F480129

General Info

Members Datasets Scaffolds Average Seq Length
772 329 697 263

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0076063|Ga0495597_0076063_115_1002
Length 295
Sequence VTQPNDFLTRPCDRYDQIFPAHPVGAGRTMISPLMLRGVWAYRGFVLGSVKREFQARYANAVLGALWSLLSPLAMILVYTVIFSEVMQSRLPGAESRFAYSIYLCAGILTWGLFAEIVGRAQGMFIEQANLIKKISFPRICLPLIVVLNALVNFAIIFGLFTLFLLATDSFPGWTYFAILPVLVLQVLLAIGVGMIAGVLNVFFRDVGQLVTIALQFWFWFTPIVYPPTILPDNVRPLLAFNPMAQVVGAYQAVLVRGATPHWPSLAPVLALALLLCLFGLRLFRKRSAELVDEL

Samples

Sample ID Description Type Environment
1 2511231007 Pseudomonas sp. GM18 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
4 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
5 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
6 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
7 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
8 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
9 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
10 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
11 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
12 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
13 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
14 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
15 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
16 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
17 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
18 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
19 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
20 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
21 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
22 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
23 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
24 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
25 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
26 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
27 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
28 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
29 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
30 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
31 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
32 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
33 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
34 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
35 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
36 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
37 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
38 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
39 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
40 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
41 2636415599 Klebsiella variicola DX120E Isolate Unclassified
42 2643221556 Massilia sp. Root1485 Isolate Unclassified
43 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
44 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
45 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
46 2643221645 Massilia sp. Root351 Isolate Unclassified
47 2643221664 Massilia sp. Root418 Isolate Unclassified
48 2643221684 Massilia sp. Root133 Isolate Unclassified
49 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
50 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
51 2738541297 Duganella sp. GV083 Isolate Unclassified
52 2738541300 Massilia sp. GV016 Isolate Unclassified
53 2738541357 Duganella sp. GV053 Isolate Unclassified
54 2738543003 Duganella sp. GV066 Isolate Unclassified
55 2738543018 Massilia sp. GV045 Isolate Unclassified
56 2738543026 Duganella sp. GV089 Isolate Unclassified
57 2738543029 Duganella sp. GV039 Isolate Unclassified
58 2738543030 Massilia sp. GV097 Isolate Unclassified
59 2775507074 Klebsiella sp. D5A Isolate Unclassified
60 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
61 2821131069 Duganella sp. 1224 Isolate Unclassified
62 2857558681 Duganella sp. R-74565 Isolate Unclassified
63 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
64 2904424332 Duganella sp. 1411 Isolate Rhizosphere
65 2904504865 Serratia marcescens 1822 Isolate Unclassified
66 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
67 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
68 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
69 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
70 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
71 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
72 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
73 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
74 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
79 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
86 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
181 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
190 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
327 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
328 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
329 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.03
Metatranscriptomes 0.26
Isolates 9.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 4.66
Nodule 0.65
Rhizoplane 7.25
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002119 3300002738 Bacteria 5560
2 JGI25163J39215_1000028 3300002771 Bacteria 67700
3 JGI25164J39214_1000107 3300002772 Bacteria 80489
4 JGI25152J39213_1014295 3300002773 Bacteria 1615
5 JGI25159J45721_1000601 3300002987 Bacteria 16095
6 JGI25165J46597_1000218 3300003214 Bacteria 80489
7 rootH1_10043487 3300003316 Bacteria 1582
8 Ga0055525_1000135 3300003759 Bacteria 108217
9 Ga0055526_1000110 3300003771 Bacteria 72034
10 Ga0055537_1000284 3300003773 Bacteria 36171
11 Ga0055524_1006844 3300003775 Bacteria 4916
12 Ga0055534_1000059 3300003784 Bacteria 84386
13 Ga0055528_1000124 3300003790 Bacteria 61627
14 Ga0055543_1007100 3300004625 Bacteria 2623
15 Ga0065165_1000050 3300005262 Bacteria 195237
16 Ga0065165_1010202 3300005262 Bacteria 4096
17 Ga0070658_10001501 3300005327 Bacteria 19811
18 Ga0070680_100043772 3300005336 Bacteria 3636
19 Ga0070682_100052125 3300005337 Bacteria 2560
20 Ga0070660_100051350 3300005339 Bacteria 3175
21 Ga0070660_100077774 3300005339 Bacteria 2601
22 Ga0070661_100227593 3300005344 Bacteria 1432
23 Ga0070669_100290047 3300005353 Bacteria 1313
24 Ga0070714_100169783 3300005435 Bacteria 1979
25 Ga0070679_100026869 3300005530 Bacteria 5661
26 Ga0070684_100033946 3300005535 Bacteria 4360
27 Ga0068853_100016929 3300005539 Bacteria 6009
28 Ga0068853_100741298 3300005539 Bacteria 938
29 Ga0068855_100006913 3300005563 Bacteria 13759
30 Ga0068855_100134421 3300005563 Bacteria 2822
31 Ga0070664_100044370 3300005564 Bacteria 3754
32 Ga0070664_100213336 3300005564 Bacteria 1725
33 Ga0068854_100140395 3300005578 Bacteria 1853
34 Ga0068852_100106833 3300005616 Bacteria 2538
35 Ga0068861_100031002 3300005719 Bacteria 3923
36 Ga0068851_10009237 3300005834 Bacteria 4578
37 Ga0070717_10094997 3300006028 Bacteria 2523
38 Ga0075362_10030522 3300006177 Bacteria 2328
39 Ga0068871_100610880 3300006358 Bacteria 992
40 Ga0075436_100262641 3300006914 Bacteria 1231
41 Ga0099826_10000003 3300006948 Bacteria 1067817
42 Ga0105251_10001634 3300009011 Bacteria 18983
43 Ga0105251_10042925 3300009011 Bacteria 2192
44 Ga0105251_10076207 3300009011 Bacteria 1556
45 Ga0105244_10004218 3300009036 Bacteria 9992
46 Ga0105244_10006422 3300009036 Bacteria 7611
47 Ga0105244_10007894 3300009036 Bacteria 6709
48 Ga0105244_10009942 3300009036 Bacteria 5800
49 Ga0105250_10001524 3300009092 Bacteria 12492
50 Ga0105250_10002509 3300009092 Bacteria 9199
51 Ga0105240_10089222 3300009093 Bacteria 3771
52 Ga0105240_10393415 3300009093 Bacteria 1563
53 Ga0105245_10052912 3300009098 Bacteria 3643
54 Ga0105243_10001703 3300009148 Bacteria 18949
55 Ga0105241_10009038 3300009174 Bacteria 7329
56 Ga0105241_10343692 3300009174 Bacteria 1294
57 Ga0105238_10055978 3300009551 Bacteria 3957
58 Ga0105239_10071052 3300010375 Bacteria 3824
59 Ga0157373_10005862 3300013100 Bacteria 9191
60 Ga0157371_10000001 3300013102 Bacteria 1162285
61 Ga0157371_10007873 3300013102 Bacteria 8555
62 Ga0157371_10020003 3300013102 Bacteria 4929
63 Ga0157370_10004280 3300013104 Bacteria 16440
64 Ga0157370_10074910 3300013104 Bacteria 3192
65 Ga0157370_10158140 3300013104 Bacteria 2108
66 Ga0157370_10191145 3300013104 Unclassified 1900
67 Ga0157369_10004954 3300013105 Bacteria 15599
68 Ga0157369_10013873 3300013105 Bacteria 9102
69 Ga0157369_10675990 3300013105 Bacteria 1064
70 Ga0163162_10263821 3300013306 Bacteria 1854
71 Ga0157372_10043201 3300013307 Bacteria 4989
72 Ga0157372_10055155 3300013307 Bacteria 4437
73 Ga0157372_10094965 3300013307 Bacteria 3397
74 Ga0157372_10751311 3300013307 Bacteria 1134
75 Ga0157375_10800698 3300013308 Unclassified 1091
76 Ga0182008_10101808 3300014497 Bacteria 1420
77 Ga0182005_1002413 3300015265 Bacteria 6688
78 Ga0182005_1005606 3300015265 Bacteria 3908
79 Ga0213872_10000002 3300021361 Bacteria 554092
80 Ga0213872_10005552 3300021361 Bacteria 6459
81 Ga0213872_10011940 3300021361 Bacteria 4100
82 Ga0209760_100020 3300025207 Bacteria 169879
83 Ga0209436_104856 3300025208 Bacteria 3221
84 Ga0209563_100036 3300025230 Bacteria 448275
85 Ga0207427_100006 3300025231 Bacteria 785415
86 Ga0209437_100013 3300025233 Bacteria 785457
87 Ga0209437_106803 3300025233 Bacteria 1889
88 Ga0209646_1000117 3300025246 Bacteria 150025
89 Ga0209026_1009208 3300025250 Bacteria 1964
90 Ga0209148_1000298 3300025254 Bacteria 72028
91 Ga0209129_1002747 3300025258 Bacteria 8232
92 Ga0209233_1000022 3300025261 Bacteria 785415
93 Ga0209565_1000006 3300025263 Bacteria 897294
94 Ga0209673_1000004 3300025273 Bacteria 896155
95 Ga0209130_1000065 3300025284 Bacteria 195251
96 Ga0209675_1000006 3300025291 Bacteria 732267
97 Ga0209025_1004912 3300025294 Bacteria 11250
98 Ga0209564_1000038 3300025295 Bacteria 414357
99 Ga0209564_1000064 3300025295 Bacteria 316431
100 Ga0209564_1041708 3300025295 Bacteria 1228
101 Ga0209758_1000803 3300025297 Bacteria 44495
102 Ga0209256_1000013 3300025299 Bacteria 689442
103 Ga0209256_1000365 3300025299 Bacteria 72787
104 Ga0207656_10027760 3300025321 Bacteria 2318
105 Ga0207696_1001500 3300025711 Bacteria 12536
106 Ga0207696_1002414 3300025711 Bacteria 9174
107 Ga0207655_1002995 3300025728 Bacteria 12938
108 Ga0207655_1017635 3300025728 Bacteria 3839
109 Ga0207655_1019803 3300025728 Bacteria 3495
110 Ga0207713_1000024 3300025735 Bacteria 339156
111 Ga0207713_1055231 3300025735 Bacteria 1551
112 Ga0207654_10080902 3300025911 Bacteria 1955
113 Ga0207695_10294291 3300025913 Bacteria 1515
114 Ga0207660_10012052 3300025917 Bacteria 5650
115 Ga0207657_10001327 3300025919 Bacteria 26265
116 Ga0207657_10014755 3300025919 Bacteria 7608
117 Ga0207649_10111432 3300025920 Bacteria 1829
118 Ga0207664_10142949 3300025929 Bacteria 2026
119 Ga0207709_10000117 3300025935 Bacteria 122667
120 Ga0207661_10024149 3300025944 Bacteria 4603
121 Ga0207679_10295864 3300025945 Bacteria 1393
122 Ga0207667_10006285 3300025949 Bacteria 14410
123 Ga0207667_10402715 3300025949 Bacteria 1393
124 Ga0207667_10421009 3300025949 Bacteria 1359
125 Ga0207640_10124573 3300025981 Bacteria 1853
126 Ga0207703_10454247 3300026035 Bacteria 1197
127 Ga0207639_10567145 3300026041 Bacteria 1044
128 Ga0207678_10178285 3300026067 Bacteria 1814
129 Ga0207702_10129161 3300026078 Bacteria 2272
130 Ga0207674_10359504 3300026116 Bacteria 1407
131 Ga0207675_100097998 3300026118 Bacteria 2761
132 Ga0209282_1000002 3300027666 Bacteria 1067825
133 Ga0316181_1077120 3300030744 Bacteria 3705
134 Ga0265332_10044632 3300031238 Bacteria 1911
135 Ga0265331_10090732 3300031250 Bacteria 1412
136 Ga0265327_10059110 3300031251 Bacteria 1965
137 Ga0265316_10321435 3300031344 Bacteria 1124
138 Ga0307408_100000461 3300031548 Bacteria 35591
139 Ga0265314_10001032 3300031711 Bacteria 32416
140 Ga0265342_10141992 3300031712 Bacteria 1339
141 Ga0307411_10104209 3300032005 Bacteria 2014
142 Ga0395899_0000141 3300037312 Bacteria 109773
143 Ga0395899_0000962 3300037312 Bacteria 26757
144 Ga0395899_0048791 3300037312 Bacteria 3149
145 Ga0395899_0235813 3300037312 Bacteria 1261
146 Ga0395899_0358560 3300037312 Bacteria 973
147 Ga0395900_0000550 3300037418 Bacteria 52140
148 Ga0395900_0271209 3300037418 Bacteria 1691
149 Ga0395905_0025457 3300037471 Bacteria 5580
150 Ga0395905_0173557 3300037471 Bacteria 2024
151 Ga0395901_0000073 3300038443 Bacteria 139769
152 Ga0400486_23214 3300038742 Bacteria 2857
153 Ga0400489_53656 3300039093 Bacteria 48451
154 Ga0436361_0154055 3300039447 Bacteria 57887
155 Ga0436361_0584108 3300039447 Bacteria 4087
156 Ga0436361_1009709 3300039447 Bacteria 25382
157 Ga0436361_1165509 3300039447 Bacteria 12217
158 Ga0439438_000002 3300041405 Bacteria 618223
159 Ga0439438_001771 3300041405 Bacteria 9486
160 Ga0439447_000704 3300041407 Bacteria 12370
161 Ga0439466_0000001 3300041411 Bacteria 647258
162 Ga0439466_0000913 3300041411 Bacteria 11266
163 Ga0439432_000295 3300042006 Bacteria 17930
164 Ga0439451_002484 3300042009 Bacteria 3738
165 Ga0439452_001060 3300042010 Bacteria 12146
166 Ga0439452_009893 3300042010 Bacteria 2794
167 Ga0439456_000306 3300042013 Bacteria 11480
168 Ga0439456_012038 3300042013 Bacteria 1793
169 Ga0450907_021497 3300042146 Bacteria 1085
170 Ga0439434_0000037 3300042435 Bacteria 32174
171 Ga0439460_0001533 3300042461 Bacteria 5432
172 Ga0466972_0000029 3300044658 Bacteria 165236
173 Ga0466972_0007618 3300044658 Bacteria 5433
174 Ga0453683_0001365 3300044673 Bacteria 21310
175 Ga0453683_0014203 3300044673 Bacteria 5176
176 Ga0466965_0000599 3300044683 Bacteria 13144
177 Ga0466965_0037202 3300044683 Bacteria 2389
178 Ga0466966_0001041 3300044684 Bacteria 17743
179 Ga0466966_0011708 3300044684 Bacteria 5815
180 Ga0466961_0003208 3300044693 Bacteria 10177
181 Ga0466961_0048871 3300044693 Bacteria 2704
182 Ga0466961_0181121 3300044693 Bacteria 1308
183 Ga0466964_0003420 3300044706 Bacteria 5789
184 Ga0466964_0009814 3300044706 Bacteria 3607
185 Ga0466964_0046403 3300044706 Bacteria 1771
186 Ga0466971_0005347 3300044719 Bacteria 5567
187 Ga0466968_0002143 3300044735 Bacteria 7194
188 Ga0466970_0000701 3300044765 Bacteria 16371
189 Ga0466970_0004144 3300044765 Bacteria 7131
190 Ga0466970_0217674 3300044765 Bacteria 1065
191 Ga0466970_0313579 3300044765 Bacteria 886
192 Ga0466957_0000386 3300044842 Bacteria 21569
193 Ga0466957_0007223 3300044842 Bacteria 6277
194 Ga0466957_0300242 3300044842 Bacteria 1079
195 Ga0466959_0002124 3300045049 Bacteria 12544
196 Ga0466959_0021570 3300045049 Bacteria 4753
197 Ga0466959_0063627 3300045049 Bacteria 2678
198 Ga0466959_0076389 3300045049 Bacteria 2418
199 Ga0451576_0003730 3300045051 Bacteria 20605
200 Ga0451576_0081461 3300045051 Bacteria 3366
201 Ga0495617_000007 3300046452 Bacteria 369986
202 Ga0495617_000138 3300046452 Bacteria 48070
203 Ga0495617_000433 3300046452 Bacteria 22580
204 Ga0495617_105191 3300046452 Bacteria 915
205 Ga0495627_000174 3300046453 Bacteria 72709
206 Ga0495627_001312 3300046453 Bacteria 15164
207 Ga0495627_011935 3300046453 Bacteria 3096
208 Ga0495603_0012022 3300046455 Bacteria 5240
209 Ga0495590_0000004 3300046457 Bacteria 402091
210 Ga0495590_0000007 3300046457 Bacteria 331108
211 Ga0495590_0000287 3300046457 Bacteria 27199
212 Ga0495590_0004196 3300046457 Bacteria 5828
213 Ga0495591_000039 3300046458 Bacteria 156460
214 Ga0495591_000310 3300046458 Bacteria 44305
215 Ga0495629_0004670 3300046459 Bacteria 10260
216 Ga0495629_0017142 3300046459 Bacteria 5195
217 Ga0495638_0000023 3300046460 Bacteria 363063
218 Ga0495638_0010460 3300046460 Bacteria 6436
219 Ga0495638_0045065 3300046460 Bacteria 2776
220 Ga0495638_0048659 3300046460 Bacteria 2653
221 Ga0495638_0066732 3300046460 Bacteria 2211
222 Ga0495653_0008794 3300046463 Bacteria 8271
223 Ga0495653_0085772 3300046463 Bacteria 2315
224 Ga0495653_0159421 3300046463 Bacteria 1567
225 Ga0495650_0000154 3300046471 Bacteria 156130
226 Ga0495650_0000320 3300046471 Bacteria 85951
227 Ga0495650_0001964 3300046471 Bacteria 18158
228 Ga0495650_0077965 3300046471 Bacteria 1284
229 Ga0495580_0183491 3300046472 Bacteria 1444
230 Ga0495580_0192523 3300046472 Bacteria 1406
231 Ga0495582_0003493 3300046473 Bacteria 8853
232 Ga0495582_0025219 3300046473 Bacteria 3257
233 Ga0495582_0117379 3300046473 Bacteria 1497
234 Ga0495605_0000133 3300046474 Bacteria 97036
235 Ga0495605_0000169 3300046474 Bacteria 82458
236 Ga0495605_0020011 3300046474 Bacteria 3561
237 Ga0495605_0046434 3300046474 Bacteria 2135
238 Ga0495605_0055141 3300046474 Bacteria 1921
239 Ga0495639_0087431 3300046475 Bacteria 1459
240 Ga0495584_0000010 3300046491 Bacteria 225095
241 Ga0495584_0000678 3300046491 Bacteria 22636
242 Ga0495584_0001011 3300046491 Bacteria 17554
243 Ga0495584_0001901 3300046491 Bacteria 12038
244 Ga0495584_0009175 3300046491 Bacteria 5100
245 Ga0495584_0044712 3300046491 Bacteria 2234
246 Ga0495584_0062617 3300046491 Bacteria 1869
247 Ga0495584_0075250 3300046491 Bacteria 1697
248 Ga0495584_0138493 3300046491 Bacteria 1235
249 Ga0495584_0212819 3300046491 Bacteria 982
250 Ga0495585_0000004 3300046492 Bacteria 348260
251 Ga0495585_0000451 3300046492 Bacteria 39252
252 Ga0495585_0000935 3300046492 Bacteria 24635
253 Ga0495585_0001097 3300046492 Bacteria 22286
254 Ga0495585_0001154 3300046492 Bacteria 21551
255 Ga0495585_0001166 3300046492 Bacteria 21382
256 Ga0495585_0001278 3300046492 Bacteria 20114
257 Ga0495585_0003335 3300046492 Bacteria 10895
258 Ga0495585_0024506 3300046492 Bacteria 3459
259 Ga0495585_0046425 3300046492 Bacteria 2422
260 Ga0495585_0047395 3300046492 Bacteria 2393
261 Ga0495585_0063889 3300046492 Bacteria 2019
262 Ga0495585_0102595 3300046492 Bacteria 1528
263 Ga0495585_0130479 3300046492 Bacteria 1323
264 Ga0495585_0283387 3300046492 Bacteria 818
265 Ga0495594_0007839 3300046499 Bacteria 5491
266 Ga0495594_0020081 3300046499 Bacteria 3557
267 Ga0495596_0000608 3300046500 Bacteria 22479
268 Ga0495596_0000617 3300046500 Bacteria 22347
269 Ga0495596_0001806 3300046500 Bacteria 11900
270 Ga0495596_0004514 3300046500 Bacteria 6766
271 Ga0495596_0006947 3300046500 Bacteria 5153
272 Ga0495596_0010807 3300046500 Bacteria 3961
273 Ga0495596_0011029 3300046500 Bacteria 3912
274 Ga0495596_0060511 3300046500 Bacteria 1475
275 Ga0495607_0000261 3300046501 Bacteria 56378
276 Ga0495607_0001157 3300046501 Bacteria 23898
277 Ga0495607_0002475 3300046501 Bacteria 14990
278 Ga0495607_0007573 3300046501 Bacteria 7493
279 Ga0495607_0018160 3300046501 Bacteria 4490
280 Ga0495607_0032895 3300046501 Bacteria 3159
281 Ga0495607_0033200 3300046501 Bacteria 3141
282 Ga0495607_0179741 3300046501 Bacteria 1061
283 Ga0495583_0000084 3300046506 Bacteria 165375
284 Ga0495583_0001335 3300046506 Bacteria 25594
285 Ga0495583_0001776 3300046506 Bacteria 20548
286 Ga0495583_0002955 3300046506 Bacteria 13660
287 Ga0495583_0003212 3300046506 Bacteria 12790
288 Ga0495583_0005922 3300046506 Bacteria 8122
289 Ga0495583_0031730 3300046506 Bacteria 2557
290 Ga0495583_0045571 3300046506 Bacteria 2027
291 Ga0495583_0051211 3300046506 Bacteria 1883
292 Ga0495583_0115797 3300046506 Bacteria 1132
293 Ga0495583_0124301 3300046506 Bacteria 1083
294 Ga0495606_0000037 3300046507 Bacteria 231282
295 Ga0495606_0000402 3300046507 Bacteria 73035
296 Ga0495606_0000533 3300046507 Bacteria 61375
297 Ga0495606_0000576 3300046507 Bacteria 58266
298 Ga0495606_0000982 3300046507 Bacteria 41525
299 Ga0495606_0002384 3300046507 Bacteria 22041
300 Ga0495606_0002810 3300046507 Bacteria 19380
301 Ga0495606_0003445 3300046507 Bacteria 16787
302 Ga0495606_0009074 3300046507 Bacteria 8480
303 Ga0495606_0012562 3300046507 Bacteria 6780
304 Ga0495606_0019010 3300046507 Bacteria 5131
305 Ga0495606_0039354 3300046507 Bacteria 3188
306 Ga0495606_0050693 3300046507 Bacteria 2713
307 Ga0495606_0052508 3300046507 Bacteria 2650
308 Ga0495606_0055725 3300046507 Bacteria 2555
309 Ga0495606_0128971 3300046507 Bacteria 1505
310 Ga0495606_0148232 3300046507 Bacteria 1379
311 Ga0495606_0216569 3300046507 Bacteria 1081
312 Ga0495606_0224489 3300046507 Bacteria 1056
313 Ga0495610_0000004 3300046512 Bacteria 1006135
314 Ga0495610_0000128 3300046512 Bacteria 83166
315 Ga0495610_0000428 3300046512 Bacteria 43253
316 Ga0495610_0001171 3300046512 Bacteria 23803
317 Ga0495610_0005473 3300046512 Bacteria 9016
318 Ga0495610_0021762 3300046512 Bacteria 3520
319 Ga0495610_0024589 3300046512 Bacteria 3247
320 Ga0495616_0000269 3300046513 Bacteria 42108
321 Ga0495616_0000344 3300046513 Bacteria 36907
322 Ga0495616_0001060 3300046513 Bacteria 19653
323 Ga0495616_0001272 3300046513 Bacteria 17715
324 Ga0495616_0001627 3300046513 Bacteria 15387
325 Ga0495616_0002122 3300046513 Bacteria 13291
326 Ga0495616_0012422 3300046513 Bacteria 4836
327 Ga0495616_0014231 3300046513 Bacteria 4462
328 Ga0495616_0019934 3300046513 Bacteria 3653
329 Ga0495616_0028294 3300046513 Bacteria 2968
330 Ga0495616_0034553 3300046513 Bacteria 2625
331 Ga0495616_0048310 3300046513 Bacteria 2139
332 Ga0495616_0069156 3300046513 Bacteria 1713
333 Ga0495616_0079823 3300046513 Bacteria 1567
334 Ga0495620_0025247 3300046515 Bacteria 2814
335 Ga0495630_0258890 3300046517 Bacteria 1329
336 Ga0495631_0000886 3300046518 Bacteria 18737
337 Ga0495631_0003700 3300046518 Bacteria 8341
338 Ga0495631_0021272 3300046518 Bacteria 3021
339 Ga0495631_0024386 3300046518 Bacteria 2792
340 Ga0495631_0027447 3300046518 Bacteria 2605
341 Ga0495631_0042274 3300046518 Bacteria 2014
342 Ga0495632_0000504 3300046519 Bacteria 36804
343 Ga0495632_0001557 3300046519 Bacteria 18923
344 Ga0495632_0006690 3300046519 Bacteria 7369
345 Ga0495632_0009303 3300046519 Bacteria 5932
346 Ga0495632_0032005 3300046519 Bacteria 2713
347 Ga0495637_0000006 3300046520 Bacteria 435763
348 Ga0495637_0000223 3300046520 Bacteria 43805
349 Ga0495637_0024391 3300046520 Bacteria 2737
350 Ga0495643_0000196 3300046522 Bacteria 95989
351 Ga0495643_0000239 3300046522 Bacteria 82416
352 Ga0495643_0003999 3300046522 Bacteria 10530
353 Ga0495643_0130596 3300046522 Bacteria 1261
354 Ga0495643_0219819 3300046522 Bacteria 902
355 Ga0495644_0012766 3300046523 Bacteria 3229
356 Ga0495644_0037310 3300046523 Bacteria 1833
357 Ga0495644_0051309 3300046523 Bacteria 1549
358 Ga0495648_0000007 3300046524 Bacteria 347305
359 Ga0495648_0001034 3300046524 Bacteria 28205
360 Ga0495648_0002116 3300046524 Bacteria 18701
361 Ga0495648_0005003 3300046524 Bacteria 11135
362 Ga0495648_0009830 3300046524 Bacteria 7352
363 Ga0495648_0018262 3300046524 Bacteria 4976
364 Ga0495648_0029372 3300046524 Bacteria 3649
365 Ga0495648_0029956 3300046524 Bacteria 3605
366 Ga0495648_0088687 3300046524 Bacteria 1738
367 Ga0495648_0149311 3300046524 Bacteria 1221
368 Ga0495648_0162848 3300046524 Bacteria 1151
369 Ga0495663_0073619 3300046525 Bacteria 1091
370 Ga0495663_0074604 3300046525 Bacteria 1084
371 Ga0495666_0047360 3300046526 Bacteria 2070
372 Ga0495666_0075095 3300046526 Bacteria 1603
373 Ga0495642_0000383 3300046528 Bacteria 23859
374 Ga0495642_0000499 3300046528 Bacteria 20174
375 Ga0495642_0001165 3300046528 Bacteria 12065
376 Ga0495642_0001497 3300046528 Bacteria 10432
377 Ga0495642_0001671 3300046528 Bacteria 9619
378 Ga0495642_0019207 3300046528 Bacteria 2678
379 Ga0495642_0053029 3300046528 Bacteria 1670
380 Ga0495642_0072656 3300046528 Bacteria 1440
381 Ga0495642_0102339 3300046528 Bacteria 1220
382 Ga0495642_0120098 3300046528 Bacteria 1127
383 Ga0495652_0024781 3300046529 Bacteria 5309
384 Ga0495652_0086848 3300046529 Bacteria 2567
385 Ga0495654_0000004 3300046530 Bacteria 515304
386 Ga0495654_0001755 3300046530 Bacteria 14525
387 Ga0495654_0001896 3300046530 Bacteria 13905
388 Ga0495654_0003847 3300046530 Bacteria 9067
389 Ga0495654_0006878 3300046530 Bacteria 6415
390 Ga0495654_0010948 3300046530 Bacteria 4927
391 Ga0495665_0053775 3300046531 Bacteria 2128
392 Ga0495665_0082749 3300046531 Bacteria 1687
393 Ga0495586_0005660 3300046535 Bacteria 6681
394 Ga0495587_0009893 3300046536 Bacteria 6085
395 Ga0495587_0303542 3300046536 Bacteria 892
396 Ga0495609_0000545 3300046538 Bacteria 29804
397 Ga0495609_0000732 3300046538 Bacteria 24952
398 Ga0495609_0000832 3300046538 Bacteria 22914
399 Ga0495609_0000847 3300046538 Bacteria 22600
400 Ga0495609_0000856 3300046538 Bacteria 22445
401 Ga0495609_0004528 3300046538 Bacteria 7562
402 Ga0495609_0009843 3300046538 Bacteria 4609
403 Ga0495609_0021589 3300046538 Bacteria 2970
404 Ga0495609_0038242 3300046538 Bacteria 2163
405 Ga0495609_0059848 3300046538 Bacteria 1684
406 Ga0495609_0138079 3300046538 Bacteria 1041
407 Ga0495597_0000239 3300046542 Bacteria 49769
408 Ga0495597_0000479 3300046542 Bacteria 33628
409 Ga0495597_0000496 3300046542 Bacteria 32885
410 Ga0495597_0000621 3300046542 Bacteria 28981
411 Ga0495597_0001375 3300046542 Bacteria 17590
412 Ga0495597_0076063 3300046542 Bacteria 1440
413 Ga0495597_0136501 3300046542 Bacteria 1014
414 Ga0495597_0136802 3300046542 Bacteria 1012
415 Ga0495645_0211932 3300046543 Bacteria 1307
416 Ga0495622_0000003 3300046557 Bacteria 268681
417 Ga0495622_0007635 3300046557 Bacteria 5023
418 Ga0495622_0089412 3300046557 Bacteria 1415
419 Ga0495633_0000541 3300046558 Bacteria 37760
420 Ga0495633_0001029 3300046558 Bacteria 22793
421 Ga0495633_0002925 3300046558 Bacteria 11708
422 Ga0495633_0003831 3300046558 Bacteria 9838
423 Ga0495633_0005412 3300046558 Bacteria 7818
424 Ga0495633_0015370 3300046558 Bacteria 3972
425 Ga0495633_0016694 3300046558 Bacteria 3778
426 Ga0495633_0020676 3300046558 Bacteria 3306
427 Ga0495633_0027375 3300046558 Bacteria 2787
428 Ga0495633_0028557 3300046558 Bacteria 2717
429 Ga0495633_0043503 3300046558 Bacteria 2131
430 Ga0495633_0167059 3300046558 Bacteria 1014
431 Ga0495656_0007063 3300046615 Bacteria 3958
432 Ga0495656_0037398 3300046615 Bacteria 2005
433 Ga0495656_0041726 3300046615 Bacteria 1918
434 Ga0495656_0061928 3300046615 Bacteria 1636
435 Ga0495668_0000049 3300046616 Bacteria 217657
436 Ga0495668_0000051 3300046616 Bacteria 214532
437 Ga0495668_0001802 3300046616 Bacteria 19550
438 Ga0495668_0001821 3300046616 Bacteria 19337
439 Ga0495668_0002559 3300046616 Bacteria 14773
440 Ga0495668_0003825 3300046616 Bacteria 11023
441 Ga0495668_0011300 3300046616 Bacteria 5356
442 Ga0495668_0043218 3300046616 Bacteria 2507
443 Ga0495668_0064421 3300046616 Bacteria 2017
444 Ga0495668_0105447 3300046616 Bacteria 1542
445 Ga0495668_0271193 3300046616 Bacteria 929
446 Ga0495634_0058086 3300046642 Bacteria 2580
447 Ga0495611_0000496 3300046648 Bacteria 23480
448 Ga0495611_0054994 3300046648 Bacteria 1800
449 Ga0495611_0061461 3300046648 Bacteria 1707
450 Ga0495611_0243923 3300046648 Bacteria 833
451 Ga0495625_0023566 3300046660 Bacteria 4700
452 Ga0495625_0035638 3300046660 Bacteria 3666
453 Ga0495625_0085276 3300046660 Bacteria 2192
454 Ga0495625_0131054 3300046660 Bacteria 1698
455 Ga0495625_0172548 3300046660 Bacteria 1443
456 Ga0495625_0254275 3300046660 Bacteria 1139
457 Ga0495625_0341234 3300046660 Bacteria 949
458 Ga0495635_0020507 3300046663 Bacteria 4604
459 Ga0495659_0018014 3300046664 Bacteria 2349
460 Ga0495659_0034369 3300046664 Bacteria 1782
461 Ga0495661_0000338 3300046665 Bacteria 51135
462 Ga0495661_0000651 3300046665 Bacteria 35125
463 Ga0495661_0000802 3300046665 Bacteria 29694
464 Ga0495661_0012141 3300046665 Bacteria 5820
465 Ga0495661_0012900 3300046665 Bacteria 5630
466 Ga0495661_0020847 3300046665 Bacteria 4273
467 Ga0495661_0023696 3300046665 Bacteria 3979
468 Ga0495661_0057951 3300046665 Bacteria 2310
469 Ga0495661_0088408 3300046665 Bacteria 1768
470 Ga0495661_0121830 3300046665 Bacteria 1439
471 Ga0495661_0126846 3300046665 Bacteria 1403
472 Ga0495661_0134896 3300046665 Bacteria 1348
473 Ga0495661_0198110 3300046665 Bacteria 1053
474 Ga0495588_0000226 3300046674 Bacteria 51538
475 Ga0495588_0000447 3300046674 Bacteria 20763
476 Ga0495588_0017069 3300046674 Bacteria 3518
477 Ga0495588_0017445 3300046674 Bacteria 3487
478 Ga0495588_0031570 3300046674 Bacteria 2667
479 Ga0495588_0032033 3300046674 Bacteria 2649
480 Ga0495588_0111710 3300046674 Bacteria 1439
481 Ga0495588_0247320 3300046674 Bacteria 940
482 Ga0495623_0065228 3300046679 Bacteria 2277
483 Ga0495669_0001886 3300046684 Bacteria 8601
484 Ga0495669_0010859 3300046684 Bacteria 3855
485 Ga0495669_0020156 3300046684 Bacteria 2883
486 Ga0495669_0067605 3300046684 Bacteria 1624
487 Ga0495613_0107974 3300046689 Bacteria 2007
488 Ga0495624_0013524 3300046690 Bacteria 5564
489 Ga0495670_0007797 3300046691 Bacteria 5265
490 Ga0495670_0009193 3300046691 Bacteria 4859
491 Ga0495670_0024751 3300046691 Bacteria 2967
492 Ga0495670_0040525 3300046691 Bacteria 2322
493 Ga0495670_0048885 3300046691 Bacteria 2115
494 Ga0495671_0000070 3300046692 Bacteria 97889
495 Ga0495671_0000192 3300046692 Bacteria 53483
496 Ga0495671_0000422 3300046692 Bacteria 33738
497 Ga0495671_0000483 3300046692 Bacteria 30968
498 Ga0495671_0000602 3300046692 Bacteria 26521
499 Ga0495671_0001766 3300046692 Bacteria 13995
500 Ga0495671_0013388 3300046692 Bacteria 4445
501 Ga0495671_0041693 3300046692 Bacteria 2310
502 Ga0495671_0046098 3300046692 Bacteria 2180
503 Ga0495671_0072158 3300046692 Bacteria 1695
504 Ga0495671_0157021 3300046692 Bacteria 1107
505 Ga0495649_0000184 3300046694 Bacteria 54636
506 Ga0495649_0000424 3300046694 Bacteria 36607
507 Ga0495649_0057588 3300046694 Bacteria 2095
508 Ga0495649_0123385 3300046694 Bacteria 1369
509 Ga0495649_0183789 3300046694 Bacteria 1090
510 Ga0495589_0000188 3300046794 Bacteria 54693
511 Ga0495589_0000921 3300046794 Bacteria 18055
512 Ga0495589_0008404 3300046794 Bacteria 5396
513 Ga0495589_0014417 3300046794 Bacteria 4070
514 Ga0495589_0020128 3300046794 Bacteria 3413
515 Ga0495600_0109674 3300046809 Bacteria 1797
516 Ga0495660_0000394 3300046810 Bacteria 37748
517 Ga0495660_0001755 3300046810 Bacteria 14449
518 Ga0495660_0002473 3300046810 Bacteria 11777
519 Ga0495660_0027715 3300046810 Bacteria 3203
520 Ga0495660_0055373 3300046810 Bacteria 2147
521 Ga0495660_0066006 3300046810 Bacteria 1930
522 Ga0495660_0131388 3300046810 Bacteria 1256
523 Ga0495660_0158241 3300046810 Bacteria 1113
524 Ga0495581_0490654 3300047315 Bacteria 714
525 Ga0495604_0007372 3300047317 Bacteria 8715
526 Ga0495636_0017913 3300047318 Bacteria 2838
527 Ga0495636_0074010 3300047318 Bacteria 1458
528 Ga0495674_0003686 3300047319 Bacteria 14897
529 Ga0495672_0000015 3300047320 Bacteria 502855
530 Ga0495672_0000441 3300047320 Bacteria 49584
531 Ga0495672_0000695 3300047320 Bacteria 37258
532 Ga0495672_0001226 3300047320 Bacteria 25838
533 Ga0495672_0046603 3300047320 Bacteria 2584
534 Ga0495672_0100740 3300047320 Bacteria 1567
535 Ga0495676_0000014 3300047321 Bacteria 203356
536 Ga0495676_0005083 3300047321 Bacteria 12068
537 Ga0495676_0056475 3300047321 Bacteria 3104
538 Ga0495676_0112139 3300047321 Bacteria 1999
539 Ga0495680_0013638 3300047322 Bacteria 7080
540 Ga0495683_0000180 3300047323 Bacteria 62230
541 Ga0495683_0000306 3300047323 Bacteria 41377
542 Ga0495683_0002293 3300047323 Bacteria 11661
543 Ga0495683_0007893 3300047323 Bacteria 5712
544 Ga0495683_0034699 3300047323 Bacteria 2565
545 Ga0495683_0060138 3300047323 Bacteria 1883
546 Ga0495683_0070268 3300047323 Bacteria 1719
547 Ga0495683_0080155 3300047323 Bacteria 1594
548 Ga0495683_0118400 3300047323 Bacteria 1259
549 Ga0495683_0135778 3300047323 Bacteria 1156
550 Ga0495687_000049 3300047443 Bacteria 205432
551 Ga0495687_000088 3300047443 Bacteria 142499
552 Ga0495687_000533 3300047443 Bacteria 45573
553 Ga0495687_000732 3300047443 Bacteria 36155
554 Ga0495687_000848 3300047443 Bacteria 32587
555 Ga0495687_000928 3300047443 Bacteria 30405
556 Ga0495687_001000 3300047443 Bacteria 28318
557 Ga0495687_026413 3300047443 Bacteria 2733
558 Ga0495687_034718 3300047443 Bacteria 2275
559 Ga0495675_0011916 3300047444 Bacteria 5463
560 Ga0495677_0000286 3300047445 Bacteria 22170
561 Ga0495677_0003083 3300047445 Bacteria 6484
562 Ga0495677_0003494 3300047445 Bacteria 6097
563 Ga0495677_0010972 3300047445 Bacteria 3319
564 Ga0495677_0053896 3300047445 Bacteria 1483
565 Ga0495677_0090213 3300047445 Bacteria 1154
566 Ga0495679_000965 3300047446 Bacteria 17777
567 Ga0495679_000979 3300047446 Bacteria 17640
568 Ga0495679_004840 3300047446 Bacteria 6084
569 Ga0495679_011850 3300047446 Bacteria 3348
570 Ga0495679_015636 3300047446 Bacteria 2769
571 Ga0495679_017285 3300047446 Bacteria 2585
572 Ga0495685_008963 3300047447 Bacteria 3334
573 Ga0495685_009579 3300047447 Bacteria 3240
574 Ga0495673_0000017 3300047469 Bacteria 574970
575 Ga0495673_0000027 3300047469 Bacteria 475440
576 Ga0495673_0005555 3300047469 Bacteria 7596
577 Ga0495673_0024772 3300047469 Bacteria 2892
578 Ga0495681_0000073 3300047470 Bacteria 92561
579 Ga0495681_0000127 3300047470 Bacteria 67389
580 Ga0495681_0000168 3300047470 Bacteria 54934
581 Ga0495681_0012405 3300047470 Bacteria 5007
582 Ga0495681_0012756 3300047470 Bacteria 4918
583 Ga0495681_0012820 3300047470 Bacteria 4902
584 Ga0495681_0033177 3300047470 Bacteria 2590
585 Ga0495681_0060135 3300047470 Bacteria 1754
586 Ga0495681_0069432 3300047470 Bacteria 1600
587 Ga0495686_0000696 3300047472 Bacteria 45475
588 Ga0495686_0001565 3300047472 Bacteria 24374
589 Ga0495686_0009279 3300047472 Bacteria 7104
590 Ga0495686_0011457 3300047472 Bacteria 6244
591 Ga0495686_0018422 3300047472 Bacteria 4687
592 Ga0495686_0021104 3300047472 Bacteria 4332
593 Ga0495686_0114693 3300047472 Bacteria 1612
594 Ga0495602_0001704 3300048088 Bacteria 21874
595 Ga0495602_0264797 3300048088 Bacteria 1273
596 Ga0495614_0016008 3300048089 Bacteria 3265
597 Ga0495614_0103412 3300048089 Bacteria 1247
598 Ga0495626_0000677 3300048091 Bacteria 32591
599 Ga0495626_0001122 3300048091 Bacteria 22502
600 Ga0495626_0001575 3300048091 Bacteria 17878
601 Ga0495626_0001656 3300048091 Bacteria 17198
602 Ga0495626_0002929 3300048091 Bacteria 11365
603 Ga0495626_0003190 3300048091 Bacteria 10672
604 Ga0495626_0003269 3300048091 Bacteria 10478
605 Ga0495626_0007954 3300048091 Bacteria 5863
606 Ga0495626_0019732 3300048091 Bacteria 3367
607 Ga0495626_0023535 3300048091 Bacteria 3032
608 Ga0495626_0044686 3300048091 Bacteria 2071
609 Ga0495626_0061379 3300048091 Bacteria 1709
610 Ga0495626_0094654 3300048091 Bacteria 1309
611 Ga0495626_0150249 3300048091 Bacteria 982
612 Ga0495626_0150256 3300048091 Bacteria 982
613 Ga0496100_0232150 3300048903 Bacteria 1358
614 Ga0496101_0009552 3300048904 Bacteria 6377
615 Ga0496102_0002678 3300048905 Bacteria 15150
616 Ga0496102_0179889 3300048905 Bacteria 1992
617 Ga0496102_0286742 3300048905 Bacteria 1552
618 Ga0496103_0008794 3300048906 Bacteria 5992
619 Ga0496103_0019302 3300048906 Bacteria 4094
620 Ga0496103_0150959 3300048906 Bacteria 1488
621 Ga0496104_0047423 3300048907 Bacteria 4049
622 Ga0496105_0257209 3300048908 Bacteria 1413
623 Ga0496106_0006898 3300048909 Bacteria 8403
624 Ga0496106_0070812 3300048909 Bacteria 2664
625 Ga0496109_0006624 3300048912 Bacteria 9754
626 Ga0496110_0000065 3300048913 Bacteria 52525
627 Ga0496110_0252368 3300048913 Bacteria 1605
628 Ga0496111_0032691 3300048914 Bacteria 3710
629 Ga0496111_0214931 3300048914 Bacteria 1428
630 Ga0496115_0001661 3300048918 Bacteria 15999
631 Ga0496115_0025058 3300048918 Bacteria 4641
632 Ga0496116_0002320 3300048919 Bacteria 20148
633 Ga0496116_0008949 3300048919 Bacteria 8610
634 Ga0496116_0020781 3300048919 Bacteria 4973
635 Ga0496117_0030586 3300048920 Bacteria 4128
636 Ga0496117_0056551 3300048920 Bacteria 2731
637 Ga0496118_0120057 3300048921 Bacteria 1716
638 Ga0496118_0155211 3300048921 Bacteria 1425
639 Ga0496118_0188913 3300048921 Bacteria 1234
640 Ga0496119_0005089 3300048922 Bacteria 12762
641 Ga0496119_0008370 3300048922 Bacteria 9100
642 Ga0496119_0022762 3300048922 Bacteria 4473
643 Ga0496119_0183336 3300048922 Bacteria 1096
644 Ga0496120_0003966 3300048923 Bacteria 12866
645 Ga0496120_0051956 3300048923 Bacteria 2337
646 Ga0496121_0023379 3300048924 Bacteria 5955
647 Ga0496122_0000169 3300048925 Bacteria 155380
648 Ga0496122_0003279 3300048925 Bacteria 21451
649 Ga0496122_0053369 3300048925 Bacteria 3048
650 Ga0496123_0001393 3300048926 Bacteria 33882
651 Ga0496123_0001911 3300048926 Bacteria 27177
652 Ga0496123_0002716 3300048926 Bacteria 21264
653 Ga0496123_0003363 3300048926 Bacteria 18084
654 Ga0496124_0000484 3300048927 Bacteria 68281
655 Ga0496124_0006649 3300048927 Bacteria 12541
656 Ga0496124_0010167 3300048927 Bacteria 9568
657 Ga0496124_0011735 3300048927 Bacteria 8738
658 Ga0496124_0064232 3300048927 Bacteria 3065
659 Ga0496124_0185603 3300048927 Bacteria 1596
660 Ga0496124_0265532 3300048927 Bacteria 1260
661 Ga0496124_0416224 3300048927 Bacteria 928
662 Ga0496125_0000916 3300048928 Bacteria 46400
663 Ga0496125_0004916 3300048928 Bacteria 15128
664 Ga0496125_0051385 3300048928 Bacteria 3400
665 Ga0496125_0127054 3300048928 Bacteria 1804
666 Ga0496125_0131621 3300048928 Bacteria 1760
667 Ga0496126_0001412 3300048929 Bacteria 38001
668 Ga0496126_0104768 3300048929 Bacteria 2471
669 Ga0495678_000056 3300049459 Bacteria 149598
670 Ga0495678_000079 3300049459 Bacteria 122038
671 Ga0495678_000449 3300049459 Bacteria 40814
672 Ga0495678_000565 3300049459 Bacteria 35612
673 Ga0495678_006643 3300049459 Bacteria 6121
674 Ga0495682_0000095 3300049460 Bacteria 77918
675 Ga0495682_0000378 3300049460 Bacteria 32210
676 Ga0495682_0000610 3300049460 Bacteria 24098
677 Ga0495682_0011263 3300049460 Bacteria 3442
678 Ga0495682_0040989 3300049460 Bacteria 1697
679 Ga0495682_0046845 3300049460 Bacteria 1577
680 Ga0495682_0196966 3300049460 Bacteria 715
681 Ga0501034_0387661 3300049571 Bacteria 1321
682 Ga0501036_0115471 3300049572 Bacteria 2268
683 Ga0501041_0194118 3300049577 Bacteria 1272
684 Ga0501046_0073916 3300049580 Bacteria 2644
685 Ga0501047_0092639 3300049581 Bacteria 2900
686 Ga0501047_0274909 3300049581 Bacteria 1530
687 Ga0501073_0225096 3300049589 Bacteria 1296
688 Ga0501076_0244872 3300049592 Bacteria 1467
689 Ga0501240_019454 3300049673 Bacteria 1009
690 Ga0501080_0025339 3300049742 Bacteria 5503
691 Ga0501083_0128850 3300049744 Bacteria 1659
692 Ga0501035_0003724 3300049822 Bacteria 14537
693 Ga0501044_0237922 3300049823 Bacteria 1766
694 nmdc:mga08x19_211136_c1 3300050514 Bacteria 1332
695 Ga0500618_000138 3300053125 Bacteria 61503
696 Ga0587068_012394 3300059641 Bacteria 1300
697 Ga0587107_007464 3300059652 Bacteria 1233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046648 Ga0495611_0243923 Ga0495611_0243923_18_689 189
2 3300046525 Ga0495663_0074604 Ga0495663_0074604_375_1043 221
3 3300046543 Ga0495645_0211932 Ga0495645_0211932_625_1296 221
4 3300046810 Ga0495660_0055373 Ga0495660_0055373_15_680 221
5 3300047315 Ga0495581_0490654 Ga0495581_0490654_31_696 221
6 3300048905 Ga0496102_0179889 Ga0496102_0179889_1307_1978 221
7 3300049460 Ga0495682_0196966 Ga0495682_0196966_32_700 221
8 3300046453 Ga0495627_001312 Ga0495627_001312_2739_3530 229
9 3300046506 Ga0495583_0002955 Ga0495583_0002955_349_1140 229
10 3300046507 Ga0495606_0148232 Ga0495606_0148232_13_804 229
11 3300009092 Ga0105250_10001524 Ga0105250_100015242 230
12 3300013102 Ga0157371_10020003 Ga0157371_100200034 230
13 3300048919 Ga0496116_0020781 Ga0496116_0020781_336_1076 230
14 3300048922 Ga0496119_0005089 Ga0496119_0005089_521_1261 230
15 3300048923 Ga0496120_0003966 Ga0496120_0003966_521_1261 230
16 3300048927 Ga0496124_0006649 Ga0496124_0006649_11501_12241 230
17 3300046492 Ga0495585_0283387 Ga0495585_0283387_18_722 234
18 3300046507 Ga0495606_0216569 Ga0495606_0216569_28_738 234
19 3300046558 Ga0495633_0028557 Ga0495633_0028557_431_1237 234
20 3300046615 Ga0495656_0041726 Ga0495656_0041726_642_1448 234
21 3300046674 Ga0495588_0247320 Ga0495588_0247320_17_727 234
22 3300046691 Ga0495670_0024751 Ga0495670_0024751_569_1375 234
23 3300046692 Ga0495671_0000422 Ga0495671_0000422_16760_17566 234
24 3300046692 Ga0495671_0157021 Ga0495671_0157021_369_1073 234
25 3300047470 Ga0495681_0000127 Ga0495681_0000127_16085_16891 234
26 3300046471 Ga0495650_0000154 Ga0495650_0000154_17899_18786 235
27 3300046507 Ga0495606_0000982 Ga0495606_0000982_27708_28595 235
28 3300013102 Ga0157371_10007873 Ga0157371_100078732 236
29 3300041405 Ga0439438_001771 Ga0439438_001771_911_1621 236
30 3300041411 Ga0439466_0000001 Ga0439466_0000001_211493_212203 236
31 3300042006 Ga0439432_000295 Ga0439432_000295_14304_15014 236
32 3300042146 Ga0450907_021497 Ga0450907_021497_21_731 236
33 3300046530 Ga0495654_0001896 Ga0495654_0001896_3654_4448 236
34 3300046810 Ga0495660_0002473 Ga0495660_0002473_10481_11191 236
35 3300047320 Ga0495672_0000015 Ga0495672_0000015_468751_469461 236
36 3300048922 Ga0496119_0183336 Ga0496119_0183336_120_830 236
37 3300048927 Ga0496124_0000484 Ga0496124_0000484_63532_64242 236
38 3300046506 Ga0495583_0051211 Ga0495583_0051211_729_1535 239
39 3300013308 Ga0157375_10800698 Ga0157375_108006982 241
40 iso_pu_bacteria 2894023352 2894024100 241
41 3300048921 Ga0496118_0120057 Ga0496118_0120057_296_1090 242
42 3300005327 Ga0070658_10001501 Ga0070658_100015013 243
43 3300005336 Ga0070680_100043772 Ga0070680_1000437723 243
44 3300005339 Ga0070660_100051350 Ga0070660_1000513502 243
45 3300005530 Ga0070679_100026869 Ga0070679_1000268693 243
46 3300005535 Ga0070684_100033946 Ga0070684_1000339463 243
47 3300005539 Ga0068853_100016929 Ga0068853_1000169293 243
48 3300005564 Ga0070664_100044370 Ga0070664_1000443703 243
49 3300005616 Ga0068852_100106833 Ga0068852_1001068332 243
50 3300005834 Ga0068851_10009237 Ga0068851_100092373 243
51 3300006358 Ga0068871_100610880 Ga0068871_1006108801 243
52 3300009093 Ga0105240_10089222 Ga0105240_100892222 243
53 3300009174 Ga0105241_10009038 Ga0105241_100090384 243
54 3300013104 Ga0157370_10191145 Ga0157370_101911451 243
55 3300013307 Ga0157372_10055155 Ga0157372_100551554 243
56 3300025321 Ga0207656_10027760 Ga0207656_100277602 243
57 3300025911 Ga0207654_10080902 Ga0207654_100809022 243
58 3300025917 Ga0207660_10012052 Ga0207660_100120525 243
59 3300025919 Ga0207657_10001327 Ga0207657_100013278 243
60 3300025944 Ga0207661_10024149 Ga0207661_100241495 243
61 3300026067 Ga0207678_10178285 Ga0207678_101782852 243
62 3300026078 Ga0207702_10129161 Ga0207702_101291612 243
63 3300005539 Ga0068853_100741298 Ga0068853_1007412981 244
64 3300009011 Ga0105251_10076207 Ga0105251_100762072 244
65 3300013104 Ga0157370_10158140 Ga0157370_101581402 244
66 3300025735 Ga0207713_1055231 Ga0207713_10552312 244
67 3300026041 Ga0207639_10567145 Ga0207639_105671452 244
68 3300050514 nmdc:mga08x19_211136_c1 nmdc:mga08x19_211136_c1_351_1148 244
69 3300025913 Ga0207695_10294291 Ga0207695_102942912 245
70 3300025935 Ga0207709_10000117 Ga0207709_1000011757 245
71 3300025949 Ga0207667_10402715 Ga0207667_104027152 245
72 3300046512 Ga0495610_0021762 Ga0495610_0021762_1708_2508 245
73 3300013307 Ga0157372_10043201 Ga0157372_100432013 246
74 3300048907 Ga0496104_0047423 Ga0496104_0047423_2125_2925 246
75 3300030744 Ga0316181_1077120 Ga0316181_10771204 247
76 3300049571 Ga0501034_0387661 Ga0501034_0387661_373_1167 247
77 3300049572 Ga0501036_0115471 Ga0501036_0115471_1458_2252 247
78 3300049580 Ga0501046_0073916 Ga0501046_0073916_1620_2414 247
79 3300049581 Ga0501047_0092639 Ga0501047_0092639_486_1280 247
80 3300049589 Ga0501073_0225096 Ga0501073_0225096_191_985 247
81 3300049742 Ga0501080_0025339 Ga0501080_0025339_1394_2188 247
82 3300049744 Ga0501083_0128850 Ga0501083_0128850_726_1520 247
83 3300025711 Ga0207696_1001500 Ga0207696_100150010 248
84 3300042461 Ga0439460_0001533 Ga0439460_0001533_1509_2306 248
85 3300046665 Ga0495661_0000338 Ga0495661_0000338_32512_33318 248
86 3300046810 Ga0495660_0000394 Ga0495660_0000394_18883_19677 248
87 3300047472 Ga0495686_0009279 Ga0495686_0009279_1169_1963 248
88 3300048904 Ga0496101_0009552 Ga0496101_0009552_586_1392 248
89 3300048912 Ga0496109_0006624 Ga0496109_0006624_8533_9339 248
90 3300048925 Ga0496122_0000169 Ga0496122_0000169_55724_56530 248
91 3300048926 Ga0496123_0001393 Ga0496123_0001393_17813_18619 248
92 3300048928 Ga0496125_0000916 Ga0496125_0000916_17848_18654 248
93 3300005435 Ga0070714_100169783 Ga0070714_1001697832 249
94 3300005719 Ga0068861_100031002 Ga0068861_1000310023 249
95 3300006177 Ga0075362_10030522 Ga0075362_100305223 249
96 3300006914 Ga0075436_100262641 Ga0075436_1002626412 249
97 3300013306 Ga0163162_10263821 Ga0163162_102638212 249
98 3300015265 Ga0182005_1005606 Ga0182005_10056062 249
99 3300025929 Ga0207664_10142949 Ga0207664_101429492 249
100 3300026118 Ga0207675_100097998 Ga0207675_1000979983 249
101 3300042010 Ga0439452_009893 Ga0439452_009893_390_1187 249
102 3300009093 Ga0105240_10393415 Ga0105240_103934152 250
103 3300005339 Ga0070660_100077774 Ga0070660_1000777741 251
104 3300025919 Ga0207657_10014755 Ga0207657_100147553 251
105 3300049577 Ga0501041_0194118 Ga0501041_0194118_19_837 251
106 3300009092 Ga0105250_10002509 Ga0105250_1000250911 252
107 3300025711 Ga0207696_1002414 Ga0207696_10024142 252
108 3300049460 Ga0495682_0000095 Ga0495682_0000095_72032_72823 252
109 3300026116 Ga0207674_10359504 Ga0207674_103595042 253
110 3300046507 Ga0495606_0003445 Ga0495606_0003445_6093_6887 253
111 3300046542 Ga0495597_0000621 Ga0495597_0000621_5214_6014 253
112 3300048913 Ga0496110_0000065 Ga0496110_0000065_41921_42727 253
113 3300005337 Ga0070682_100052125 Ga0070682_1000521253 254
114 3300044719 Ga0466971_0005347 Ga0466971_0005347_3468_4253 254
115 3300044765 Ga0466970_0217674 Ga0466970_0217674_193_978 254
116 3300046463 Ga0495653_0085772 Ga0495653_0085772_1276_2070 254
117 3300046507 Ga0495606_0224489 Ga0495606_0224489_210_995 254
118 3300047443 Ga0495687_001000 Ga0495687_001000_9696_10481 254
119 3300013307 Ga0157372_10751311 Ga0157372_107513111 255
120 3300044693 Ga0466961_0048871 Ga0466961_0048871_1791_2576 255
121 3300047470 Ga0495681_0033177 Ga0495681_0033177_128_922 255
122 3300048903 Ga0496100_0232150 Ga0496100_0232150_239_1024 255
123 3300048927 Ga0496124_0416224 Ga0496124_0416224_27_812 255
124 3300049592 Ga0501076_0244872 Ga0501076_0244872_427_1239 255
125 3300009036 Ga0105244_10004218 Ga0105244_100042182 256
126 3300025728 Ga0207655_1002995 Ga0207655_10029957 256
127 3300005262 Ga0065165_1010202 Ga0065165_10102024 257
128 iso_pu_bacteria 2600255254 2601522956 257
129 iso_pu_bacteria 2600255255 2601527983 257
130 iso_pu_bacteria 2600255280 2601614817 257
131 iso_pu_bacteria 2600255281 2601619534 257
132 iso_pu_bacteria 2600255287 2601641871 257
133 iso_pu_bacteria 2600255288 2601646708 257
134 iso_pu_bacteria 2600255289 2601656347 257
135 iso_pu_bacteria 2600255290 2601658287 257
136 iso_pu_bacteria 2600255291 2601665911 257
137 iso_pu_bacteria 2600255298 2601698768 257
138 iso_pu_bacteria 2600255299 2601701614 257
139 iso_pu_bacteria 2600255300 2601706808 257
140 iso_pu_bacteria 2600255301 2601711112 257
141 iso_pu_bacteria 2600255302 2601716126 257
142 iso_pu_bacteria 2600255303 2601719678 257
143 iso_pu_bacteria 2600255304 2601726532 257
144 iso_pu_bacteria 2600255305 2601731073 257
145 iso_pu_bacteria 2600255306 2601736088 257
146 iso_pu_bacteria 2602042052 2603661372 257
147 iso_pu_bacteria 2602042053 2603664326 257
148 iso_pu_bacteria 2602042103 2603838468 257
149 iso_pu_bacteria 2602042104 2603843545 257
150 iso_pu_bacteria 2602042105 2603848619 257
151 iso_pu_bacteria 2602042106 2603853692 257
152 iso_pu_bacteria 2602042109 2603868779 257
153 iso_pu_bacteria 2602042110 2603871746 257
154 iso_pu_bacteria 2602042111 2603876648 257
155 iso_pu_bacteria 2603880178 2606048936 257
156 iso_pu_bacteria 2603880184 2606068756 257
157 iso_pu_bacteria 2603880202 2606144549 257
158 iso_pu_bacteria 2603880211 2606176339 257
159 iso_pu_bacteria 2636415599 2637224272 257
160 iso_pu_bacteria 2643221556 2643797905 257
161 iso_pu_bacteria 2643221684 2644473084 257
162 iso_pu_bacteria 2939631187 2939634816 257
163 3300009036 Ga0105244_10009942 Ga0105244_100099422 258
164 3300025233 Ga0209437_106803 Ga0209437_1068032 258
165 3300046507 Ga0495606_0128971 Ga0495606_0128971_193_987 258
166 3300046513 Ga0495616_0019934 Ga0495616_0019934_1712_2524 258
167 3300046519 Ga0495632_0001557 Ga0495632_0001557_8350_9162 258
168 3300046530 Ga0495654_0010948 Ga0495654_0010948_421_1218 258
169 3300046538 Ga0495609_0009843 Ga0495609_0009843_14_811 258
170 3300046538 Ga0495609_0138079 Ga0495609_0138079_131_925 258
171 3300047320 Ga0495672_0046603 Ga0495672_0046603_833_1630 258
172 3300047469 Ga0495673_0005555 Ga0495673_0005555_1449_2246 258
173 3300044683 Ga0466965_0037202 Ga0466965_0037202_1029_1829 259
174 3300046491 Ga0495584_0000678 Ga0495584_0000678_6570_7370 259
175 3300046501 Ga0495607_0007573 Ga0495607_0007573_5440_6252 259
176 3300046522 Ga0495643_0003999 Ga0495643_0003999_8957_9769 259
177 3300046665 Ga0495661_0000651 Ga0495661_0000651_15332_16144 259
178 3300046694 Ga0495649_0000184 Ga0495649_0000184_51004_51816 259
179 3300047445 Ga0495677_0003083 Ga0495677_0003083_3461_4273 259
180 iso_pu_bacteria 2728369097 2729148711 259
181 iso_pu_bacteria 8055225921 8055226199 259
182 3300021361 Ga0213872_10000002 Ga0213872_10000002406 260
183 3300047323 Ga0495683_0034699 Ga0495683_0034699_659_1444 260
184 iso_pu_bacteria 2513237082 2513555954 260
185 iso_pu_bacteria 2515154189 2516017127 260
186 iso_pu_bacteria 2599185169 2599411448 260
187 iso_pu_bacteria 2600255307 2601741498 260
188 iso_pu_bacteria 2600255309 2601752248 260
189 iso_pu_bacteria 2600255392 2602019089 260
190 iso_pu_bacteria 2643221643 2644237287 260
191 iso_pu_bacteria 2675903046 2676405674 260
192 iso_pu_bacteria 2775507074 2777020756 260
193 iso_pu_bacteria 2904504865 2904507960 260
194 iso_pu_bacteria 2928157003 2928159725 260
195 iso_pu_bacteria 2969079654 2969081312 260
196 iso_pu_bacteria 2984559226 2984563775 260
197 iso_pu_bacteria 2984595703 2984596507 260
198 iso_pu_bacteria 641736154 642415789 260
199 iso_pu_bacteria 8015394850 8015397726 260
200 3300005563 Ga0068855_100134421 Ga0068855_1001344212 261
201 3300010375 Ga0105239_10071052 Ga0105239_100710524 261
202 3300013105 Ga0157369_10004954 Ga0157369_100049549 261
203 3300015265 Ga0182005_1002413 Ga0182005_10024136 261
204 3300037471 Ga0395905_0025457 Ga0395905_0025457_1782_2567 261
205 3300039447 Ga0436361_1009709 Ga0436361_1009709_7585_8370 261
206 3300044684 Ga0466966_0001041 Ga0466966_0001041_13781_14569 261
207 3300044842 Ga0466957_0000386 Ga0466957_0000386_12997_13785 261
208 3300045049 Ga0466959_0076389 Ga0466959_0076389_519_1307 261
209 3300045051 Ga0451576_0081461 Ga0451576_0081461_336_1121 261
210 3300046491 Ga0495584_0044712 Ga0495584_0044712_1245_2030 261
211 3300046492 Ga0495585_0003335 Ga0495585_0003335_4400_5191 261
212 3300046499 Ga0495594_0007839 Ga0495594_0007839_3389_4180 261
213 3300046512 Ga0495610_0000428 Ga0495610_0000428_20011_20796 261
214 3300046512 Ga0495610_0001171 Ga0495610_0001171_3801_4586 261
215 3300046523 Ga0495644_0051309 Ga0495644_0051309_35_820 261
216 3300046524 Ga0495648_0029956 Ga0495648_0029956_2448_3239 261
217 3300046528 Ga0495642_0001165 Ga0495642_0001165_10176_10964 261
218 3300046528 Ga0495642_0102339 Ga0495642_0102339_315_1100 261
219 3300046538 Ga0495609_0000856 Ga0495609_0000856_21550_22341 261
220 3300046558 Ga0495633_0016694 Ga0495633_0016694_355_1140 261
221 3300046558 Ga0495633_0020676 Ga0495633_0020676_2427_3212 261
222 3300046558 Ga0495633_0027375 Ga0495633_0027375_692_1477 261
223 3300046616 Ga0495668_0000051 Ga0495668_0000051_171319_172104 261
224 3300046660 Ga0495625_0131054 Ga0495625_0131054_896_1687 261
225 3300047320 Ga0495672_0100740 Ga0495672_0100740_172_984 261
226 3300047323 Ga0495683_0007893 Ga0495683_0007893_1100_1885 261
227 3300047446 Ga0495679_011850 Ga0495679_011850_1507_2292 261
228 3300047469 Ga0495673_0000017 Ga0495673_0000017_331156_331941 261
229 3300047472 Ga0495686_0021104 Ga0495686_0021104_2848_3633 261
230 3300048091 Ga0495626_0001122 Ga0495626_0001122_21201_21986 261
231 3300048091 Ga0495626_0001575 Ga0495626_0001575_14690_15481 261
232 3300048091 Ga0495626_0007954 Ga0495626_0007954_2033_2824 261
233 3300048906 Ga0496103_0008794 Ga0496103_0008794_3357_4142 261
234 3300048906 Ga0496103_0150959 Ga0496103_0150959_510_1301 261
235 3300048918 Ga0496115_0025058 Ga0496115_0025058_975_1760 261
236 3300048919 Ga0496116_0008949 Ga0496116_0008949_6337_7122 261
237 3300048920 Ga0496117_0030586 Ga0496117_0030586_1370_2155 261
238 3300048921 Ga0496118_0155211 Ga0496118_0155211_539_1324 261
239 3300048921 Ga0496118_0188913 Ga0496118_0188913_71_856 261
240 iso_pu_bacteria 2511231007 2511273008 261
241 iso_pu_bacteria 2554235132 2554818575 261
242 iso_pu_bacteria 2606217733 2608384239 261
243 iso_pu_bacteria 2643221562 2643831111 261
244 iso_pu_bacteria 2643221603 2644027402 261
245 3300046517 Ga0495630_0258890 Ga0495630_0258890_396_1190 262
246 3300046536 Ga0495587_0303542 Ga0495587_0303542_66_860 262
247 3300046660 Ga0495625_0341234 Ga0495625_0341234_115_903 262
248 3300046809 Ga0495600_0109674 Ga0495600_0109674_828_1622 262
249 3300049823 Ga0501044_0237922 Ga0501044_0237922_505_1293 262
250 iso_pu_bacteria 2643221645 2644250951 262
251 iso_pu_bacteria 2643221664 2644356366 262
252 iso_pu_bacteria 2738541297 2738825393 262
253 iso_pu_bacteria 2738541300 2738846226 262
254 iso_pu_bacteria 2738541357 2739149190 262
255 iso_pu_bacteria 2738543003 2739191109 262
256 iso_pu_bacteria 2738543018 2739275125 262
257 iso_pu_bacteria 2738543026 2739317586 262
258 iso_pu_bacteria 2738543029 2739335827 262
259 iso_pu_bacteria 2738543030 2739344169 262
260 iso_pu_bacteria 2821131069 2821133991 262
261 iso_pu_bacteria 2857558681 2857564547 262
262 iso_pu_bacteria 2904424332 2904429204 262
263 iso_pu_bacteria 8047673197 8047677907 262
264 3300009011 Ga0105251_10001634 Ga0105251_100016347 263
265 3300009011 Ga0105251_10042925 Ga0105251_100429252 263
266 3300009098 Ga0105245_10052912 Ga0105245_100529123 263
267 3300025735 Ga0207713_1000024 Ga0207713_1000024320 263
268 3300031548 Ga0307408_100000461 Ga0307408_1000004614 263
269 3300041405 Ga0439438_000002 Ga0439438_000002_173552_174346 263
270 3300044684 Ga0466966_0011708 Ga0466966_0011708_4128_4922 263
271 3300044693 Ga0466961_0003208 Ga0466961_0003208_8027_8821 263
272 3300044765 Ga0466970_0000701 Ga0466970_0000701_14183_14977 263
273 3300045049 Ga0466959_0002124 Ga0466959_0002124_730_1524 263
274 3300046474 Ga0495605_0000169 Ga0495605_0000169_52282_53076 263
275 3300046507 Ga0495606_0000402 Ga0495606_0000402_34431_35225 263
276 3300048923 Ga0496120_0051956 Ga0496120_0051956_907_1701 263
277 3300053125 Ga0500618_000138 Ga0500618_000138_41162_41953 263
278 3300002771 JGI25163J39215_1000028 JGI25163J39215_100002843 264
279 3300002772 JGI25164J39214_1000107 JGI25164J39214_100010727 264
280 3300002773 JGI25152J39213_1014295 JGI25152J39213_10142951 264
281 3300003214 JGI25165J46597_1000218 JGI25165J46597_100021827 264
282 3300003316 rootH1_10043487 rootH1_100434872 264
283 3300005353 Ga0070669_100290047 Ga0070669_1002900472 264
284 3300005563 Ga0068855_100006913 Ga0068855_1000069139 264
285 3300013100 Ga0157373_10005862 Ga0157373_1000586211 264
286 3300013105 Ga0157369_10013873 Ga0157369_1001387311 264
287 3300021361 Ga0213872_10011940 Ga0213872_100119402 264
288 3300025207 Ga0209760_100020 Ga0209760_100020108 264
289 3300025231 Ga0207427_100006 Ga0207427_100006156 264
290 3300025233 Ga0209437_100013 Ga0209437_100013156 264
291 3300025258 Ga0209129_1002747 Ga0209129_10027476 264
292 3300025261 Ga0209233_1000022 Ga0209233_1000022156 264
293 3300025949 Ga0207667_10006285 Ga0207667_100062853 264
294 3300031251 Ga0265327_10059110 Ga0265327_100591101 264
295 3300038742 Ga0400486_23214 Ga0400486_23214_1767_2561 264
296 3300039093 Ga0400489_53656 Ga0400489_53656_12096_12890 264
297 3300039447 Ga0436361_0154055 Ga0436361_0154055_46850_47647 264
298 3300039447 Ga0436361_1165509 Ga0436361_1165509_2815_3612 264
299 3300044673 Ga0453683_0014203 Ga0453683_0014203_3744_4538 264
300 3300046452 Ga0495617_105191 Ga0495617_105191_54_848 264
301 3300046457 Ga0495590_0004196 Ga0495590_0004196_4976_5773 264
302 3300046458 Ga0495591_000310 Ga0495591_000310_38768_39562 264
303 3300046459 Ga0495629_0017142 Ga0495629_0017142_2703_3497 264
304 3300046471 Ga0495650_0001964 Ga0495650_0001964_1529_2326 264
305 3300046471 Ga0495650_0077965 Ga0495650_0077965_122_916 264
306 3300046501 Ga0495607_0000261 Ga0495607_0000261_39739_40536 264
307 3300046513 Ga0495616_0001272 Ga0495616_0001272_15571_16368 264
308 3300046519 Ga0495632_0009303 Ga0495632_0009303_437_1231 264
309 3300046692 Ga0495671_0072158 Ga0495671_0072158_379_1173 264
310 3300047319 Ga0495674_0003686 Ga0495674_0003686_4501_5295 264
311 3300047446 Ga0495679_017285 Ga0495679_017285_1767_2561 264
312 3300047469 Ga0495673_0024772 Ga0495673_0024772_437_1231 264
313 3300047470 Ga0495681_0000168 Ga0495681_0000168_38346_39143 264
314 3300048091 Ga0495626_0003190 Ga0495626_0003190_436_1230 264
315 3300048922 Ga0496119_0008370 Ga0496119_0008370_211_1005 264
316 3300048927 Ga0496124_0010167 Ga0496124_0010167_631_1425 264
317 3300059652 Ga0587107_007464 Ga0587107_007464_252_1046 264
318 3300003759 Ga0055525_1000135 Ga0055525_100013547 265
319 3300005578 Ga0068854_100140395 Ga0068854_1001403952 265
320 3300009174 Ga0105241_10343692 Ga0105241_103436922 265
321 3300013104 Ga0157370_10004280 Ga0157370_100042805 265
322 3300014497 Ga0182008_10101808 Ga0182008_101018081 265
323 3300025230 Ga0209563_100036 Ga0209563_10003685 265
324 3300025981 Ga0207640_10124573 Ga0207640_101245732 265
325 3300041407 Ga0439447_000704 Ga0439447_000704_10048_10845 265
326 3300041411 Ga0439466_0000913 Ga0439466_0000913_449_1246 265
327 3300042009 Ga0439451_002484 Ga0439451_002484_1232_2029 265
328 3300042010 Ga0439452_001060 Ga0439452_001060_1160_1957 265
329 3300042013 Ga0439456_000306 Ga0439456_000306_449_1246 265
330 3300042013 Ga0439456_012038 Ga0439456_012038_508_1305 265
331 3300042435 Ga0439434_0000037 Ga0439434_0000037_23651_24448 265
332 3300044658 Ga0466972_0000029 Ga0466972_0000029_109462_110259 265
333 3300044683 Ga0466965_0000599 Ga0466965_0000599_5738_6535 265
334 3300044706 Ga0466964_0009814 Ga0466964_0009814_2044_2841 265
335 3300044706 Ga0466964_0046403 Ga0466964_0046403_242_1039 265
336 3300044765 Ga0466970_0004144 Ga0466970_0004144_5024_5821 265
337 3300045049 Ga0466959_0021570 Ga0466959_0021570_1498_2295 265
338 3300046492 Ga0495585_0000451 Ga0495585_0000451_22029_22826 265
339 3300046492 Ga0495585_0001154 Ga0495585_0001154_3203_4000 265
340 3300046507 Ga0495606_0000533 Ga0495606_0000533_17084_17884 265
341 3300046512 Ga0495610_0000004 Ga0495610_0000004_652610_653407 265
342 3300046512 Ga0495610_0024589 Ga0495610_0024589_1570_2367 265
343 3300046558 Ga0495633_0001029 Ga0495633_0001029_6701_7498 265
344 3300046558 Ga0495633_0002925 Ga0495633_0002925_717_1514 265
345 3300046692 Ga0495671_0000602 Ga0495671_0000602_14413_15210 265
346 3300047320 Ga0495672_0000695 Ga0495672_0000695_7897_8694 265
347 3300047321 Ga0495676_0112139 Ga0495676_0112139_583_1380 265
348 3300047446 Ga0495679_000979 Ga0495679_000979_1004_1801 265
349 3300047469 Ga0495673_0000027 Ga0495673_0000027_159253_160053 265
350 3300047472 Ga0495686_0000696 Ga0495686_0000696_28379_29179 265
351 3300048927 Ga0496124_0185603 Ga0496124_0185603_593_1390 265
352 3300049459 Ga0495678_006643 Ga0495678_006643_4470_5267 265
353 iso_pu_bacteria 2808606418 2809144391 265
354 iso_pu_bacteria 2932422444 2932422618 265
355 3300002738 JGI25154J39366_1002119 JGI25154J39366_10021192 266
356 3300002987 JGI25159J45721_1000601 JGI25159J45721_10006015 266
357 3300003771 Ga0055526_1000110 Ga0055526_100011022 266
358 3300003773 Ga0055537_1000284 Ga0055537_100028413 266
359 3300003775 Ga0055524_1006844 Ga0055524_10068442 266
360 3300003784 Ga0055534_1000059 Ga0055534_100005922 266
361 3300003790 Ga0055528_1000124 Ga0055528_100012443 266
362 3300004625 Ga0055543_1007100 Ga0055543_10071003 266
363 3300005262 Ga0065165_1000050 Ga0065165_1000050130 266
364 3300005344 Ga0070661_100227593 Ga0070661_1002275932 266
365 3300005564 Ga0070664_100213336 Ga0070664_1002133362 266
366 3300006028 Ga0070717_10094997 Ga0070717_100949972 266
367 3300006948 Ga0099826_10000003 Ga0099826_10000003415 266
368 3300009036 Ga0105244_10006422 Ga0105244_100064224 266
369 3300009036 Ga0105244_10007894 Ga0105244_100078942 266
370 3300009148 Ga0105243_10001703 Ga0105243_100017032 266
371 3300009551 Ga0105238_10055978 Ga0105238_100559783 266
372 3300013102 Ga0157371_10000001 Ga0157371_10000001788 266
373 3300013104 Ga0157370_10074910 Ga0157370_100749102 266
374 3300013105 Ga0157369_10675990 Ga0157369_106759901 266
375 3300013307 Ga0157372_10094965 Ga0157372_100949652 266
376 3300021361 Ga0213872_10005552 Ga0213872_100055525 266
377 3300025208 Ga0209436_104856 Ga0209436_1048563 266
378 3300025246 Ga0209646_1000117 Ga0209646_10001174 266
379 3300025250 Ga0209026_1009208 Ga0209026_10092082 266
380 3300025254 Ga0209148_1000298 Ga0209148_100029841 266
381 3300025263 Ga0209565_1000006 Ga0209565_1000006135 266
382 3300025273 Ga0209673_1000004 Ga0209673_1000004694 266
383 3300025284 Ga0209130_1000065 Ga0209130_1000065129 266
384 3300025291 Ga0209675_1000006 Ga0209675_1000006134 266
385 3300025294 Ga0209025_1004912 Ga0209025_10049122 266
386 3300025295 Ga0209564_1000038 Ga0209564_1000038257 266
387 3300025295 Ga0209564_1000064 Ga0209564_1000064143 266
388 3300025295 Ga0209564_1041708 Ga0209564_10417081 266
389 3300025297 Ga0209758_1000803 Ga0209758_100080311 266
390 3300025299 Ga0209256_1000013 Ga0209256_100001313 266
391 3300025299 Ga0209256_1000365 Ga0209256_100036533 266
392 3300025728 Ga0207655_1017635 Ga0207655_10176353 266
393 3300025728 Ga0207655_1019803 Ga0207655_10198033 266
394 3300025920 Ga0207649_10111432 Ga0207649_101114322 266
395 3300025945 Ga0207679_10295864 Ga0207679_102958642 266
396 3300025949 Ga0207667_10421009 Ga0207667_104210092 266
397 3300026035 Ga0207703_10454247 Ga0207703_104542471 266
398 3300027666 Ga0209282_1000002 Ga0209282_1000002583 266
399 3300031238 Ga0265332_10044632 Ga0265332_100446322 266
400 3300031250 Ga0265331_10090732 Ga0265331_100907322 266
401 3300031344 Ga0265316_10321435 Ga0265316_103214351 266
402 3300031711 Ga0265314_10001032 Ga0265314_1000103214 266
403 3300031712 Ga0265342_10141992 Ga0265342_101419922 266
404 3300032005 Ga0307411_10104209 Ga0307411_101042092 266
405 3300037312 Ga0395899_0000141 Ga0395899_0000141_41374_42174 266
406 3300037312 Ga0395899_0000962 Ga0395899_0000962_19246_20046 266
407 3300037312 Ga0395899_0048791 Ga0395899_0048791_855_1661 266
408 3300037312 Ga0395899_0235813 Ga0395899_0235813_279_1082 266
409 3300037312 Ga0395899_0358560 Ga0395899_0358560_106_912 266
410 3300037418 Ga0395900_0000550 Ga0395900_0000550_21525_22331 266
411 3300037418 Ga0395900_0271209 Ga0395900_0271209_217_1023 266
412 3300037471 Ga0395905_0173557 Ga0395905_0173557_725_1531 266
413 3300038443 Ga0395901_0000073 Ga0395901_0000073_65981_66787 266
414 3300039447 Ga0436361_0584108 Ga0436361_0584108_2459_3259 266
415 3300044658 Ga0466972_0007618 Ga0466972_0007618_4326_5129 266
416 3300044673 Ga0453683_0001365 Ga0453683_0001365_596_1432 266
417 3300044693 Ga0466961_0181121 Ga0466961_0181121_153_956 266
418 3300044706 Ga0466964_0003420 Ga0466964_0003420_4629_5432 266
419 3300044735 Ga0466968_0002143 Ga0466968_0002143_3686_4489 266
420 3300044765 Ga0466970_0313579 Ga0466970_0313579_49_852 266
421 3300044842 Ga0466957_0007223 Ga0466957_0007223_1154_1954 266
422 3300044842 Ga0466957_0300242 Ga0466957_0300242_206_1006 266
423 3300045049 Ga0466959_0063627 Ga0466959_0063627_795_1598 266
424 3300045051 Ga0451576_0003730 Ga0451576_0003730_16626_17462 266
425 3300046452 Ga0495617_000007 Ga0495617_000007_238828_239628 266
426 3300046452 Ga0495617_000138 Ga0495617_000138_29078_29878 266
427 3300046452 Ga0495617_000433 Ga0495617_000433_6997_7797 266
428 3300046453 Ga0495627_000174 Ga0495627_000174_54283_55089 266
429 3300046453 Ga0495627_011935 Ga0495627_011935_415_1215 266
430 3300046455 Ga0495603_0012022 Ga0495603_0012022_4177_4983 266
431 3300046457 Ga0495590_0000004 Ga0495590_0000004_110005_110805 266
432 3300046457 Ga0495590_0000007 Ga0495590_0000007_169678_170478 266
433 3300046457 Ga0495590_0000287 Ga0495590_0000287_4337_5143 266
434 3300046458 Ga0495591_000039 Ga0495591_000039_104064_104864 266
435 3300046459 Ga0495629_0004670 Ga0495629_0004670_6080_6961 266
436 3300046460 Ga0495638_0000023 Ga0495638_0000023_153855_154655 266
437 3300046460 Ga0495638_0010460 Ga0495638_0010460_1696_2496 266
438 3300046460 Ga0495638_0045065 Ga0495638_0045065_186_992 266
439 3300046460 Ga0495638_0048659 Ga0495638_0048659_126_926 266
440 3300046460 Ga0495638_0066732 Ga0495638_0066732_582_1382 266
441 3300046463 Ga0495653_0008794 Ga0495653_0008794_5190_6059 266
442 3300046463 Ga0495653_0159421 Ga0495653_0159421_47_928 266
443 3300046471 Ga0495650_0000320 Ga0495650_0000320_39686_40492 266
444 3300046472 Ga0495580_0183491 Ga0495580_0183491_404_1210 266
445 3300046472 Ga0495580_0192523 Ga0495580_0192523_557_1357 266
446 3300046473 Ga0495582_0003493 Ga0495582_0003493_6308_7114 266
447 3300046473 Ga0495582_0025219 Ga0495582_0025219_2130_3011 266
448 3300046473 Ga0495582_0117379 Ga0495582_0117379_248_1048 266
449 3300046474 Ga0495605_0000133 Ga0495605_0000133_60668_61474 266
450 3300046474 Ga0495605_0020011 Ga0495605_0020011_2736_3539 266
451 3300046474 Ga0495605_0046434 Ga0495605_0046434_251_1051 266
452 3300046474 Ga0495605_0055141 Ga0495605_0055141_689_1495 266
453 3300046475 Ga0495639_0087431 Ga0495639_0087431_521_1321 266
454 3300046491 Ga0495584_0000010 Ga0495584_0000010_147529_148329 266
455 3300046491 Ga0495584_0001011 Ga0495584_0001011_14675_15475 266
456 3300046491 Ga0495584_0001901 Ga0495584_0001901_16_816 266
457 3300046491 Ga0495584_0009175 Ga0495584_0009175_656_1456 266
458 3300046491 Ga0495584_0062617 Ga0495584_0062617_126_926 266
459 3300046491 Ga0495584_0075250 Ga0495584_0075250_656_1456 266
460 3300046491 Ga0495584_0138493 Ga0495584_0138493_134_934 266
461 3300046491 Ga0495584_0212819 Ga0495584_0212819_132_932 266
462 3300046492 Ga0495585_0000004 Ga0495585_0000004_68144_68944 266
463 3300046492 Ga0495585_0000935 Ga0495585_0000935_16157_16957 266
464 3300046492 Ga0495585_0001097 Ga0495585_0001097_15205_16005 266
465 3300046492 Ga0495585_0001166 Ga0495585_0001166_11356_12162 266
466 3300046492 Ga0495585_0001278 Ga0495585_0001278_766_1566 266
467 3300046492 Ga0495585_0024506 Ga0495585_0024506_621_1421 266
468 3300046492 Ga0495585_0046425 Ga0495585_0046425_770_1570 266
469 3300046492 Ga0495585_0047395 Ga0495585_0047395_82_882 266
470 3300046492 Ga0495585_0063889 Ga0495585_0063889_79_888 266
471 3300046492 Ga0495585_0102595 Ga0495585_0102595_648_1454 266
472 3300046492 Ga0495585_0130479 Ga0495585_0130479_222_1022 266
473 3300046499 Ga0495594_0020081 Ga0495594_0020081_929_1729 266
474 3300046500 Ga0495596_0000608 Ga0495596_0000608_15432_16232 266
475 3300046500 Ga0495596_0000617 Ga0495596_0000617_10449_11249 266
476 3300046500 Ga0495596_0001806 Ga0495596_0001806_6958_7758 266
477 3300046500 Ga0495596_0004514 Ga0495596_0004514_2375_3181 266
478 3300046500 Ga0495596_0006947 Ga0495596_0006947_2314_3114 266
479 3300046500 Ga0495596_0010807 Ga0495596_0010807_61_867 266
480 3300046500 Ga0495596_0011029 Ga0495596_0011029_1440_2246 266
481 3300046500 Ga0495596_0060511 Ga0495596_0060511_20_820 266
482 3300046501 Ga0495607_0001157 Ga0495607_0001157_22756_23556 266
483 3300046501 Ga0495607_0002475 Ga0495607_0002475_2434_3234 266
484 3300046501 Ga0495607_0018160 Ga0495607_0018160_2347_3153 266
485 3300046501 Ga0495607_0032895 Ga0495607_0032895_1892_2695 266
486 3300046501 Ga0495607_0033200 Ga0495607_0033200_2180_2980 266
487 3300046501 Ga0495607_0179741 Ga0495607_0179741_97_897 266
488 3300046506 Ga0495583_0000084 Ga0495583_0000084_41643_42443 266
489 3300046506 Ga0495583_0001335 Ga0495583_0001335_5606_6406 266
490 3300046506 Ga0495583_0001776 Ga0495583_0001776_18147_18953 266
491 3300046506 Ga0495583_0003212 Ga0495583_0003212_8700_9506 266
492 3300046506 Ga0495583_0005922 Ga0495583_0005922_6423_7229 266
493 3300046506 Ga0495583_0031730 Ga0495583_0031730_1574_2374 266
494 3300046506 Ga0495583_0045571 Ga0495583_0045571_1119_1919 266
495 3300046506 Ga0495583_0115797 Ga0495583_0115797_244_1050 266
496 3300046506 Ga0495583_0124301 Ga0495583_0124301_40_849 266
497 3300046507 Ga0495606_0000037 Ga0495606_0000037_54861_55661 266
498 3300046507 Ga0495606_0000576 Ga0495606_0000576_9552_10352 266
499 3300046507 Ga0495606_0002384 Ga0495606_0002384_13379_14179 266
500 3300046507 Ga0495606_0002810 Ga0495606_0002810_5812_6612 266
501 3300046507 Ga0495606_0009074 Ga0495606_0009074_305_1105 266
502 3300046507 Ga0495606_0012562 Ga0495606_0012562_2566_3366 266
503 3300046507 Ga0495606_0019010 Ga0495606_0019010_1181_1987 266
504 3300046507 Ga0495606_0039354 Ga0495606_0039354_1248_2048 266
505 3300046507 Ga0495606_0050693 Ga0495606_0050693_1119_1928 266
506 3300046507 Ga0495606_0052508 Ga0495606_0052508_1557_2360 266
507 3300046507 Ga0495606_0055725 Ga0495606_0055725_648_1448 266
508 3300046512 Ga0495610_0000128 Ga0495610_0000128_43951_44751 266
509 3300046512 Ga0495610_0005473 Ga0495610_0005473_6699_7499 266
510 3300046513 Ga0495616_0000269 Ga0495616_0000269_35924_36724 266
511 3300046513 Ga0495616_0000344 Ga0495616_0000344_30597_31397 266
512 3300046513 Ga0495616_0001060 Ga0495616_0001060_4598_5404 266
513 3300046513 Ga0495616_0001627 Ga0495616_0001627_14528_15334 266
514 3300046513 Ga0495616_0002122 Ga0495616_0002122_5226_6032 266
515 3300046513 Ga0495616_0012422 Ga0495616_0012422_3604_4410 266
516 3300046513 Ga0495616_0014231 Ga0495616_0014231_2684_3484 266
517 3300046513 Ga0495616_0028294 Ga0495616_0028294_2042_2842 266
518 3300046513 Ga0495616_0034553 Ga0495616_0034553_630_1430 266
519 3300046513 Ga0495616_0048310 Ga0495616_0048310_254_1057 266
520 3300046513 Ga0495616_0069156 Ga0495616_0069156_185_985 266
521 3300046513 Ga0495616_0079823 Ga0495616_0079823_688_1488 266
522 3300046515 Ga0495620_0025247 Ga0495620_0025247_684_1493 266
523 3300046518 Ga0495631_0000886 Ga0495631_0000886_13280_14080 266
524 3300046518 Ga0495631_0003700 Ga0495631_0003700_7270_8076 266
525 3300046518 Ga0495631_0021272 Ga0495631_0021272_1897_2703 266
526 3300046518 Ga0495631_0024386 Ga0495631_0024386_267_1073 266
527 3300046518 Ga0495631_0027447 Ga0495631_0027447_1314_2120 266
528 3300046518 Ga0495631_0042274 Ga0495631_0042274_598_1398 266
529 3300046519 Ga0495632_0000504 Ga0495632_0000504_16751_17557 266
530 3300046519 Ga0495632_0006690 Ga0495632_0006690_208_1008 266
531 3300046519 Ga0495632_0032005 Ga0495632_0032005_1772_2572 266
532 3300046520 Ga0495637_0000006 Ga0495637_0000006_415434_416234 266
533 3300046520 Ga0495637_0000223 Ga0495637_0000223_23307_24107 266
534 3300046520 Ga0495637_0024391 Ga0495637_0024391_1441_2241 266
535 3300046522 Ga0495643_0000196 Ga0495643_0000196_85582_86394 266
536 3300046522 Ga0495643_0000239 Ga0495643_0000239_30543_31343 266
537 3300046522 Ga0495643_0130596 Ga0495643_0130596_40_843 266
538 3300046522 Ga0495643_0219819 Ga0495643_0219819_91_891 266
539 3300046523 Ga0495644_0012766 Ga0495644_0012766_433_1239 266
540 3300046523 Ga0495644_0037310 Ga0495644_0037310_642_1442 266
541 3300046524 Ga0495648_0000007 Ga0495648_0000007_34691_35491 266
542 3300046524 Ga0495648_0001034 Ga0495648_0001034_11818_12687 266
543 3300046524 Ga0495648_0002116 Ga0495648_0002116_71_877 266
544 3300046524 Ga0495648_0005003 Ga0495648_0005003_80_886 266
545 3300046524 Ga0495648_0009830 Ga0495648_0009830_1323_2123 266
546 3300046524 Ga0495648_0018262 Ga0495648_0018262_537_1340 266
547 3300046524 Ga0495648_0029372 Ga0495648_0029372_1855_2661 266
548 3300046524 Ga0495648_0088687 Ga0495648_0088687_40_846 266
549 3300046524 Ga0495648_0149311 Ga0495648_0149311_53_859 266
550 3300046524 Ga0495648_0162848 Ga0495648_0162848_177_977 266
551 3300046525 Ga0495663_0073619 Ga0495663_0073619_260_1060 266
552 3300046526 Ga0495666_0047360 Ga0495666_0047360_261_1067 266
553 3300046526 Ga0495666_0075095 Ga0495666_0075095_372_1172 266
554 3300046528 Ga0495642_0000383 Ga0495642_0000383_18413_19219 266
555 3300046528 Ga0495642_0000499 Ga0495642_0000499_19304_20110 266
556 3300046528 Ga0495642_0001497 Ga0495642_0001497_4646_5446 266
557 3300046528 Ga0495642_0001671 Ga0495642_0001671_2482_3291 266
558 3300046528 Ga0495642_0019207 Ga0495642_0019207_1728_2528 266
559 3300046528 Ga0495642_0053029 Ga0495642_0053029_404_1204 266
560 3300046528 Ga0495642_0072656 Ga0495642_0072656_93_899 266
561 3300046528 Ga0495642_0120098 Ga0495642_0120098_120_920 266
562 3300046529 Ga0495652_0024781 Ga0495652_0024781_2916_3722 266
563 3300046529 Ga0495652_0086848 Ga0495652_0086848_483_1364 266
564 3300046530 Ga0495654_0000004 Ga0495654_0000004_377133_377933 266
565 3300046530 Ga0495654_0001755 Ga0495654_0001755_12603_13409 266
566 3300046530 Ga0495654_0003847 Ga0495654_0003847_3397_4203 266
567 3300046530 Ga0495654_0006878 Ga0495654_0006878_538_1407 266
568 3300046531 Ga0495665_0053775 Ga0495665_0053775_164_970 266
569 3300046531 Ga0495665_0082749 Ga0495665_0082749_721_1602 266
570 3300046535 Ga0495586_0005660 Ga0495586_0005660_3704_4573 266
571 3300046536 Ga0495587_0009893 Ga0495587_0009893_889_1770 266
572 3300046538 Ga0495609_0000545 Ga0495609_0000545_16385_17185 266
573 3300046538 Ga0495609_0000732 Ga0495609_0000732_6559_7359 266
574 3300046538 Ga0495609_0000832 Ga0495609_0000832_9306_10112 266
575 3300046538 Ga0495609_0000847 Ga0495609_0000847_3285_4085 266
576 3300046538 Ga0495609_0004528 Ga0495609_0004528_157_957 266
577 3300046538 Ga0495609_0021589 Ga0495609_0021589_1087_1893 266
578 3300046538 Ga0495609_0038242 Ga0495609_0038242_671_1471 266
579 3300046538 Ga0495609_0059848 Ga0495609_0059848_832_1632 266
580 3300046542 Ga0495597_0000239 Ga0495597_0000239_31016_31816 266
581 3300046542 Ga0495597_0000479 Ga0495597_0000479_15951_16757 266
582 3300046542 Ga0495597_0000496 Ga0495597_0000496_22056_22922 266
583 3300046542 Ga0495597_0001375 Ga0495597_0001375_14294_15100 266
584 3300046542 Ga0495597_0076063 Ga0495597_0076063_115_1002 266
585 3300046542 Ga0495597_0136501 Ga0495597_0136501_25_825 266
586 3300046542 Ga0495597_0136802 Ga0495597_0136802_86_886 266
587 3300046557 Ga0495622_0000003 Ga0495622_0000003_229583_230386 266
588 3300046557 Ga0495622_0007635 Ga0495622_0007635_86_886 266
589 3300046557 Ga0495622_0089412 Ga0495622_0089412_453_1253 266
590 3300046558 Ga0495633_0000541 Ga0495633_0000541_17431_18231 266
591 3300046558 Ga0495633_0003831 Ga0495633_0003831_5255_6055 266
592 3300046558 Ga0495633_0005412 Ga0495633_0005412_1107_1919 266
593 3300046558 Ga0495633_0015370 Ga0495633_0015370_638_1438 266
594 3300046558 Ga0495633_0043503 Ga0495633_0043503_823_1629 266
595 3300046558 Ga0495633_0167059 Ga0495633_0167059_65_865 266
596 3300046615 Ga0495656_0007063 Ga0495656_0007063_239_1039 266
597 3300046615 Ga0495656_0037398 Ga0495656_0037398_957_1757 266
598 3300046615 Ga0495656_0061928 Ga0495656_0061928_300_1106 266
599 3300046616 Ga0495668_0000049 Ga0495668_0000049_22945_23745 266
600 3300046616 Ga0495668_0001802 Ga0495668_0001802_2143_2949 266
601 3300046616 Ga0495668_0001821 Ga0495668_0001821_3248_4048 266
602 3300046616 Ga0495668_0002559 Ga0495668_0002559_6726_7526 266
603 3300046616 Ga0495668_0003825 Ga0495668_0003825_7247_8053 266
604 3300046616 Ga0495668_0011300 Ga0495668_0011300_1085_1885 266
605 3300046616 Ga0495668_0043218 Ga0495668_0043218_371_1171 266
606 3300046616 Ga0495668_0064421 Ga0495668_0064421_422_1222 266
607 3300046616 Ga0495668_0105447 Ga0495668_0105447_71_880 266
608 3300046616 Ga0495668_0271193 Ga0495668_0271193_112_912 266
609 3300046642 Ga0495634_0058086 Ga0495634_0058086_830_1711 266
610 3300046648 Ga0495611_0000496 Ga0495611_0000496_22015_22815 266
611 3300046648 Ga0495611_0054994 Ga0495611_0054994_951_1757 266
612 3300046648 Ga0495611_0061461 Ga0495611_0061461_277_1083 266
613 3300046660 Ga0495625_0023566 Ga0495625_0023566_2174_2974 266
614 3300046660 Ga0495625_0035638 Ga0495625_0035638_888_1694 266
615 3300046660 Ga0495625_0085276 Ga0495625_0085276_145_945 266
616 3300046660 Ga0495625_0172548 Ga0495625_0172548_375_1175 266
617 3300046660 Ga0495625_0254275 Ga0495625_0254275_226_1032 266
618 3300046663 Ga0495635_0020507 Ga0495635_0020507_85_954 266
619 3300046664 Ga0495659_0018014 Ga0495659_0018014_1346_2146 266
620 3300046664 Ga0495659_0034369 Ga0495659_0034369_621_1421 266
621 3300046665 Ga0495661_0000802 Ga0495661_0000802_11329_12135 266
622 3300046665 Ga0495661_0012141 Ga0495661_0012141_4067_4867 266
623 3300046665 Ga0495661_0012900 Ga0495661_0012900_3097_3903 266
624 3300046665 Ga0495661_0020847 Ga0495661_0020847_584_1387 266
625 3300046665 Ga0495661_0023696 Ga0495661_0023696_1342_2145 266
626 3300046665 Ga0495661_0057951 Ga0495661_0057951_370_1170 266
627 3300046665 Ga0495661_0088408 Ga0495661_0088408_331_1131 266
628 3300046665 Ga0495661_0121830 Ga0495661_0121830_499_1305 266
629 3300046665 Ga0495661_0126846 Ga0495661_0126846_255_1055 266
630 3300046665 Ga0495661_0134896 Ga0495661_0134896_223_1023 266
631 3300046665 Ga0495661_0198110 Ga0495661_0198110_229_1029 266
632 3300046674 Ga0495588_0000226 Ga0495588_0000226_20265_21068 266
633 3300046674 Ga0495588_0000447 Ga0495588_0000447_14652_15452 266
634 3300046674 Ga0495588_0017069 Ga0495588_0017069_1721_2521 266
635 3300046674 Ga0495588_0017445 Ga0495588_0017445_2165_2971 266
636 3300046674 Ga0495588_0031570 Ga0495588_0031570_1694_2494 266
637 3300046674 Ga0495588_0032033 Ga0495588_0032033_607_1407 266
638 3300046674 Ga0495588_0111710 Ga0495588_0111710_252_1052 266
639 3300046679 Ga0495623_0065228 Ga0495623_0065228_913_1794 266
640 3300046684 Ga0495669_0001886 Ga0495669_0001886_4470_5276 266
641 3300046684 Ga0495669_0010859 Ga0495669_0010859_673_1479 266
642 3300046684 Ga0495669_0020156 Ga0495669_0020156_536_1336 266
643 3300046684 Ga0495669_0067605 Ga0495669_0067605_51_851 266
644 3300046689 Ga0495613_0107974 Ga0495613_0107974_268_1137 266
645 3300046690 Ga0495624_0013524 Ga0495624_0013524_4607_5407 266
646 3300046691 Ga0495670_0007797 Ga0495670_0007797_205_1011 266
647 3300046691 Ga0495670_0009193 Ga0495670_0009193_1004_1804 266
648 3300046691 Ga0495670_0040525 Ga0495670_0040525_1466_2272 266
649 3300046691 Ga0495670_0048885 Ga0495670_0048885_295_1095 266
650 3300046692 Ga0495671_0000070 Ga0495671_0000070_28569_29369 266
651 3300046692 Ga0495671_0000192 Ga0495671_0000192_50942_51748 266
652 3300046692 Ga0495671_0000483 Ga0495671_0000483_15829_16635 266
653 3300046692 Ga0495671_0001766 Ga0495671_0001766_6345_7145 266
654 3300046692 Ga0495671_0013388 Ga0495671_0013388_2768_3568 266
655 3300046692 Ga0495671_0041693 Ga0495671_0041693_444_1250 266
656 3300046692 Ga0495671_0046098 Ga0495671_0046098_153_953 266
657 3300046694 Ga0495649_0000424 Ga0495649_0000424_18642_19442 266
658 3300046694 Ga0495649_0057588 Ga0495649_0057588_98_898 266
659 3300046694 Ga0495649_0123385 Ga0495649_0123385_289_1089 266
660 3300046694 Ga0495649_0183789 Ga0495649_0183789_20_820 266
661 3300046794 Ga0495589_0000188 Ga0495589_0000188_49073_49879 266
662 3300046794 Ga0495589_0000921 Ga0495589_0000921_16739_17545 266
663 3300046794 Ga0495589_0008404 Ga0495589_0008404_3981_4781 266
664 3300046794 Ga0495589_0014417 Ga0495589_0014417_3191_3991 266
665 3300046794 Ga0495589_0020128 Ga0495589_0020128_1972_2772 266
666 3300046810 Ga0495660_0001755 Ga0495660_0001755_7147_7950 266
667 3300046810 Ga0495660_0027715 Ga0495660_0027715_485_1285 266
668 3300046810 Ga0495660_0066006 Ga0495660_0066006_884_1690 266
669 3300046810 Ga0495660_0131388 Ga0495660_0131388_53_853 266
670 3300046810 Ga0495660_0158241 Ga0495660_0158241_208_1008 266
671 3300047317 Ga0495604_0007372 Ga0495604_0007372_2485_3291 266
672 3300047318 Ga0495636_0017913 Ga0495636_0017913_1128_1928 266
673 3300047318 Ga0495636_0074010 Ga0495636_0074010_152_952 266
674 3300047320 Ga0495672_0000441 Ga0495672_0000441_3365_4171 266
675 3300047320 Ga0495672_0001226 Ga0495672_0001226_18464_19264 266
676 3300047321 Ga0495676_0000014 Ga0495676_0000014_124473_125273 266
677 3300047321 Ga0495676_0005083 Ga0495676_0005083_5345_6166 266
678 3300047321 Ga0495676_0056475 Ga0495676_0056475_1201_2001 266
679 3300047322 Ga0495680_0013638 Ga0495680_0013638_1283_2152 266
680 3300047323 Ga0495683_0000180 Ga0495683_0000180_5611_6411 266
681 3300047323 Ga0495683_0000306 Ga0495683_0000306_28807_29607 266
682 3300047323 Ga0495683_0002293 Ga0495683_0002293_4897_5703 266
683 3300047323 Ga0495683_0060138 Ga0495683_0060138_563_1363 266
684 3300047323 Ga0495683_0070268 Ga0495683_0070268_237_1037 266
685 3300047323 Ga0495683_0080155 Ga0495683_0080155_722_1522 266
686 3300047323 Ga0495683_0118400 Ga0495683_0118400_380_1180 266
687 3300047323 Ga0495683_0135778 Ga0495683_0135778_198_998 266
688 3300047443 Ga0495687_000049 Ga0495687_000049_130986_131792 266
689 3300047443 Ga0495687_000088 Ga0495687_000088_93814_94620 266
690 3300047443 Ga0495687_000533 Ga0495687_000533_27397_28197 266
691 3300047443 Ga0495687_000732 Ga0495687_000732_18133_18933 266
692 3300047443 Ga0495687_000848 Ga0495687_000848_14928_15734 266
693 3300047443 Ga0495687_000928 Ga0495687_000928_19890_20693 266
694 3300047443 Ga0495687_026413 Ga0495687_026413_576_1376 266
695 3300047443 Ga0495687_034718 Ga0495687_034718_1415_2215 266
696 3300047444 Ga0495675_0011916 Ga0495675_0011916_868_1737 266
697 3300047445 Ga0495677_0000286 Ga0495677_0000286_6143_6943 266
698 3300047445 Ga0495677_0003494 Ga0495677_0003494_2492_3298 266
699 3300047445 Ga0495677_0010972 Ga0495677_0010972_714_1517 266
700 3300047445 Ga0495677_0053896 Ga0495677_0053896_288_1088 266
701 3300047445 Ga0495677_0090213 Ga0495677_0090213_58_858 266
702 3300047446 Ga0495679_000965 Ga0495679_000965_15905_16774 266
703 3300047446 Ga0495679_004840 Ga0495679_004840_1693_2499 266
704 3300047446 Ga0495679_015636 Ga0495679_015636_853_1653 266
705 3300047447 Ga0495685_008963 Ga0495685_008963_723_1529 266
706 3300047447 Ga0495685_009579 Ga0495685_009579_1852_2652 266
707 3300047470 Ga0495681_0000073 Ga0495681_0000073_74510_75310 266
708 3300047470 Ga0495681_0012405 Ga0495681_0012405_3219_4019 266
709 3300047470 Ga0495681_0012756 Ga0495681_0012756_3654_4454 266
710 3300047470 Ga0495681_0012820 Ga0495681_0012820_3199_3999 266
711 3300047470 Ga0495681_0060135 Ga0495681_0060135_258_1058 266
712 3300047470 Ga0495681_0069432 Ga0495681_0069432_579_1388 266
713 3300047472 Ga0495686_0001565 Ga0495686_0001565_17002_17802 266
714 3300047472 Ga0495686_0011457 Ga0495686_0011457_4432_5232 266
715 3300047472 Ga0495686_0018422 Ga0495686_0018422_1068_1868 266
716 3300047472 Ga0495686_0114693 Ga0495686_0114693_192_998 266
717 3300048088 Ga0495602_0001704 Ga0495602_0001704_21049_21855 266
718 3300048088 Ga0495602_0264797 Ga0495602_0264797_449_1255 266
719 3300048089 Ga0495614_0016008 Ga0495614_0016008_1590_2459 266
720 3300048089 Ga0495614_0103412 Ga0495614_0103412_208_1008 266
721 3300048091 Ga0495626_0000677 Ga0495626_0000677_26564_27367 266
722 3300048091 Ga0495626_0001656 Ga0495626_0001656_151_963 266
723 3300048091 Ga0495626_0002929 Ga0495626_0002929_2056_2856 266
724 3300048091 Ga0495626_0003269 Ga0495626_0003269_5169_5981 266
725 3300048091 Ga0495626_0019732 Ga0495626_0019732_2543_3343 266
726 3300048091 Ga0495626_0023535 Ga0495626_0023535_2083_2883 266
727 3300048091 Ga0495626_0044686 Ga0495626_0044686_428_1234 266
728 3300048091 Ga0495626_0061379 Ga0495626_0061379_656_1456 266
729 3300048091 Ga0495626_0094654 Ga0495626_0094654_135_941 266
730 3300048091 Ga0495626_0150249 Ga0495626_0150249_12_812 266
731 3300048091 Ga0495626_0150256 Ga0495626_0150256_171_971 266
732 3300048905 Ga0496102_0002678 Ga0496102_0002678_13844_14644 266
733 3300048905 Ga0496102_0286742 Ga0496102_0286742_225_1025 266
734 3300048906 Ga0496103_0019302 Ga0496103_0019302_755_1555 266
735 3300048908 Ga0496105_0257209 Ga0496105_0257209_352_1221 266
736 3300048909 Ga0496106_0006898 Ga0496106_0006898_28_834 266
737 3300048909 Ga0496106_0070812 Ga0496106_0070812_1794_2600 266
738 3300048913 Ga0496110_0252368 Ga0496110_0252368_491_1297 266
739 3300048914 Ga0496111_0032691 Ga0496111_0032691_2225_3025 266
740 3300048914 Ga0496111_0214931 Ga0496111_0214931_35_838 266
741 3300048918 Ga0496115_0001661 Ga0496115_0001661_5380_6246 266
742 3300048919 Ga0496116_0002320 Ga0496116_0002320_2247_3050 266
743 3300048920 Ga0496117_0056551 Ga0496117_0056551_453_1256 266
744 3300048922 Ga0496119_0022762 Ga0496119_0022762_1607_2410 266
745 3300048924 Ga0496121_0023379 Ga0496121_0023379_3699_4505 266
746 3300048925 Ga0496122_0003279 Ga0496122_0003279_2571_3374 266
747 3300048925 Ga0496122_0053369 Ga0496122_0053369_2222_3022 266
748 3300048926 Ga0496123_0001911 Ga0496123_0001911_11644_12447 266
749 3300048926 Ga0496123_0002716 Ga0496123_0002716_2417_3220 266
750 3300048926 Ga0496123_0003363 Ga0496123_0003363_13981_14781 266
751 3300048927 Ga0496124_0011735 Ga0496124_0011735_855_1658 266
752 3300048927 Ga0496124_0064232 Ga0496124_0064232_1121_1921 266
753 3300048927 Ga0496124_0265532 Ga0496124_0265532_424_1227 266
754 3300048928 Ga0496125_0004916 Ga0496125_0004916_1459_2262 266
755 3300048928 Ga0496125_0051385 Ga0496125_0051385_1431_2234 266
756 3300048928 Ga0496125_0127054 Ga0496125_0127054_161_967 266
757 3300048928 Ga0496125_0131621 Ga0496125_0131621_247_1050 266
758 3300048929 Ga0496126_0001412 Ga0496126_0001412_15202_16002 266
759 3300048929 Ga0496126_0104768 Ga0496126_0104768_213_1016 266
760 3300049459 Ga0495678_000056 Ga0495678_000056_83485_84285 266
761 3300049459 Ga0495678_000079 Ga0495678_000079_18480_19286 266
762 3300049459 Ga0495678_000449 Ga0495678_000449_22944_23744 266
763 3300049459 Ga0495678_000565 Ga0495678_000565_18167_18973 266
764 3300049460 Ga0495682_0000378 Ga0495682_0000378_17290_18096 266
765 3300049460 Ga0495682_0000610 Ga0495682_0000610_20014_20814 266
766 3300049460 Ga0495682_0011263 Ga0495682_0011263_410_1210 266
767 3300049460 Ga0495682_0040989 Ga0495682_0040989_461_1261 266
768 3300049460 Ga0495682_0046845 Ga0495682_0046845_152_952 266
769 3300049581 Ga0501047_0274909 Ga0501047_0274909_339_1145 266
770 3300049673 Ga0501240_019454 Ga0501240_019454_192_992 266
771 3300049822 Ga0501035_0003724 Ga0501035_0003724_13075_13881 266
772 3300059641 Ga0587068_012394 Ga0587068_012394_141_944 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

46

256

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8919 15 264
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.8832 15 264
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.883 15 266
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.879 15 264
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8786 15 264
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6253 71 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.595 67 255 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5411 70 266 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4585 71 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4381 67 255 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1G7ZXH7-F1-model_v4 Lipopolysaccharide transport system permease protein 0.9715 58 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A4P6L157-F1-model_v4 Transport permease protein 0.9698 2 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A0X8XC14-F1-model_v4 Transport permease protein 0.9694 33 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A1G7ZXH7-F1-model_v4 Lipopolysaccharide transport system permease protein 0.9669 58 266 GO:0005886
GO:0015920
GO:0140359
AF-A0A0X8XC14-F1-model_v4 Transport permease protein 0.9653 33 266 GO:0005886
GO:0015920
GO:0140359

Feature Viewer

pLDDT pTM Quality
84.56 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map