |
| 325 | 3300047322 | Ga0495680_0015795 | Ga0495680_0015795_2484_2870 | 118 |
| 326 | 3300047471 | Ga0495684_0006613 | Ga0495684_0006613_4452_4838 | 118 |
| 327 | 3300047673 | Ga0495593_0159897 | Ga0495593_0159897_533_919 | 118 |
| 328 | 3300048904 | Ga0496101_0225368 | Ga0496101_0225368_874_1236 | 118 |
| 329 | 3300048905 | Ga0496102_0111722 | Ga0496102_0111722_1397_1759 | 118 |
| 330 | 3300048906 | Ga0496103_0370228 | Ga0496103_0370228_124_486 | 118 |
| 331 | 3300048907 | Ga0496104_0005163 | Ga0496104_0005163_2962_3324 | 118 |
| 332 | 3300048908 | Ga0496105_0004718 | Ga0496105_0004718_1988_2350 | 118 |
| 333 | 3300048910 | Ga0496107_0171160 | Ga0496107_0171160_415_777 | 118 |
| 334 | 3300048911 | Ga0496108_0004974 | Ga0496108_0004974_8279_8641 | 118 |
| 335 | 3300048912 | Ga0496109_0010814 | Ga0496109_0010814_5132_5494 | 118 |
| 336 | 3300048914 | Ga0496111_0755443 | Ga0496111_0755443_306_692 | 118 |
| 337 | 3300048915 | Ga0496112_0223500 | Ga0496112_0223500_554_916 | 118 |
| 338 | 3300048916 | Ga0496113_0004041 | Ga0496113_0004041_3634_3996 | 118 |
| 339 | 3300048918 | Ga0496115_0022786 | Ga0496115_0022786_2255_2617 | 118 |
| 340 | 3300050507 | nmdc:mga05p37_945656_c1 | nmdc:mga05p37_945656_c1_13_384 | 118 |
| 341 | 3300050510 | nmdc:mga06r32_792933_c1 | nmdc:mga06r32_792933_c1_66_437 | 118 |
| 342 | 3300050512 | nmdc:mga0n895_2164801_c1 | nmdc:mga0n895_2164801_c1_115_486 | 118 |
| 343 | 3300050513 | nmdc:mga0rr50_1868136_c1 | nmdc:mga0rr50_1868136_c1_26_388 | 118 |
| 344 | 3300053078 | Ga0495612_0112953 | Ga0495612_0112953_464_850 | 118 |
| 345 | iso_pu_bacteria | 3002998708 | 3003002236 | 118 |
| 346 | 3300005434 | Ga0070709_10096367 | Ga0070709_100963673 | 119 |
| 347 | 3300005436 | Ga0070713_100030293 | Ga0070713_1000302934 | 119 |
| 348 | 3300005436 | Ga0070713_100614444 | Ga0070713_1006144442 | 119 |
| 349 | 3300005439 | Ga0070711_100025647 | Ga0070711_1000256474 | 119 |
| 350 | 3300005841 | Ga0068863_100657588 | Ga0068863_1006575882 | 119 |
| 351 | 3300006028 | Ga0070717_11232435 | Ga0070717_112324352 | 119 |
| 352 | 3300006173 | Ga0070716_100449537 | Ga0070716_1004495372 | 119 |
| 353 | 3300009147 | Ga0114129_10679304 | Ga0114129_106793042 | 119 |
| 354 | 3300009177 | Ga0105248_10592881 | Ga0105248_105928812 | 119 |
| 355 | 3300021388 | Ga0213875_10121738 | Ga0213875_101217382 | 119 |
| 356 | 3300025928 | Ga0207700_10291651 | Ga0207700_102916512 | 119 |
| 357 | 3300026078 | Ga0207702_10022811 | Ga0207702_100228114 | 119 |
| 358 | 3300026088 | Ga0207641_10178236 | Ga0207641_101782362 | 119 |
| 359 | 3300037853 | Ga0436364_1340274 | Ga0436364_1340274_6090_6449 | 119 |
| 360 | 3300046529 | Ga0495652_0169601 | Ga0495652_0169601_1052_1450 | 119 |
| 361 | 3300053136 | Ga0500559_0336106 | Ga0500559_0336106_276_635 | 119 |
| 362 | 3300005440 | Ga0070705_100127804 | Ga0070705_1001278042 | 120 |
| 363 | 3300005471 | Ga0070698_101397775 | Ga0070698_1013977752 | 120 |
| 364 | 3300005614 | Ga0068856_100158753 | Ga0068856_1001587532 | 120 |
| 365 | 3300025928 | Ga0207700_11096223 | Ga0207700_110962232 | 120 |
| 366 | 3300037853 | Ga0436364_0493666 | Ga0436364_0493666_1164_1526 | 120 |
| 367 | 3300060353 | Ga0501082_1616419 | Ga0501082_1616419_184_552 | 120 |
| 368 | 3300005435 | Ga0070714_100000937 | Ga0070714_10000093717 | 121 |
| 369 | 3300005436 | Ga0070713_100031660 | Ga0070713_1000316602 | 121 |
| 370 | 3300005467 | Ga0070706_101152073 | Ga0070706_1011520731 | 121 |
| 371 | 3300006028 | Ga0070717_10011647 | Ga0070717_100116474 | 121 |
| 372 | 3300006871 | Ga0075434_100008238 | Ga0075434_1000082382 | 121 |
| 373 | 3300007076 | Ga0075435_100132301 | Ga0075435_1001323012 | 121 |
| 374 | 3300013105 | Ga0157369_10290741 | Ga0157369_102907413 | 121 |
| 375 | 3300017792 | Ga0163161_10986533 | Ga0163161_109865332 | 121 |
| 376 | 3300021384 | Ga0213876_10025335 | Ga0213876_100253353 | 121 |
| 377 | 3300025929 | Ga0207664_10001327 | Ga0207664_100013272 | 121 |
| 378 | 3300039437 | Ga0436365_1268655 | Ga0436365_1268655_22091_22456 | 121 |
| 379 | 3300044658 | Ga0466972_0125251 | Ga0466972_0125251_433_798 | 121 |
| 380 | 3300044684 | Ga0466966_0284844 | Ga0466966_0284844_100_465 | 121 |
| 381 | 3300044693 | Ga0466961_0002925 | Ga0466961_0002925_9724_10089 | 121 |
| 382 | 3300044694 | Ga0466963_0135203 | Ga0466963_0135203_848_1216 | 121 |
| 383 | 3300044719 | Ga0466971_0091915 | Ga0466971_0091915_109_474 | 121 |
| 384 | 3300044719 | Ga0466971_0157557 | Ga0466971_0157557_29_397 | 121 |
| 385 | 3300044765 | Ga0466970_0270861 | Ga0466970_0270861_575_940 | 121 |
| 386 | 3300044842 | Ga0466957_0283700 | Ga0466957_0283700_294_662 | 121 |
| 387 | 3300044842 | Ga0466957_0309464 | Ga0466957_0309464_130_495 | 121 |
| 388 | 3300045049 | Ga0466959_0534964 | Ga0466959_0534964_76_444 | 121 |
| 389 | 3300045836 | Ga0466958_0060893 | Ga0466958_0060893_333_698 | 121 |
| 390 | 3300045976 | Ga0466967_0473759 | Ga0466967_0473759_776_1144 | 121 |
| 391 | 3300048904 | Ga0496101_0348623 | Ga0496101_0348623_669_1043 | 121 |
| 392 | 3300048905 | Ga0496102_0249595 | Ga0496102_0249595_805_1179 | 121 |
| 393 | 3300048907 | Ga0496104_0181582 | Ga0496104_0181582_262_636 | 121 |
| 394 | 3300048908 | Ga0496105_0012672 | Ga0496105_0012672_484_858 | 121 |
| 395 | 3300048909 | Ga0496106_0029465 | Ga0496106_0029465_2860_3234 | 121 |
| 396 | 3300048911 | Ga0496108_0085639 | Ga0496108_0085639_1560_1934 | 121 |
| 397 | 3300048912 | Ga0496109_0044183 | Ga0496109_0044183_3074_3448 | 121 |
| 398 | 3300048913 | Ga0496110_0097105 | Ga0496110_0097105_1758_2132 | 121 |
| 399 | 3300048914 | Ga0496111_0024913 | Ga0496111_0024913_700_1074 | 121 |
| 400 | 3300048917 | Ga0496114_0370529 | Ga0496114_0370529_262_636 | 121 |
| 401 | 3300050512 | nmdc:mga0n895_2169_c1 | nmdc:mga0n895_2169_c1_3244_3645 | 121 |
| 402 | 3300050513 | nmdc:mga0rr50_220574_c1 | nmdc:mga0rr50_220574_c1_931_1332 | 121 |
| 403 | 3300061719 | Ga0466962_0114843 | Ga0466962_0114843_586_951 | 121 |
| 404 | 3300002459 | JGI24751J29686_10003182 | JGI24751J29686_100031821 | 122 |
| 405 | 3300005327 | Ga0070658_10040464 | Ga0070658_100404645 | 122 |
| 406 | 3300005328 | Ga0070676_10331454 | Ga0070676_103314542 | 122 |
| 407 | 3300005329 | Ga0070683_100052373 | Ga0070683_1000523735 | 122 |
| 408 | 3300005329 | Ga0070683_101308524 | Ga0070683_1013085242 | 122 |
| 409 | 3300005330 | Ga0070690_101437926 | Ga0070690_1014379262 | 122 |
| 410 | 3300005331 | Ga0070670_100255372 | Ga0070670_1002553723 | 122 |
| 411 | 3300005334 | Ga0068869_100110630 | Ga0068869_1001106303 | 122 |
| 412 | 3300005335 | Ga0070666_10614291 | Ga0070666_106142912 | 122 |
| 413 | 3300005336 | Ga0070680_100711232 | Ga0070680_1007112322 | 122 |
| 414 | 3300005337 | Ga0070682_100025511 | Ga0070682_1000255113 | 122 |
| 415 | 3300005338 | Ga0068868_100557480 | Ga0068868_1005574802 | 122 |
| 416 | 3300005338 | Ga0068868_101424320 | Ga0068868_1014243202 | 122 |
| 417 | 3300005340 | Ga0070689_100116724 | Ga0070689_1001167243 | 122 |
| 418 | 3300005341 | Ga0070691_10026408 | Ga0070691_100264082 | 122 |
| 419 | 3300005344 | Ga0070661_100151274 | Ga0070661_1001512742 | 122 |
| 420 | 3300005345 | Ga0070692_10013899 | Ga0070692_100138995 | 122 |
| 421 | 3300005354 | Ga0070675_100124838 | Ga0070675_1001248383 | 122 |
| 422 | 3300005355 | Ga0070671_100005402 | Ga0070671_1000054022 | 122 |
| 423 | 3300005364 | Ga0070673_100314174 | Ga0070673_1003141742 | 122 |
| 424 | 3300005364 | Ga0070673_100318813 | Ga0070673_1003188132 | 122 |
| 425 | 3300005365 | Ga0070688_100100420 | Ga0070688_1001004203 | 122 |
| 426 | 3300005366 | Ga0070659_100394351 | Ga0070659_1003943512 | 122 |
| 427 | 3300005367 | Ga0070667_100435226 | Ga0070667_1004352262 | 122 |
| 428 | 3300005367 | Ga0070667_101851071 | Ga0070667_1018510712 | 122 |
| 429 | 3300005434 | Ga0070709_10337100 | Ga0070709_103371002 | 122 |
| 430 | 3300005434 | Ga0070709_10400314 | Ga0070709_104003142 | 122 |
| 431 | 3300005435 | Ga0070714_100392814 | Ga0070714_1003928141 | 122 |
| 432 | 3300005435 | Ga0070714_100624457 | Ga0070714_1006244572 | 122 |
| 433 | 3300005436 | Ga0070713_100156458 | Ga0070713_1001564582 | 122 |
| 434 | 3300005439 | Ga0070711_100710542 | Ga0070711_1007105422 | 122 |
| 435 | 3300005440 | Ga0070705_100611013 | Ga0070705_1006110132 | 122 |
| 436 | 3300005441 | Ga0070700_100033987 | Ga0070700_1000339873 | 122 |
| 437 | 3300005455 | Ga0070663_100016494 | Ga0070663_1000164945 | 122 |
| 438 | 3300005456 | Ga0070678_101122991 | Ga0070678_1011229912 | 122 |
| 439 | 3300005457 | Ga0070662_100511848 | Ga0070662_1005118482 | 122 |
| 440 | 3300005458 | Ga0070681_10032437 | Ga0070681_100324373 | 122 |
| 441 | 3300005466 | Ga0070685_10231754 | Ga0070685_102317542 | 122 |
| 442 | 3300005467 | Ga0070706_100297573 | Ga0070706_1002975731 | 122 |
| 443 | 3300005467 | Ga0070706_100872534 | Ga0070706_1008725342 | 122 |
| 444 | 3300005468 | Ga0070707_100005889 | Ga0070707_10000588916 | 122 |
| 445 | 3300005468 | Ga0070707_100020582 | Ga0070707_1000205829 | 122 |
| 446 | 3300005468 | Ga0070707_101950411 | Ga0070707_1019504111 | 122 |
| 447 | 3300005471 | Ga0070698_100384244 | Ga0070698_1003842442 | 122 |
| 448 | 3300005530 | Ga0070679_100034523 | Ga0070679_1000345235 | 122 |
| 449 | 3300005530 | Ga0070679_100174074 | Ga0070679_1001740741 | 122 |
| 450 | 3300005535 | Ga0070684_100114599 | Ga0070684_1001145993 | 122 |
| 451 | 3300005535 | Ga0070684_100611980 | Ga0070684_1006119802 | 122 |
| 452 | 3300005535 | Ga0070684_102158659 | Ga0070684_1021586591 | 122 |
| 453 | 3300005544 | Ga0070686_100644652 | Ga0070686_1006446522 | 122 |
| 454 | 3300005545 | Ga0070695_101069987 | Ga0070695_1010699872 | 122 |
| 455 | 3300005547 | Ga0070693_100348721 | Ga0070693_1003487212 | 122 |
| 456 | 3300005548 | Ga0070665_100019562 | Ga0070665_1000195623 | 122 |
| 457 | 3300005549 | Ga0070704_100507319 | Ga0070704_1005073191 | 122 |
| 458 | 3300005563 | Ga0068855_100573435 | Ga0068855_1005734352 | 122 |
| 459 | 3300005564 | Ga0070664_100572186 | Ga0070664_1005721862 | 122 |
| 460 | 3300005564 | Ga0070664_100892212 | Ga0070664_1008922122 | 122 |
| 461 | 3300005564 | Ga0070664_102166292 | Ga0070664_1021662921 | 122 |
| 462 | 3300005577 | Ga0068857_100926014 | Ga0068857_1009260142 | 122 |
| 463 | 3300005614 | Ga0068856_101427183 | Ga0068856_1014271832 | 122 |
| 464 | 3300005615 | Ga0070702_100000699 | Ga0070702_1000006992 | 122 |
| 465 | 3300005615 | Ga0070702_100326675 | Ga0070702_1003266752 | 122 |
| 466 | 3300005615 | Ga0070702_100876734 | Ga0070702_1008767341 | 122 |
| 467 | 3300005616 | Ga0068852_100017058 | Ga0068852_1000170585 | 122 |
| 468 | 3300005617 | Ga0068859_100355094 | Ga0068859_1003550943 | 122 |
| 469 | 3300005617 | Ga0068859_102774994 | Ga0068859_1027749941 | 122 |
| 470 | 3300005618 | Ga0068864_100180116 | Ga0068864_1001801162 | 122 |
| 471 | 3300005618 | Ga0068864_100295598 | Ga0068864_1002955982 | 122 |
| 472 | 3300005618 | Ga0068864_100497376 | Ga0068864_1004973761 | 122 |
| 473 | 3300005834 | Ga0068851_10018753 | Ga0068851_100187534 | 122 |
| 474 | 3300005840 | Ga0068870_10037245 | Ga0068870_100372452 | 122 |
| 475 | 3300005841 | Ga0068863_100014461 | Ga0068863_1000144613 | 122 |
| 476 | 3300005841 | Ga0068863_100225369 | Ga0068863_1002253692 | 122 |
| 477 | 3300005841 | Ga0068863_100588458 | Ga0068863_1005884582 | 122 |
| 478 | 3300005842 | Ga0068858_100007085 | Ga0068858_1000070855 | 122 |
| 479 | 3300005844 | Ga0068862_100930876 | Ga0068862_1009308762 | 122 |
| 480 | 3300005983 | Ga0081540_1000130 | Ga0081540_100013021 | 122 |
| 481 | 3300006058 | Ga0075432_10078620 | Ga0075432_100786202 | 122 |
| 482 | 3300006175 | Ga0070712_100818426 | Ga0070712_1008184262 | 122 |
| 483 | 3300006237 | Ga0097621_100012139 | Ga0097621_1000121395 | 122 |
| 484 | 3300006358 | Ga0068871_100114640 | Ga0068871_1001146402 | 122 |
| 485 | 3300006358 | Ga0068871_100463449 | Ga0068871_1004634492 | 122 |
| 486 | 3300006844 | Ga0075428_100712971 | Ga0075428_1007129712 | 122 |
| 487 | 3300006847 | Ga0075431_100340777 | Ga0075431_1003407772 | 122 |
| 488 | 3300006852 | Ga0075433_10030854 | Ga0075433_100308545 | 122 |
| 489 | 3300006871 | Ga0075434_100028027 | Ga0075434_1000280275 | 122 |
| 490 | 3300006880 | Ga0075429_100327577 | Ga0075429_1003275773 | 122 |
| 491 | 3300006914 | Ga0075436_100119535 | Ga0075436_1001195354 | 122 |
| 492 | 3300006914 | Ga0075436_100451878 | Ga0075436_1004518782 | 122 |
| 493 | 3300006931 | Ga0097620_100355098 | Ga0097620_1003550982 | 122 |
| 494 | 3300006931 | Ga0097620_102774409 | Ga0097620_1027744092 | 122 |
| 495 | 3300007076 | Ga0075435_100085064 | Ga0075435_1000850643 | 122 |
| 496 | 3300009094 | Ga0111539_10066323 | Ga0111539_100663232 | 122 |
| 497 | 3300009094 | Ga0111539_10614608 | Ga0111539_106146082 | 122 |
| 498 | 3300009098 | Ga0105245_10012353 | Ga0105245_100123532 | 122 |
| 499 | 3300009098 | Ga0105245_10306220 | Ga0105245_103062203 | 122 |
| 500 | 3300009098 | Ga0105245_10864737 | Ga0105245_108647371 | 122 |
| 501 | 3300009101 | Ga0105247_10269257 | Ga0105247_102692571 | 122 |
| 502 | 3300009101 | Ga0105247_10645988 | Ga0105247_106459882 | 122 |
| 503 | 3300009101 | Ga0105247_10916399 | Ga0105247_109163992 | 122 |
| 504 | 3300009147 | Ga0114129_10385042 | Ga0114129_103850423 | 122 |
| 505 | 3300009174 | Ga0105241_10008085 | Ga0105241_100080855 | 122 |
| 506 | 3300009174 | Ga0105241_10501419 | Ga0105241_105014192 | 122 |
| 507 | 3300009177 | Ga0105248_10493782 | Ga0105248_104937821 | 122 |
| 508 | 3300009545 | Ga0105237_10158460 | Ga0105237_101584602 | 122 |
| 509 | 3300009551 | Ga0105238_10026472 | Ga0105238_100264723 | 122 |
| 510 | 3300009553 | Ga0105249_10275336 | Ga0105249_102753362 | 122 |
| 511 | 3300010375 | Ga0105239_10417257 | Ga0105239_104172572 | 122 |
| 512 | 3300010375 | Ga0105239_12530365 | Ga0105239_125303652 | 122 |
| 513 | 3300011119 | Ga0105246_10004526 | Ga0105246_100045266 | 122 |
| 514 | 3300011119 | Ga0105246_10687854 | Ga0105246_106878542 | 122 |
| 515 | 3300013102 | Ga0157371_10086727 | Ga0157371_100867273 | 122 |
| 516 | 3300013104 | Ga0157370_10024014 | Ga0157370_100240142 | 122 |
| 517 | 3300013104 | Ga0157370_10309511 | Ga0157370_103095112 | 122 |
| 518 | 3300013105 | Ga0157369_10059476 | Ga0157369_100594765 | 122 |
| 519 | 3300013105 | Ga0157369_10586110 | Ga0157369_105861102 | 122 |
| 520 | 3300013296 | Ga0157374_10015605 | Ga0157374_100156056 | 122 |
| 521 | 3300013296 | Ga0157374_10565468 | Ga0157374_105654682 | 122 |
| 522 | 3300013296 | Ga0157374_11097550 | Ga0157374_110975502 | 122 |
| 523 | 3300013306 | Ga0163162_10800267 | Ga0163162_108002672 | 122 |
| 524 | 3300013306 | Ga0163162_10814133 | Ga0163162_108141332 | 122 |
| 525 | 3300013308 | Ga0157375_10138437 | Ga0157375_101384373 | 122 |
| 526 | 3300013308 | Ga0157375_10262065 | Ga0157375_102620652 | 122 |
| 527 | 3300013308 | Ga0157375_10291180 | Ga0157375_102911803 | 122 |
| 528 | 3300014325 | Ga0163163_10277423 | Ga0163163_102774232 | 122 |
| 529 | 3300014325 | Ga0163163_10486663 | Ga0163163_104866632 | 122 |
| 530 | 3300014325 | Ga0163163_10541370 | Ga0163163_105413702 | 122 |
| 531 | 3300014325 | Ga0163163_10561257 | Ga0163163_105612572 | 122 |
| 532 | 3300014325 | Ga0163163_10961725 | Ga0163163_109617252 | 122 |
| 533 | 3300014325 | Ga0163163_11424862 | Ga0163163_114248622 | 122 |
| 534 | 3300014326 | Ga0157380_10627038 | Ga0157380_106270381 | 122 |
| 535 | 3300014326 | Ga0157380_10662032 | Ga0157380_106620322 | 122 |
| 536 | 3300014497 | Ga0182008_10262034 | Ga0182008_102620342 | 122 |
| 537 | 3300014745 | Ga0157377_10063184 | Ga0157377_100631842 | 122 |
| 538 | 3300014745 | Ga0157377_11070178 | Ga0157377_110701781 | 122 |
| 539 | 3300014969 | Ga0157376_11133679 | Ga0157376_111336792 | 122 |
| 540 | 3300014969 | Ga0157376_11436643 | Ga0157376_114366432 | 122 |
| 541 | 3300017792 | Ga0163161_10391681 | Ga0163161_103916811 | 122 |
| 542 | 3300020069 | Ga0197907_10462210 | Ga0197907_104622102 | 122 |
| 543 | 3300020081 | Ga0206354_11300942 | Ga0206354_113009423 | 122 |
| 544 | 3300020082 | Ga0206353_10100621 | Ga0206353_101006213 | 122 |
| 545 | 3300020082 | Ga0206353_10237056 | Ga0206353_102370562 | 122 |
| 546 | 3300021388 | Ga0213875_10000104 | Ga0213875_1000010416 | 122 |
| 547 | 3300022467 | Ga0224712_10104518 | Ga0224712_101045182 | 122 |
| 548 | 3300025321 | Ga0207656_10025425 | Ga0207656_100254252 | 122 |
| 549 | 3300025898 | Ga0207692_10001780 | Ga0207692_100017803 | 122 |
| 550 | 3300025898 | Ga0207692_10271138 | Ga0207692_102711382 | 122 |
| 551 | 3300025900 | Ga0207710_10274048 | Ga0207710_102740481 | 122 |
| 552 | 3300025901 | Ga0207688_10013216 | Ga0207688_100132163 | 122 |
| 553 | 3300025903 | Ga0207680_10290077 | Ga0207680_102900771 | 122 |
| 554 | 3300025903 | Ga0207680_10292423 | Ga0207680_102924232 | 122 |
| 555 | 3300025904 | Ga0207647_10057082 | Ga0207647_100570822 | 122 |
| 556 | 3300025905 | Ga0207685_10008461 | Ga0207685_100084615 | 122 |
| 557 | 3300025906 | Ga0207699_10017496 | Ga0207699_100174962 | 122 |
| 558 | 3300025906 | Ga0207699_10252090 | Ga0207699_102520902 | 122 |
| 559 | 3300025906 | Ga0207699_10373324 | Ga0207699_103733242 | 122 |
| 560 | 3300025907 | Ga0207645_10303888 | Ga0207645_103038882 | 122 |
| 561 | 3300025908 | Ga0207643_10000196 | Ga0207643_100001962 | 122 |
| 562 | 3300025909 | Ga0207705_10229386 | Ga0207705_102293862 | 122 |
| 563 | 3300025910 | Ga0207684_10377861 | Ga0207684_103778611 | 122 |
| 564 | 3300025911 | Ga0207654_10017240 | Ga0207654_100172402 | 122 |
| 565 | 3300025912 | Ga0207707_10036983 | Ga0207707_100369835 | 122 |
| 566 | 3300025914 | Ga0207671_10173318 | Ga0207671_101733183 | 122 |
| 567 | 3300025915 | Ga0207693_10657585 | Ga0207693_106575851 | 122 |
| 568 | 3300025917 | Ga0207660_10741866 | Ga0207660_107418662 | 122 |
| 569 | 3300025918 | Ga0207662_11333249 | Ga0207662_113332492 | 122 |
| 570 | 3300025919 | Ga0207657_10051547 | Ga0207657_100515473 | 122 |
| 571 | 3300025920 | Ga0207649_10206430 | Ga0207649_102064302 | 122 |
| 572 | 3300025921 | Ga0207652_10309723 | Ga0207652_103097233 | 122 |
| 573 | 3300025922 | Ga0207646_10174644 | Ga0207646_101746443 | 122 |
| 574 | 3300025922 | Ga0207646_10182493 | Ga0207646_101824932 | 122 |
| 575 | 3300025925 | Ga0207650_10015635 | Ga0207650_100156352 | 122 |
| 576 | 3300025926 | Ga0207659_10012749 | Ga0207659_100127495 | 122 |
| 577 | 3300025926 | Ga0207659_10497983 | Ga0207659_104979832 | 122 |
| 578 | 3300025926 | Ga0207659_10847512 | Ga0207659_108475122 | 122 |
| 579 | 3300025927 | Ga0207687_10172821 | Ga0207687_101728213 | 122 |
| 580 | 3300025927 | Ga0207687_10258370 | Ga0207687_102583702 | 122 |
| 581 | 3300025928 | Ga0207700_10001069 | Ga0207700_100010693 | 122 |
| 582 | 3300025929 | Ga0207664_10417760 | Ga0207664_104177602 | 122 |
| 583 | 3300025931 | Ga0207644_10013239 | Ga0207644_100132393 | 122 |
| 584 | 3300025932 | Ga0207690_10374532 | Ga0207690_103745322 | 122 |
| 585 | 3300025933 | Ga0207706_10171732 | Ga0207706_101717322 | 122 |
| 586 | 3300025934 | Ga0207686_10841877 | Ga0207686_108418772 | 122 |
| 587 | 3300025935 | Ga0207709_10631566 | Ga0207709_106315662 | 122 |
| 588 | 3300025940 | Ga0207691_10154496 | Ga0207691_101544962 | 122 |
| 589 | 3300025940 | Ga0207691_10677181 | Ga0207691_106771812 | 122 |
| 590 | 3300025941 | Ga0207711_10697514 | Ga0207711_106975142 | 122 |
| 591 | 3300025942 | Ga0207689_10001658 | Ga0207689_100016584 | 122 |
| 592 | 3300025942 | Ga0207689_10666031 | Ga0207689_106660311 | 122 |
| 593 | 3300025942 | Ga0207689_11676632 | Ga0207689_116766321 | 122 |
| 594 | 3300025944 | Ga0207661_10019838 | Ga0207661_100198383 | 122 |
| 595 | 3300025944 | Ga0207661_10328861 | Ga0207661_103288613 | 122 |
| 596 | 3300025944 | Ga0207661_10882785 | Ga0207661_108827852 | 122 |
| 597 | 3300025945 | Ga0207679_10004949 | Ga0207679_100049492 | 122 |
| 598 | 3300025945 | Ga0207679_10533408 | Ga0207679_105334082 | 122 |
| 599 | 3300025949 | Ga0207667_10302014 | Ga0207667_103020142 | 122 |
| 600 | 3300025960 | Ga0207651_10490902 | Ga0207651_104909022 | 122 |
| 601 | 3300025961 | Ga0207712_10147227 | Ga0207712_101472273 | 122 |
| 602 | 3300025972 | Ga0207668_11835155 | Ga0207668_118351552 | 122 |
| 603 | 3300025981 | Ga0207640_10164234 | Ga0207640_101642343 | 122 |
| 604 | 3300026023 | Ga0207677_10144765 | Ga0207677_101447652 | 122 |
| 605 | 3300026023 | Ga0207677_10412372 | Ga0207677_104123722 | 122 |
| 606 | 3300026023 | Ga0207677_11586313 | Ga0207677_115863132 | 122 |
| 607 | 3300026035 | Ga0207703_10105533 | Ga0207703_101055333 | 122 |
| 608 | 3300026041 | Ga0207639_11619761 | Ga0207639_116197611 | 122 |
| 609 | 3300026067 | Ga0207678_10000794 | Ga0207678_1000079415 | 122 |
| 610 | 3300026075 | Ga0207708_10012630 | Ga0207708_100126305 | 122 |
| 611 | 3300026078 | Ga0207702_10020495 | Ga0207702_100204955 | 122 |
| 612 | 3300026088 | Ga0207641_10511129 | Ga0207641_105111292 | 122 |
| 613 | 3300026095 | Ga0207676_10000651 | Ga0207676_1000065122 | 122 |
| 614 | 3300026095 | Ga0207676_10622093 | Ga0207676_106220932 | 122 |
| 615 | 3300026095 | Ga0207676_11211410 | Ga0207676_112114102 | 122 |
| 616 | 3300026121 | Ga0207683_10010407 | Ga0207683_100104076 | 122 |
| 617 | 3300026121 | Ga0207683_10029666 | Ga0207683_100296667 | 122 |
| 618 | 3300026142 | Ga0207698_10009693 | Ga0207698_100096935 | 122 |
| 619 | 3300027907 | Ga0207428_10037356 | Ga0207428_100373563 | 122 |
| 620 | 3300028379 | Ga0268266_10430738 | Ga0268266_104307382 | 122 |
| 621 | 3300028380 | Ga0268265_10629585 | Ga0268265_106295852 | 122 |
| 622 | 3300028381 | Ga0268264_10056594 | Ga0268264_100565943 | 122 |
| 623 | 3300035086 | Ga0373934_0000161 | Ga0373934_0000161_9763_10131 | 122 |
| 624 | 3300035111 | Ga0373923_0017856 | Ga0373923_0017856_231_599 | 122 |
| 625 | 3300035113 | Ga0373936_0008494 | Ga0373936_0008494_1084_1491 | 122 |
| 626 | 3300035113 | Ga0373936_0431587 | Ga0373936_0431587_74_442 | 122 |
| 627 | 3300035115 | Ga0373941_0426801 | Ga0373941_0426801_66_458 | 122 |
| 628 | 3300035117 | Ga0373953_0000035 | Ga0373953_0000035_5247_5615 | 122 |
| 629 | 3300035118 | Ga0373954_0006506 | Ga0373954_0006506_3047_3415 | 122 |
| 630 | 3300035118 | Ga0373954_0201926 | Ga0373954_0201926_11_418 | 122 |
| 631 | 3300035119 | Ga0373956_0000318 | Ga0373956_0000318_13087_13455 | 122 |
| 632 | 3300035119 | Ga0373956_0007792 | Ga0373956_0007792_283_690 | 122 |
| 633 | 3300035120 | Ga0373957_0000039 | Ga0373957_0000039_30434_30802 | 122 |
| 634 | 3300035170 | Ga0373943_0026256 | Ga0373943_0026256_2225_2632 | 122 |
| 635 | 3300035171 | Ga0373946_0083161 | Ga0373946_0083161_831_1238 | 122 |
| 636 | 3300035172 | Ga0373955_0000124 | Ga0373955_0000124_2140_2508 | 122 |
| 637 | 3300035410 | Ga0373924_0000479 | Ga0373924_0000479_8341_8709 | 122 |
| 638 | 3300035410 | Ga0373924_0035869 | Ga0373924_0035869_379_786 | 122 |
| 639 | 3300035691 | Ga0373931_0069736 | Ga0373931_0069736_1258_1626 | 122 |
| 640 | 3300035692 | Ga0373935_0168854 | Ga0373935_0168854_114_521 | 122 |
| 641 | 3300035692 | Ga0373935_0433572 | Ga0373935_0433572_488_865 | 122 |
| 642 | 3300035695 | Ga0373927_0064620 | Ga0373927_0064620_1691_2098 | 122 |
| 643 | 3300035724 | Ga0373933_0000069 | Ga0373933_0000069_34381_34749 | 122 |
| 644 | 3300035724 | Ga0373933_0023254 | Ga0373933_0023254_2876_3283 | 122 |
| 645 | 3300035725 | Ga0373947_1160396 | Ga0373947_1160396_44_421 | 122 |
| 646 | 3300036401 | Ga0373937_0000168 | Ga0373937_0000168_35065_35433 | 122 |
| 647 | 3300036401 | Ga0373937_0324361 | Ga0373937_0324361_367_735 | 122 |
| 648 | 3300037068 | Ga0373925_0002965 | Ga0373925_0002965_9336_9719 | 122 |
| 649 | 3300037853 | Ga0436364_0153646 | Ga0436364_0153646_29_415 | 122 |
| 650 | 3300037853 | Ga0436364_1079797 | Ga0436364_1079797_348_734 | 122 |
| 651 | 3300037853 | Ga0436364_1497153 | Ga0436364_1497153_52998_53381 | 122 |
| 652 | 3300039437 | Ga0436365_1931865 | Ga0436365_1931865_1248_1631 | 122 |
| 653 | 3300039453 | Ga0436362_0768964 | Ga0436362_0768964_89_466 | 122 |
| 654 | 3300041507 | Ga0451851_1363798 | Ga0451851_1363798_127_510 | 122 |
| 655 | 3300042012 | Ga0439455_0221766 | Ga0439455_0221766_160_528 | 122 |
| 656 | 3300042016 | Ga0439463_104456 | Ga0439463_104456_264_632 | 122 |
| 657 | 3300042157 | Ga0439458_0049023 | Ga0439458_0049023_93_461 | 122 |
| 658 | 3300042438 | Ga0439459_0002078 | Ga0439459_0002078_326_694 | 122 |
| 659 | 3300044684 | Ga0466966_0085686 | Ga0466966_0085686_1300_1677 | 122 |
| 660 | 3300044693 | Ga0466961_0164307 | Ga0466961_0164307_195_572 | 122 |
| 661 | 3300045049 | Ga0466959_0071971 | Ga0466959_0071971_2105_2482 | 122 |
| 662 | 3300045976 | Ga0466967_0256960 | Ga0466967_0256960_390_812 | 122 |
| 663 | 3300046454 | Ga0495592_0000144 | Ga0495592_0000144_28235_28603 | 122 |
| 664 | 3300046455 | Ga0495603_0238032 | Ga0495603_0238032_122_505 | 122 |
| 665 | 3300046455 | Ga0495603_0515673 | Ga0495603_0515673_266_649 | 122 |
| 666 | 3300046459 | Ga0495629_0016555 | Ga0495629_0016555_1895_2302 | 122 |
| 667 | 3300046462 | Ga0495651_0000100 | Ga0495651_0000100_28235_28603 | 122 |
| 668 | 3300046463 | Ga0495653_0000436 | Ga0495653_0000436_7468_7836 | 122 |
| 669 | 3300046463 | Ga0495653_0043967 | Ga0495653_0043967_34_441 | 122 |
| 670 | 3300046472 | Ga0495580_0068952 | Ga0495580_0068952_28_435 | 122 |
| 671 | 3300046475 | Ga0495639_0042213 | Ga0495639_0042213_1267_1674 | 122 |
| 672 | 3300046477 | Ga0495664_0070271 | Ga0495664_0070271_963_1361 | 122 |
| 673 | 3300046511 | Ga0495608_0000093 | Ga0495608_0000093_56194_56562 | 122 |
| 674 | 3300046511 | Ga0495608_0009607 | Ga0495608_0009607_776_1183 | 122 |
| 675 | 3300046516 | Ga0495628_0000308 | Ga0495628_0000308_29913_30281 | 122 |
| 676 | 3300046516 | Ga0495628_0725202 | Ga0495628_0725202_29_427 | 122 |
| 677 | 3300046517 | Ga0495630_0028951 | Ga0495630_0028951_3396_3803 | 122 |
| 678 | 3300046517 | Ga0495630_0176284 | Ga0495630_0176284_943_1326 | 122 |
| 679 | 3300046523 | Ga0495644_0163044 | Ga0495644_0163044_348_728 | 122 |
| 680 | 3300046526 | Ga0495666_0466604 | Ga0495666_0466604_66_449 | 122 |
| 681 | 3300046529 | Ga0495652_0000126 | Ga0495652_0000126_55720_56088 | 122 |
| 682 | 3300046529 | Ga0495652_0092705 | Ga0495652_0092705_302_709 | 122 |
| 683 | 3300046531 | Ga0495665_0076751 | Ga0495665_0076751_663_1070 | 122 |
| 684 | 3300046536 | Ga0495587_0000104 | Ga0495587_0000104_28235_28603 | 122 |
| 685 | 3300046536 | Ga0495587_0017950 | Ga0495587_0017950_1013_1420 | 122 |
| 686 | 3300046543 | Ga0495645_0111347 | Ga0495645_0111347_191_589 | 122 |
| 687 | 3300046559 | Ga0495667_0000097 | Ga0495667_0000097_34381_34749 | 122 |
| 688 | 3300046642 | Ga0495634_0150733 | Ga0495634_0150733_223_606 | 122 |
| 689 | 3300046674 | Ga0495588_0187321 | Ga0495588_0187321_637_1020 | 122 |
| 690 | 3300046675 | Ga0495657_0000325 | Ga0495657_0000325_7648_8016 | 122 |
| 691 | 3300046675 | Ga0495657_0022596 | Ga0495657_0022596_11_418 | 122 |
| 692 | 3300046678 | Ga0495599_0000214 | Ga0495599_0000214_13287_13655 | 122 |
| 693 | 3300046678 | Ga0495599_0310325 | Ga0495599_0310325_304_702 | 122 |
| 694 | 3300046679 | Ga0495623_0000090 | Ga0495623_0000090_28222_28590 | 122 |
| 695 | 3300046680 | Ga0495646_0032866 | Ga0495646_0032866_2642_3049 | 122 |
| 696 | 3300046680 | Ga0495646_0266648 | Ga0495646_0266648_401_769 | 122 |
| 697 | 3300046681 | Ga0495647_0144672 | Ga0495647_0144672_52_459 | 122 |
| 698 | 3300046689 | Ga0495613_0532616 | Ga0495613_0532616_345_728 | 122 |
| 699 | 3300046690 | Ga0495624_0072175 | Ga0495624_0072175_616_1023 | 122 |
| 700 | 3300046690 | Ga0495624_0327526 | Ga0495624_0327526_104_481 | 122 |
| 701 | 3300046694 | Ga0495649_0248720 | Ga0495649_0248720_384_755 | 122 |
| 702 | 3300046809 | Ga0495600_0010254 | Ga0495600_0010254_1388_1756 | 122 |
| 703 | 3300046809 | Ga0495600_0106319 | Ga0495600_0106319_537_944 | 122 |
| 704 | 3300047315 | Ga0495581_0025904 | Ga0495581_0025904_234_641 | 122 |
| 705 | 3300047317 | Ga0495604_0000135 | Ga0495604_0000135_34381_34749 | 122 |
| 706 | 3300047317 | Ga0495604_0026803 | Ga0495604_0026803_3557_3964 | 122 |
| 707 | 3300047320 | Ga0495672_0353707 | Ga0495672_0353707_246_617 | 122 |
| 708 | 3300047321 | Ga0495676_0243463 | Ga0495676_0243463_513_920 | 122 |
| 709 | 3300047322 | Ga0495680_0000156 | Ga0495680_0000156_34659_35027 | 122 |
| 710 | 3300047322 | Ga0495680_0030252 | Ga0495680_0030252_2044_2451 | 122 |
| 711 | 3300047444 | Ga0495675_0000102 | Ga0495675_0000102_55974_56342 | 122 |
| 712 | 3300047444 | Ga0495675_0039238 | Ga0495675_0039238_500_907 | 122 |
| 713 | 3300047471 | Ga0495684_0137566 | Ga0495684_0137566_1192_1599 | 122 |
| 714 | 3300048088 | Ga0495602_0005662 | Ga0495602_0005662_451_819 | 122 |
| 715 | 3300048088 | Ga0495602_0010831 | Ga0495602_0010831_6580_6987 | 122 |
| 716 | 3300048089 | Ga0495614_0086249 | Ga0495614_0086249_407_814 | 122 |
| 717 | 3300048903 | Ga0496100_0111409 | Ga0496100_0111409_1440_1808 | 122 |
| 718 | 3300048904 | Ga0496101_0197182 | Ga0496101_0197182_882_1250 | 122 |
| 719 | 3300048904 | Ga0496101_1029557 | Ga0496101_1029557_222_605 | 122 |
| 720 | 3300048904 | Ga0496101_1119315 | Ga0496101_1119315_16_384 | 122 |
| 721 | 3300048907 | Ga0496104_0030892 | Ga0496104_0030892_381_749 | 122 |
| 722 | 3300048907 | Ga0496104_0033506 | Ga0496104_0033506_316_699 | 122 |
| 723 | 3300048908 | Ga0496105_0021444 | Ga0496105_0021444_3381_3749 | 122 |
| 724 | 3300048908 | Ga0496105_1099946 | Ga0496105_1099946_34_417 | 122 |
| 725 | 3300048909 | Ga0496106_0086654 | Ga0496106_0086654_1341_1709 | 122 |
| 726 | 3300048909 | Ga0496106_0611718 | Ga0496106_0611718_445_813 | 122 |
| 727 | 3300048909 | Ga0496106_1044624 | Ga0496106_1044624_181_564 | 122 |
| 728 | 3300048910 | Ga0496107_0611012 | Ga0496107_0611012_133_501 | 122 |
| 729 | 3300048911 | Ga0496108_0136338 | Ga0496108_0136338_554_958 | 122 |
| 730 | 3300048911 | Ga0496108_0166408 | Ga0496108_0166408_678_1046 | 122 |
| 731 | 3300048911 | Ga0496108_0219703 | Ga0496108_0219703_655_1038 | 122 |
| 732 | 3300048911 | Ga0496108_0293786 | Ga0496108_0293786_561_944 | 122 |
| 733 | 3300048911 | Ga0496108_0297186 | Ga0496108_0297186_621_1004 | 122 |
| 734 | 3300048912 | Ga0496109_0057455 | Ga0496109_0057455_1148_1531 | 122 |
| 735 | 3300048912 | Ga0496109_0077768 | Ga0496109_0077768_128_496 | 122 |
| 736 | 3300048912 | Ga0496109_0138011 | Ga0496109_0138011_257_640 | 122 |
| 737 | 3300048912 | Ga0496109_0295637 | Ga0496109_0295637_281_664 | 122 |
| 738 | 3300048912 | Ga0496109_0727120 | Ga0496109_0727120_93_476 | 122 |
| 739 | 3300048912 | Ga0496109_1254922 | Ga0496109_1254922_74_451 | 122 |
| 740 | 3300048913 | Ga0496110_0124840 | Ga0496110_0124840_683_1066 | 122 |
| 741 | 3300048913 | Ga0496110_0293254 | Ga0496110_0293254_434_802 | 122 |
| 742 | 3300048913 | Ga0496110_1005325 | Ga0496110_1005325_288_671 | 122 |
| 743 | 3300048914 | Ga0496111_0170329 | Ga0496111_0170329_1200_1583 | 122 |
| 744 | 3300048914 | Ga0496111_0266597 | Ga0496111_0266597_381_749 | 122 |
| 745 | 3300048914 | Ga0496111_0807125 | Ga0496111_0807125_117_494 | 122 |
| 746 | 3300048915 | Ga0496112_0059896 | Ga0496112_0059896_2957_3325 | 122 |
| 747 | 3300048915 | Ga0496112_0150354 | Ga0496112_0150354_401_784 | 122 |
| 748 | 3300048915 | Ga0496112_0330872 | Ga0496112_0330872_827_1210 | 122 |
| 749 | 3300048915 | Ga0496112_0345562 | Ga0496112_0345562_337_720 | 122 |
| 750 | 3300048915 | Ga0496112_1327847 | Ga0496112_1327847_221_589 | 122 |
| 751 | 3300048916 | Ga0496113_0029533 | Ga0496113_0029533_1320_1703 | 122 |
| 752 | 3300048916 | Ga0496113_0045489 | Ga0496113_0045489_2708_3091 | 122 |
| 753 | 3300048916 | Ga0496113_0052594 | Ga0496113_0052594_2459_2842 | 122 |
| 754 | 3300048916 | Ga0496113_0098468 | Ga0496113_0098468_1351_1719 | 122 |
| 755 | 3300048916 | Ga0496113_0893121 | Ga0496113_0893121_20_397 | 122 |
| 756 | 3300048917 | Ga0496114_0031385 | Ga0496114_0031385_464_832 | 122 |
| 757 | 3300048917 | Ga0496114_0521928 | Ga0496114_0521928_583_966 | 122 |
| 758 | 3300048917 | Ga0496114_0573201 | Ga0496114_0573201_133_516 | 122 |
| 759 | 3300048917 | Ga0496114_1224364 | Ga0496114_1224364_194_577 | 122 |
| 760 | 3300048917 | Ga0496114_1262293 | Ga0496114_1262293_189_557 | 122 |
| 761 | 3300048918 | Ga0496115_0034857 | Ga0496115_0034857_2816_3184 | 122 |
| 762 | 3300050507 | nmdc:mga05p37_839899_c1 | nmdc:mga05p37_839899_c1_459_827 | 122 |
| 763 | 3300050508 | nmdc:mga09592_626685_c1 | nmdc:mga09592_626685_c1_44_412 | 122 |
| 764 | 3300050511 | nmdc:mga08y16_168979_c1 | nmdc:mga08y16_168979_c1_1479_1847 | 122 |
| 765 | 3300050512 | nmdc:mga0n895_10213_c1 | nmdc:mga0n895_10213_c1_7478_7846 | 122 |
| 766 | 3300050513 | nmdc:mga0rr50_2398_c1 | nmdc:mga0rr50_2398_c1_4266_4634 | 122 |
| 767 | 3300050513 | nmdc:mga0rr50_865846_c1 | nmdc:mga0rr50_865846_c1_68_451 | 122 |
| 768 | 3300050514 | nmdc:mga08x19_16151_c1 | nmdc:mga08x19_16151_c1_876_1244 | 122 |
| 769 | 3300050514 | nmdc:mga08x19_648448_c1 | nmdc:mga08x19_648448_c1_199_579 | 122 |
| 770 | 3300050515 | nmdc:mga0a205_39305_c1 | nmdc:mga0a205_39305_c1_3623_3991 | 122 |
| 771 | 3300053077 | Ga0495601_0035979 | Ga0495601_0035979_2096_2503 | 122 |
| 772 | 3300053084 | Ga0495595_0001660 | Ga0495595_0001660_6912_7280 | 122 |
| 773 | 3300053085 | Ga0495619_0022864 | Ga0495619_0022864_1486_1893 | 122 |
| 774 | 3300053085 | Ga0495619_0576728 | Ga0495619_0576728_352_720 | 122 |
| 775 | 3300059424 | Ga0590075_002138 | Ga0590075_002138_2108_2491 | 122 |
| 776 | 3300059426 | Ga0590077_004008 | Ga0590077_004008_1948_2331 | 122 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9493 | 21 | 78 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9428 | 19 | 77 |
| 2oqg-assembly1.cif.gz_B | arsr-like transcriptional regulator from rhodococcus sp. rha1 | 0.9413 | 7 | 101 |
| 1sfu-assembly1.cif.gz_B | crystal structure of the viral zalpha domain bound to left-handed z-dna | 0.9358 | 33 | 77 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9344 | 24 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9578 | 21 | 76 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9493 | 21 | 78 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9428 | 19 | 77 | 1.10.10.10 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.941 | 23 | 77 | 1.10.10.10 |
| af_P64638_1_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9403 | 21 | 78 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0EXS7-F1-model_v4 | ArsR family transcriptional regulator | 0.9969 | 5 | 100 |
GO:0003700
|
| AF-A0A4R2HTP3-F1-model_v4 | DNA-binding transcriptional ArsR family regulator | 0.9868 | 5 | 100 |
GO:0003677
GO:0003700 |
| AF-A0A366LQW3-F1-model_v4 | Transcriptional regulator | 0.9862 | 2 | 97 |
GO:0003700
|
| AF-A0A6N7FUD8-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.982 | 11 | 100 |
GO:0003700
|
| AF-A0A2W2C315-F1-model_v4 | Transcriptional regulator | 0.9808 | 3 | 101 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar