F479953

General Info

Members Datasets Scaffolds Average Seq Length
768 351 1536 186

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10414125|Ga0207674_104141253
Length 218
Sequence MAGSLPSVLVRSRRCTRTPPRSHGPIDTYEKEDEEKKMTDREQYTPGPMTAEVEKNGESWALVLTKDLRHSPDKVWDALTDPAQLREWAPFDADGNMGAEGNTVKLTTVGAPQLHVTETKVTRADKPELLEYTWGGFDMRWKLEPAGNGTRLTLWTNIARPFIAMGAAGWHICLDVLDHMLDGDPLGRIVGPDAMHFAPWQKLNEQYSQQFGIEKPKW

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
314 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
315 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
316 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
317 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
318 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
319 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
320 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
321 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
322 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
323 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
326 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
327 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
332 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
333 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
334 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
335 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
336 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
351 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.13
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0.26
Rhizoplane 3.12
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10414125 3300026116 Unclassified 1302
2 Ga0065715_10040118 3300005293 Bacteria 1515
3 Ga0065715_10107365 3300005293 Bacteria 2761
4 Ga0065715_10126911 3300005293 Bacteria 2098
5 Ga0070658_10004464 3300005327 Bacteria 11394
6 Ga0070676_10001467 3300005328 Bacteria 11937
7 Ga0070676_10104773 3300005328 Unclassified 1753
8 Ga0070683_100000795 3300005329 Bacteria 23309
9 Ga0070683_100007143 3300005329 Bacteria 9411
10 Ga0070683_100109611 3300005329 Bacteria 2604
11 Ga0070683_100125297 3300005329 Bacteria 2428
12 Ga0070683_100212432 3300005329 Unclassified 1838
13 Ga0070683_100542898 3300005329 Bacteria 1111
14 Ga0070690_100038488 3300005330 Bacteria 3018
15 Ga0070690_100060200 3300005330 Bacteria 2443
16 Ga0070670_100226419 3300005331 Bacteria 1627
17 Ga0070670_100254883 3300005331 Unclassified 1529
18 Ga0070670_100432311 3300005331 Bacteria 1165
19 Ga0068869_100052723 3300005334 Bacteria 2954
20 Ga0068869_100267018 3300005334 Bacteria 1372
21 Ga0070666_10007556 3300005335 Bacteria 6702
22 Ga0070666_10043303 3300005335 Bacteria 3014
23 Ga0070666_10048229 3300005335 Bacteria 2861
24 Ga0070666_10143558 3300005335 Bacteria 1663
25 Ga0070682_100007915 3300005337 Bacteria 5981
26 Ga0070682_100280108 3300005337 Bacteria 1215
27 Ga0070682_100326297 3300005337 Bacteria 1136
28 Ga0068868_100002415 3300005338 Bacteria 12931
29 Ga0068868_100376485 3300005338 Bacteria 1221
30 Ga0068868_101302211 3300005338 Bacteria 675
31 Ga0070660_100020628 3300005339 Bacteria 4847
32 Ga0070660_100240333 3300005339 Bacteria 1475
33 Ga0070660_100860087 3300005339 Bacteria 764
34 Ga0070660_100909385 3300005339 Bacteria 742
35 Ga0070689_100118810 3300005340 Bacteria 2110
36 Ga0070691_10028947 3300005341 Bacteria 2590
37 Ga0070687_100006786 3300005343 Bacteria 4720
38 Ga0070687_100145373 3300005343 Bacteria 1385
39 Ga0070687_100349317 3300005343 Bacteria 954
40 Ga0070661_100009261 3300005344 Bacteria 6808
41 Ga0070661_100018820 3300005344 Bacteria 4915
42 Ga0070661_100101542 3300005344 Bacteria 2140
43 Ga0070661_100303413 3300005344 Bacteria 1243
44 Ga0070661_100748283 3300005344 Bacteria 799
45 Ga0070668_100011189 3300005347 Bacteria 6681
46 Ga0070669_100067681 3300005353 Bacteria 2635
47 Ga0070669_100078274 3300005353 Bacteria 2457
48 Ga0070669_100111329 3300005353 Bacteria 2078
49 Ga0070669_100142059 3300005353 Bacteria 1852
50 Ga0070669_100519381 3300005353 Bacteria 990
51 Ga0070675_100042568 3300005354 Bacteria 3710
52 Ga0070675_100164906 3300005354 Bacteria 1908
53 Ga0070675_100400163 3300005354 Bacteria 1225
54 Ga0070675_100420369 3300005354 Bacteria 1195
55 Ga0070671_100016552 3300005355 Bacteria 5962
56 Ga0070671_100031925 3300005355 Bacteria 4353
57 Ga0070671_100403739 3300005355 Bacteria 1169
58 Ga0070674_100575148 3300005356 Bacteria 949
59 Ga0070673_100017713 3300005364 Bacteria 5074
60 Ga0070673_100112586 3300005364 Bacteria 2259
61 Ga0070673_100975905 3300005364 Bacteria 788
62 Ga0070673_101057242 3300005364 Bacteria 757
63 Ga0070688_100169800 3300005365 Bacteria 1504
64 Ga0070659_100041610 3300005366 Bacteria 3593
65 Ga0070659_100240732 3300005366 Bacteria 1497
66 Ga0070659_100435548 3300005366 Bacteria 1110
67 Ga0070667_100000129 3300005367 Bacteria 95291
68 Ga0070667_100004742 3300005367 Bacteria 11393
69 Ga0070667_100013626 3300005367 Bacteria 6719
70 Ga0070667_100031761 3300005367 Bacteria 4402
71 Ga0070667_100100550 3300005367 Bacteria 2497
72 Ga0070709_10061645 3300005434 Bacteria 2388
73 Ga0070709_10085847 3300005434 Bacteria 2065
74 Ga0070709_10918412 3300005434 Unclassified 693
75 Ga0070714_100152368 3300005435 Bacteria 2084
76 Ga0070714_100504760 3300005435 Bacteria 1154
77 Ga0070714_100965144 3300005435 Bacteria 829
78 Ga0070713_100001016 3300005436 Bacteria 17953
79 Ga0070713_100004083 3300005436 Bacteria 9726
80 Ga0070713_100093207 3300005436 Bacteria 2595
81 Ga0070713_100298439 3300005436 Bacteria 1483
82 Ga0070713_100740342 3300005436 Bacteria 940
83 Ga0070701_10160587 3300005438 Bacteria 1301
84 Ga0070711_100000199 3300005439 Bacteria 31704
85 Ga0070711_100863173 3300005439 Unclassified 771
86 Ga0070705_100010543 3300005440 Bacteria 4631
87 Ga0070700_100001944 3300005441 Bacteria 10474
88 Ga0070700_100240414 3300005441 Bacteria 1294
89 Ga0070694_100014427 3300005444 Bacteria 4946
90 Ga0070663_100003626 3300005455 Bacteria 8930
91 Ga0070663_100069973 3300005455 Bacteria 2551
92 Ga0070663_100679663 3300005455 Bacteria 873
93 Ga0070678_100065502 3300005456 Bacteria 2698
94 Ga0070662_100002845 3300005457 Bacteria 10736
95 Ga0070662_100252299 3300005457 Bacteria 1419
96 Ga0070662_100367511 3300005457 Bacteria 1182
97 Ga0070681_10021742 3300005458 Bacteria 6432
98 Ga0070681_10106791 3300005458 Bacteria 2741
99 Ga0070681_10129992 3300005458 Bacteria 2450
100 Ga0070681_10303847 3300005458 Bacteria 1505
101 Ga0070681_10316107 3300005458 Bacteria 1471
102 Ga0070681_10527329 3300005458 Bacteria 1094
103 Ga0070681_10589727 3300005458 Bacteria 1026
104 Ga0070681_10719980 3300005458 Bacteria 914
105 Ga0068867_100077592 3300005459 Bacteria 2496
106 Ga0068867_100082876 3300005459 Bacteria 2420
107 Ga0068867_100105529 3300005459 Bacteria 2157
108 Ga0068867_100635000 3300005459 Unclassified 935
109 Ga0068867_100862911 3300005459 Bacteria 812
110 Ga0070685_10036931 3300005466 Bacteria 2764
111 Ga0070685_10088076 3300005466 Bacteria 1874
112 Ga0070685_10102394 3300005466 Bacteria 1751
113 Ga0070699_100079576 3300005518 Bacteria 2855
114 Ga0070679_100001628 3300005530 Bacteria 20213
115 Ga0070679_100073184 3300005530 Bacteria 3419
116 Ga0070679_100098224 3300005530 Bacteria 2916
117 Ga0070679_100246882 3300005530 Bacteria 1742
118 Ga0070679_100436489 3300005530 Bacteria 1254
119 Ga0070679_100537071 3300005530 Bacteria 1113
120 Ga0070679_100939535 3300005530 Bacteria 808
121 Ga0070684_100001729 3300005535 Bacteria 15874
122 Ga0070684_100025145 3300005535 Bacteria 5001
123 Ga0070684_100038613 3300005535 Bacteria 4102
124 Ga0070684_100176464 3300005535 Bacteria 1942
125 Ga0070684_100246557 3300005535 Bacteria 1632
126 Ga0070684_100249610 3300005535 Bacteria 1622
127 Ga0068853_100038442 3300005539 Bacteria 4076
128 Ga0068853_100041427 3300005539 Bacteria 3934
129 Ga0068853_100083208 3300005539 Bacteria 2804
130 Ga0068853_100161274 3300005539 Bacteria 2024
131 Ga0068853_100311279 3300005539 Bacteria 1458
132 Ga0068853_100671399 3300005539 Bacteria 987
133 Ga0068853_101155073 3300005539 Bacteria 747
134 Ga0068853_101179561 3300005539 Bacteria 739
135 Ga0068853_101213757 3300005539 Unclassified 728
136 Ga0070672_100018129 3300005543 Bacteria 5083
137 Ga0070686_100039984 3300005544 Bacteria 2924
138 Ga0070686_100512171 3300005544 Bacteria 933
139 Ga0070695_100005501 3300005545 Bacteria 7462
140 Ga0070695_100087103 3300005545 Bacteria 2077
141 Ga0070695_100367697 3300005545 Bacteria 1082
142 Ga0070696_100004289 3300005546 Bacteria 9501
143 Ga0070696_100004520 3300005546 Bacteria 9283
144 Ga0070693_100241565 3300005547 Bacteria 1193
145 Ga0070693_100300624 3300005547 Bacteria 1082
146 Ga0070693_100454984 3300005547 Bacteria 899
147 Ga0070665_100013453 3300005548 Bacteria 8231
148 Ga0070665_100068349 3300005548 Bacteria 3562
149 Ga0070665_100815909 3300005548 Bacteria 946
150 Ga0068855_100190937 3300005563 Bacteria 2310
151 Ga0068855_100304962 3300005563 Bacteria 1763
152 Ga0068855_100325198 3300005563 Bacteria 1699
153 Ga0068855_100470403 3300005563 Bacteria 1369
154 Ga0068855_100554669 3300005563 Bacteria 1243
155 Ga0070664_100002294 3300005564 Bacteria 15381
156 Ga0070664_100007502 3300005564 Bacteria 8806
157 Ga0070664_100009554 3300005564 Bacteria 7863
158 Ga0070664_100035559 3300005564 Bacteria 4182
159 Ga0070664_100104037 3300005564 Bacteria 2472
160 Ga0068857_100297102 3300005577 Bacteria 1488
161 Ga0068857_100423703 3300005577 Bacteria 1241
162 Ga0068857_100689263 3300005577 Bacteria 970
163 Ga0068854_100056768 3300005578 Bacteria 2823
164 Ga0068854_100100965 3300005578 Bacteria 2163
165 Ga0068854_100132981 3300005578 Bacteria 1901
166 Ga0068854_100159135 3300005578 Bacteria 1747
167 Ga0068854_100178603 3300005578 Bacteria 1657
168 Ga0068854_100266473 3300005578 Bacteria 1373
169 Ga0068856_100037956 3300005614 Bacteria 4727
170 Ga0070702_100001633 3300005615 Bacteria 9285
171 Ga0070702_100092446 3300005615 Bacteria 1837
172 Ga0068852_100029316 3300005616 Bacteria 4520
173 Ga0068852_100050119 3300005616 Bacteria 3576
174 Ga0068852_100064213 3300005616 Bacteria 3200
175 Ga0068852_100076792 3300005616 Bacteria 2950
176 Ga0068852_100360168 3300005616 Bacteria 1422
177 Ga0068852_101486089 3300005616 Bacteria 700
178 Ga0068859_100031383 3300005617 Bacteria 5335
179 Ga0068864_100455521 3300005618 Bacteria 1224
180 Ga0068866_10026547 3300005718 Bacteria 2736
181 Ga0068861_100003061 3300005719 Bacteria 11043
182 Ga0068861_100038676 3300005719 Bacteria 3556
183 Ga0068861_100136080 3300005719 Bacteria 1999
184 Ga0068861_100462951 3300005719 Bacteria 1139
185 Ga0068861_101357677 3300005719 Unclassified 693
186 Ga0068851_10013342 3300005834 Bacteria 3890
187 Ga0068851_10144312 3300005834 Bacteria 1297
188 Ga0068851_10221207 3300005834 Bacteria 1064
189 Ga0068870_10347916 3300005840 Bacteria 950
190 Ga0068863_100015555 3300005841 Bacteria 7310
191 Ga0068863_100138441 3300005841 Bacteria 2326
192 Ga0068863_101154170 3300005841 Bacteria 780
193 Ga0068858_100077734 3300005842 Bacteria 3083
194 Ga0068858_100101198 3300005842 Bacteria 2687
195 Ga0068858_100551972 3300005842 Bacteria 1115
196 Ga0068860_100030175 3300005843 Bacteria 5215
197 Ga0068860_100162747 3300005843 Bacteria 2152
198 Ga0068860_100221046 3300005843 Bacteria 1839
199 Ga0068860_100254419 3300005843 Bacteria 1711
200 Ga0068862_100021983 3300005844 Bacteria 5335
201 Ga0068862_100064251 3300005844 Bacteria 3159
202 Ga0068862_100103287 3300005844 Bacteria 2496
203 Ga0081455_10067561 3300005937 Bacteria 2978
204 Ga0070717_10363068 3300006028 Bacteria 1296
205 Ga0070717_10435112 3300006028 Bacteria 1181
206 Ga0070717_10447058 3300006028 Unclassified 1164
207 Ga0075363_100182710 3300006048 Bacteria 1194
208 Ga0070716_100019858 3300006173 Bacteria 3518
209 Ga0070712_100097309 3300006175 Bacteria 2169
210 Ga0070712_100276512 3300006175 Bacteria 1351
211 Ga0070712_100596331 3300006175 Bacteria 935
212 Ga0075362_10040494 3300006177 Bacteria 2051
213 Ga0075367_10000686 3300006178 Bacteria 13023
214 Ga0075366_10001385 3300006195 Bacteria 12137
215 Ga0097621_100093146 3300006237 Bacteria 2524
216 Ga0075370_10031441 3300006353 Bacteria 2963
217 Ga0068871_100064103 3300006358 Bacteria 3007
218 Ga0075428_100012697 3300006844 Bacteria 9366
219 Ga0075428_100243428 3300006844 Bacteria 1940
220 Ga0075431_100075567 3300006847 Bacteria 3477
221 Ga0075431_101218597 3300006847 Bacteria 715
222 Ga0075431_101276029 3300006847 Bacteria 696
223 Ga0075433_10277255 3300006852 Bacteria 1486
224 Ga0075434_100045045 3300006871 Bacteria 4376
225 Ga0068865_100004047 3300006881 Bacteria 8802
226 Ga0068865_100550718 3300006881 Bacteria 969
227 Ga0075436_100030280 3300006914 Bacteria 3725
228 Ga0097620_100031383 3300006931 Bacteria 5335
229 Ga0099795_10011947 3300007788 Bacteria 2616
230 Ga0105240_10055252 3300009093 Bacteria 4972
231 Ga0105240_10059013 3300009093 Bacteria 4789
232 Ga0105240_10105303 3300009093 Unclassified 3424
233 Ga0111539_10000734 3300009094 Bacteria 42621
234 Ga0111539_10000994 3300009094 Bacteria 37119
235 Ga0111539_10008471 3300009094 Bacteria 13075
236 Ga0111539_10112731 3300009094 Bacteria 3190
237 Ga0111539_10790585 3300009094 Bacteria 1104
238 Ga0105245_10156238 3300009098 Bacteria 2160
239 Ga0105245_10185077 3300009098 Bacteria 1992
240 Ga0105247_10085705 3300009101 Bacteria 1992
241 Ga0114129_10016679 3300009147 Bacteria 10460
242 Ga0105243_10064032 3300009148 Bacteria 2949
243 Ga0105243_10501130 3300009148 Bacteria 1151
244 Ga0105243_10516203 3300009148 Bacteria 1135
245 Ga0105241_10053698 3300009174 Bacteria 3082
246 Ga0105241_10225498 3300009174 Unclassified 1577
247 Ga0105242_10012408 3300009176 Bacteria 6560
248 Ga0105242_10144801 3300009176 Bacteria 2066
249 Ga0105242_10528383 3300009176 Bacteria 1127
250 Ga0105242_10784484 3300009176 Bacteria 941
251 Ga0105248_10027917 3300009177 Bacteria 6284
252 Ga0105248_10034437 3300009177 Bacteria 5662
253 Ga0105248_10045550 3300009177 Bacteria 4918
254 Ga0105248_10209937 3300009177 Bacteria 2194
255 Ga0105248_11040294 3300009177 Unclassified 925
256 Ga0105237_10000049 3300009545 Bacteria 162066
257 Ga0105237_10164203 3300009545 Bacteria 2219
258 Ga0105238_10043645 3300009551 Bacteria 4536
259 Ga0105238_11215491 3300009551 Bacteria 778
260 Ga0105249_10019079 3300009553 Bacteria 6117
261 Ga0105249_10203251 3300009553 Bacteria 1940
262 Ga0105249_10338935 3300009553 Bacteria 1520
263 Ga0105239_10037969 3300010375 Bacteria 5278
264 Ga0105239_10413120 3300010375 Bacteria 1528
265 Ga0105239_10869090 3300010375 Bacteria 1034
266 Ga0105246_10024901 3300011119 Bacteria 3895
267 Ga0157373_10004182 3300013100 Bacteria 10887
268 Ga0157373_10069264 3300013100 Bacteria 2494
269 Ga0157373_10184280 3300013100 Bacteria 1470
270 Ga0157373_10350004 3300013100 Bacteria 1054
271 Ga0157373_10358638 3300013100 Bacteria 1041
272 Ga0157371_10254621 3300013102 Bacteria 1265
273 Ga0157370_10027797 3300013104 Bacteria 5576
274 Ga0157370_10145508 3300013104 Bacteria 2207
275 Ga0157370_10253064 3300013104 Bacteria 1629
276 Ga0157370_10301892 3300013104 Bacteria 1478
277 Ga0157370_10801025 3300013104 Bacteria 857
278 Ga0157369_10029444 3300013105 Bacteria 6067
279 Ga0157369_10104622 3300013105 Unclassified 3014
280 Ga0157369_10242558 3300013105 Bacteria 1882
281 Ga0157369_11417801 3300013105 Bacteria 707
282 Ga0157374_10005768 3300013296 Bacteria 10450
283 Ga0157374_10645448 3300013296 Bacteria 1070
284 Ga0157378_10005847 3300013297 Bacteria 10781
285 Ga0157378_10039511 3300013297 Bacteria 4185
286 Ga0157378_10165484 3300013297 Bacteria 2071
287 Ga0157378_10186811 3300013297 Bacteria 1952
288 Ga0157378_10904369 3300013297 Bacteria 913
289 Ga0163162_10051416 3300013306 Bacteria 4135
290 Ga0163162_10536455 3300013306 Bacteria 1299
291 Ga0157372_10000829 3300013307 Bacteria 33472
292 Ga0157372_10001054 3300013307 Bacteria 30118
293 Ga0157372_10008051 3300013307 Bacteria 11210
294 Ga0157372_10013269 3300013307 Bacteria 8794
295 Ga0157372_10046972 3300013307 Bacteria 4795
296 Ga0157372_10086858 3300013307 Bacteria 3548
297 Ga0157372_10622277 3300013307 Bacteria 1258
298 Ga0157375_10033217 3300013308 Bacteria 4900
299 Ga0157375_10045806 3300013308 Bacteria 4258
300 Ga0157375_10228956 3300013308 Bacteria 2018
301 Ga0163163_10066886 3300014325 Bacteria 3571
302 Ga0163163_10098534 3300014325 Bacteria 2944
303 Ga0157380_10371072 3300014326 Bacteria 1347
304 Ga0157377_10311463 3300014745 Bacteria 1043
305 Ga0157377_10496985 3300014745 Bacteria 852
306 Ga0157379_10013757 3300014968 Bacteria 7093
307 Ga0157379_10191724 3300014968 Bacteria 1847
308 Ga0157379_10248132 3300014968 Bacteria 1616
309 Ga0157376_10056243 3300014969 Bacteria 3286
310 Ga0157376_10139622 3300014969 Bacteria 2172
311 Ga0157376_11271121 3300014969 Bacteria 765
312 Ga0206353_10867396 3300020082 Bacteria 955
313 Ga0213871_10094795 3300021441 Unclassified 868
314 Ga0207673_1017059 3300025290 Bacteria 968
315 Ga0207697_10000173 3300025315 Bacteria 32981
316 Ga0207697_10109255 3300025315 Bacteria 1183
317 Ga0207656_10114408 3300025321 Bacteria 1250
318 Ga0207656_10141780 3300025321 Bacteria 1133
319 Ga0207642_10250137 3300025899 Bacteria 1005
320 Ga0207710_10092432 3300025900 Bacteria 1418
321 Ga0207688_10007915 3300025901 Bacteria 5785
322 Ga0207688_10159972 3300025901 Bacteria 1334
323 Ga0207680_10098172 3300025903 Bacteria 1877
324 Ga0207680_10135026 3300025903 Bacteria 1630
325 Ga0207680_10283679 3300025903 Bacteria 1151
326 Ga0207680_10781966 3300025903 Bacteria 684
327 Ga0207645_10005656 3300025907 Bacteria 9031
328 Ga0207645_10032873 3300025907 Bacteria 3334
329 Ga0207645_10149544 3300025907 Bacteria 1524
330 Ga0207705_10000867 3300025909 Bacteria 24793
331 Ga0207654_10018736 3300025911 Bacteria 3638
332 Ga0207707_10014017 3300025912 Bacteria 6988
333 Ga0207707_10014058 3300025912 Bacteria 6978
334 Ga0207707_10194121 3300025912 Bacteria 1771
335 Ga0207707_10436684 3300025912 Bacteria 1121
336 Ga0207695_10021244 3300025913 Bacteria 7413
337 Ga0207695_10044548 3300025913 Bacteria 4718
338 Ga0207695_10065541 3300025913 Bacteria 3735
339 Ga0207695_10105006 3300025913 Bacteria 2813
340 Ga0207671_10000004 3300025914 Bacteria 1022356
341 Ga0207671_10017884 3300025914 Bacteria 5452
342 Ga0207671_10697774 3300025914 Bacteria 807
343 Ga0207693_10114039 3300025915 Bacteria 2120
344 Ga0207693_10246672 3300025915 Bacteria 1402
345 Ga0207693_10448121 3300025915 Bacteria 1009
346 Ga0207663_10054228 3300025916 Bacteria 2509
347 Ga0207663_10869541 3300025916 Unclassified 720
348 Ga0207660_10001655 3300025917 Bacteria 14931
349 Ga0207660_11121550 3300025917 Bacteria 641
350 Ga0207662_10057735 3300025918 Bacteria 2320
351 Ga0207662_10167867 3300025918 Bacteria 1406
352 Ga0207657_10001939 3300025919 Bacteria 22355
353 Ga0207657_10229669 3300025919 Bacteria 1484
354 Ga0207657_10277867 3300025919 Bacteria 1330
355 Ga0207649_10010248 3300025920 Bacteria 5145
356 Ga0207649_10013548 3300025920 Bacteria 4553
357 Ga0207649_10059441 3300025920 Bacteria 2398
358 Ga0207649_10175694 3300025920 Bacteria 1495
359 Ga0207649_10302371 3300025920 Bacteria 1170
360 Ga0207649_10809638 3300025920 Bacteria 731
361 Ga0207652_10001455 3300025921 Bacteria 20964
362 Ga0207652_10011529 3300025921 Bacteria 7126
363 Ga0207652_10222928 3300025921 Bacteria 1699
364 Ga0207652_10244886 3300025921 Bacteria 1616
365 Ga0207652_10467252 3300025921 Unclassified 1137
366 Ga0207681_10016432 3300025923 Bacteria 4631
367 Ga0207681_10016751 3300025923 Bacteria 4592
368 Ga0207681_10224373 3300025923 Bacteria 1455
369 Ga0207681_10312724 3300025923 Bacteria 1246
370 Ga0207681_10336267 3300025923 Bacteria 1205
371 Ga0207694_10220774 3300025924 Bacteria 1546
372 Ga0207694_10852550 3300025924 Bacteria 770
373 Ga0207650_10098636 3300025925 Bacteria 2245
374 Ga0207650_10295490 3300025925 Bacteria 1322
375 Ga0207650_10885159 3300025925 Unclassified 758
376 Ga0207659_10026197 3300025926 Bacteria 3932
377 Ga0207659_10123308 3300025926 Bacteria 1989
378 Ga0207659_10165697 3300025926 Bacteria 1739
379 Ga0207659_10553707 3300025926 Bacteria 978
380 Ga0207687_10001094 3300025927 Bacteria 18423
381 Ga0207700_10005781 3300025928 Bacteria 7431
382 Ga0207700_10083651 3300025928 Bacteria 2499
383 Ga0207664_10120938 3300025929 Bacteria 2191
384 Ga0207664_10476081 3300025929 Bacteria 1117
385 Ga0207664_10603412 3300025929 Bacteria 986
386 Ga0207644_10026392 3300025931 Bacteria 4002
387 Ga0207644_10109130 3300025931 Bacteria 2090
388 Ga0207690_10021830 3300025932 Bacteria 3976
389 Ga0207690_10055598 3300025932 Bacteria 2666
390 Ga0207690_10202907 3300025932 Bacteria 1507
391 Ga0207706_10000520 3300025933 Bacteria 40984
392 Ga0207706_10072695 3300025933 Bacteria 3024
393 Ga0207706_10218458 3300025933 Bacteria 1669
394 Ga0207686_10017948 3300025934 Bacteria 3998
395 Ga0207686_10064746 3300025934 Bacteria 2328
396 Ga0207686_11007491 3300025934 Bacteria 676
397 Ga0207709_10133283 3300025935 Bacteria 1696
398 Ga0207709_10194903 3300025935 Bacteria 1442
399 Ga0207670_10041546 3300025936 Bacteria 3025
400 Ga0207669_10318434 3300025937 Bacteria 1189
401 Ga0207669_10798539 3300025937 Bacteria 782
402 Ga0207704_10327157 3300025938 Bacteria 1185
403 Ga0207704_10418891 3300025938 Bacteria 1061
404 Ga0207704_10533973 3300025938 Bacteria 951
405 Ga0207665_10009293 3300025939 Bacteria 6453
406 Ga0207691_10013388 3300025940 Bacteria 7852
407 Ga0207711_10009104 3300025941 Bacteria 8289
408 Ga0207711_10047301 3300025941 Bacteria 3677
409 Ga0207711_10068530 3300025941 Bacteria 3073
410 Ga0207689_10027261 3300025942 Bacteria 4783
411 Ga0207689_10078950 3300025942 Bacteria 2705
412 Ga0207661_10035131 3300025944 Bacteria 3903
413 Ga0207661_10118209 3300025944 Bacteria 2253
414 Ga0207661_10172092 3300025944 Bacteria 1885
415 Ga0207661_10401905 3300025944 Bacteria 1242
416 Ga0207679_10006902 3300025945 Bacteria 7193
417 Ga0207679_10032904 3300025945 Bacteria 3645
418 Ga0207679_10034339 3300025945 Bacteria 3577
419 Ga0207679_10185535 3300025945 Bacteria 1724
420 Ga0207679_10247672 3300025945 Bacteria 1513
421 Ga0207679_10371549 3300025945 Bacteria 1252
422 Ga0207679_10394307 3300025945 Bacteria 1216
423 Ga0207679_10401351 3300025945 Bacteria 1206
424 Ga0207667_10006739 3300025949 Bacteria 13869
425 Ga0207667_10145977 3300025949 Bacteria 2435
426 Ga0207667_10236962 3300025949 Bacteria 1868
427 Ga0207667_11142121 3300025949 Bacteria 761
428 Ga0207651_10029425 3300025960 Bacteria 3480
429 Ga0207651_10039374 3300025960 Bacteria 3117
430 Ga0207651_10073034 3300025960 Bacteria 2438
431 Ga0207712_10031036 3300025961 Bacteria 3596
432 Ga0207712_10031572 3300025961 Bacteria 3569
433 Ga0207668_10015023 3300025972 Bacteria 4804
434 Ga0207668_10053146 3300025972 Bacteria 2806
435 Ga0207668_10117100 3300025972 Bacteria 2010
436 Ga0207640_10016974 3300025981 Bacteria 4249
437 Ga0207640_10060777 3300025981 Bacteria 2499
438 Ga0207640_10661337 3300025981 Bacteria 891
439 Ga0207640_10861990 3300025981 Bacteria 789
440 Ga0207658_10000126 3300025986 Bacteria 83451
441 Ga0207658_10015990 3300025986 Bacteria 5155
442 Ga0207658_10246104 3300025986 Bacteria 1517
443 Ga0207677_10005303 3300026023 Bacteria 6989
444 Ga0207677_10053474 3300026023 Bacteria 2749
445 Ga0207677_10054322 3300026023 Bacteria 2732
446 Ga0207677_10510666 3300026023 Bacteria 1041
447 Ga0207703_10059145 3300026035 Bacteria 3130
448 Ga0207703_10092690 3300026035 Bacteria 2543
449 Ga0207639_10055129 3300026041 Bacteria 3041
450 Ga0207639_10153858 3300026041 Bacteria 1929
451 Ga0207639_10249966 3300026041 Bacteria 1546
452 Ga0207639_10690361 3300026041 Bacteria 947
453 Ga0207639_11076296 3300026041 Bacteria 754
454 Ga0207678_10006010 3300026067 Bacteria 10798
455 Ga0207678_10706502 3300026067 Unclassified 887
456 Ga0207708_10006637 3300026075 Bacteria 8566
457 Ga0207708_10120497 3300026075 Bacteria 2044
458 Ga0207708_10256946 3300026075 Bacteria 1409
459 Ga0207702_10013324 3300026078 Bacteria 6838
460 Ga0207702_10042416 3300026078 Bacteria 3816
461 Ga0207641_10191557 3300026088 Bacteria 1880
462 Ga0207648_10002220 3300026089 Bacteria 21052
463 Ga0207648_10013389 3300026089 Bacteria 7632
464 Ga0207648_10092526 3300026089 Bacteria 2644
465 Ga0207648_10306086 3300026089 Bacteria 1426
466 Ga0207676_10041682 3300026095 Bacteria 3526
467 Ga0207674_10033656 3300026116 Bacteria 5364
468 Ga0207674_10035827 3300026116 Bacteria 5177
469 Ga0207674_10587782 3300026116 Bacteria 1075
470 Ga0207675_100000371 3300026118 Bacteria 43068
471 Ga0207675_100069702 3300026118 Bacteria 3286
472 Ga0207675_100142861 3300026118 Bacteria 2274
473 Ga0207675_100241092 3300026118 Unclassified 1747
474 Ga0207675_100998216 3300026118 Bacteria 855
475 Ga0207683_10006929 3300026121 Bacteria 9706
476 Ga0207683_10086652 3300026121 Bacteria 2784
477 Ga0207683_10618121 3300026121 Bacteria 1003
478 Ga0207698_10037816 3300026142 Bacteria 3559
479 Ga0207698_10055847 3300026142 Bacteria 3046
480 Ga0207698_10618003 3300026142 Bacteria 1070
481 Ga0209371_1006695 3300027312 Bacteria 4199
482 Ga0209967_1019945 3300027364 Bacteria 976
483 Ga0209995_1002812 3300027471 Bacteria 2757
484 Ga0209999_1000731 3300027543 Bacteria 5337
485 Ga0209966_1000275 3300027695 Bacteria 18269
486 Ga0209998_10000191 3300027717 Bacteria 21738
487 Ga0207428_10000070 3300027907 Bacteria 147650
488 Ga0207428_10033077 3300027907 Bacteria 4249
489 Ga0207428_10052216 3300027907 Bacteria 3266
490 Ga0207428_10156327 3300027907 Bacteria 1734
491 Ga0268266_10013297 3300028379 Bacteria 7094
492 Ga0268266_10070048 3300028379 Bacteria 3040
493 Ga0268266_10090123 3300028379 Bacteria 2687
494 Ga0268265_10069590 3300028380 Bacteria 2733
495 Ga0268265_10081975 3300028380 Bacteria 2549
496 Ga0268265_10192822 3300028380 Bacteria 1761
497 Ga0268264_10020380 3300028381 Bacteria 5420
498 Ga0268264_10147554 3300028381 Bacteria 2105
499 Ga0268264_10182900 3300028381 Bacteria 1905
500 Ga0307515_10000019 3300028794 Bacteria 422262
501 Ga0265338_10000613 3300028800 Bacteria 62518
502 Ga0265338_10037851 3300028800 Bacteria 4581
503 Ga0268256_1006731 3300030500 Bacteria 4224
504 Ga0265332_10070390 3300031238 Bacteria 1490
505 Ga0265325_10025593 3300031241 Bacteria 3203
506 Ga0265325_10332114 3300031241 Bacteria 674
507 Ga0265327_10006752 3300031251 Bacteria 9069
508 Ga0307408_100148296 3300031548 Bacteria 1849
509 Ga0265314_10031389 3300031711 Bacteria 3922
510 Ga0307405_10018831 3300031731 Bacteria 3818
511 Ga0307413_10284594 3300031824 Unclassified 1245
512 Ga0307410_10132607 3300031852 Bacteria 1832
513 Ga0307406_10017722 3300031901 Bacteria 4151
514 Ga0307407_10025970 3300031903 Bacteria 3096
515 Ga0307409_100015935 3300031995 Bacteria 4953
516 Ga0307409_100829237 3300031995 Unclassified 934
517 Ga0307409_101013643 3300031995 Bacteria 849
518 Ga0307416_100120759 3300032002 Bacteria 2334
519 Ga0307414_10399606 3300032004 Bacteria 1193
520 Ga0307415_100159130 3300032126 Unclassified 1748
521 Ga0316212_1014589 3300033547 Bacteria 1114
522 Ga0373930_0017646 3300034816 Bacteria 1363
523 Ga0373934_0153406 3300035086 Bacteria 944
524 Ga0373923_0370929 3300035111 Bacteria 686
525 Ga0373932_0033333 3300035112 Bacteria 1446
526 Ga0373939_0040833 3300035114 Bacteria 1395
527 Ga0373941_0083917 3300035115 Bacteria 1081
528 Ga0373960_0037453 3300035121 Bacteria 1386
529 Ga0373960_0070228 3300035121 Bacteria 1082
530 Ga0373943_0008200 3300035170 Bacteria 4689
531 Ga0373943_0044220 3300035170 Unclassified 2167
532 Ga0373942_0036522 3300035207 Bacteria 1324
533 Ga0373961_0092705 3300035241 Bacteria 967
534 Ga0373931_0072490 3300035691 Bacteria 1883
535 Ga0373927_0225459 3300035695 Bacteria 1231
536 Ga0373927_0257663 3300035695 Unclassified 1147
537 Ga0373927_0266129 3300035695 Bacteria 1127
538 Ga0373947_0046354 3300035725 Bacteria 2603
539 Ga0373947_0184016 3300035725 Bacteria 1361
540 Ga0373925_0071106 3300037068 Bacteria 2631
541 Ga0373925_0106130 3300037068 Bacteria 2165
542 Ga0373925_0368765 3300037068 Bacteria 1168
543 Ga0395905_0681021 3300037471 Bacteria 931
544 Ga0436360_1300662 3300039438 Bacteria 1132
545 Ga0436363_1404847 3300039450 Unclassified 725
546 Ga0439448_0056445 3300042005 Bacteria 1293
547 Ga0466969_0009518 3300044656 Bacteria 5150
548 Ga0453683_0002671 3300044673 Bacteria 13636
549 Ga0466966_0233240 3300044684 Bacteria 1110
550 Ga0466966_0332379 3300044684 Bacteria 913
551 Ga0466959_0548057 3300045049 Unclassified 780
552 Ga0466958_0051235 3300045836 Bacteria 2499
553 Ga0466967_1482811 3300045976 Bacteria 676
554 Ga0495592_0121852 3300046454 Bacteria 1833
555 Ga0495603_0066492 3300046455 Bacteria 2123
556 Ga0495591_000325 3300046458 Bacteria 43149
557 Ga0495629_0002254 3300046459 Bacteria 14859
558 Ga0495629_0106770 3300046459 Bacteria 1953
559 Ga0495629_0161724 3300046459 Bacteria 1555
560 Ga0495641_0054929 3300046461 Bacteria 1809
561 Ga0495651_0063790 3300046462 Bacteria 2815
562 Ga0495650_0005337 3300046471 Bacteria 8386
563 Ga0495580_0003590 3300046472 Bacteria 13163
564 Ga0495580_0022825 3300046472 Bacteria 4599
565 Ga0495580_0026216 3300046472 Bacteria 4252
566 Ga0495580_0218538 3300046472 Bacteria 1310
567 Ga0495580_0392386 3300046472 Bacteria 937
568 Ga0495580_1040901 3300046472 Bacteria 520
569 Ga0495582_0025858 3300046473 Bacteria 3216
570 Ga0495582_0129508 3300046473 Bacteria 1425
571 Ga0495662_0081185 3300046476 Bacteria 1577
572 Ga0495664_0115010 3300046477 Bacteria 1625
573 Ga0495664_0229515 3300046477 Bacteria 1123
574 Ga0495596_0002393 3300046500 Bacteria 10137
575 Ga0495618_0001764 3300046514 Bacteria 14353
576 Ga0495628_0102503 3300046516 Bacteria 2208
577 Ga0495630_0012072 3300046517 Bacteria 6262
578 Ga0495630_0015604 3300046517 Bacteria 5551
579 Ga0495648_0004224 3300046524 Bacteria 12325
580 Ga0495666_0005640 3300046526 Bacteria 6302
581 Ga0495665_0000428 3300046531 Bacteria 21430
582 Ga0495665_0451566 3300046531 Bacteria 650
583 Ga0495640_0014148 3300046533 Bacteria 6048
584 Ga0495586_0028706 3300046535 Bacteria 2977
585 Ga0495586_0060217 3300046535 Bacteria 2064
586 Ga0495587_0009056 3300046536 Bacteria 6389
587 Ga0495645_0086930 3300046543 Bacteria 2237
588 Ga0495645_0329743 3300046543 Bacteria 988
589 Ga0495645_0375732 3300046543 Bacteria 910
590 Ga0495634_0016785 3300046642 Bacteria 5229
591 Ga0495635_0002492 3300046663 Bacteria 12570
592 Ga0495635_0111577 3300046663 Bacteria 1868
593 Ga0495661_0009932 3300046665 Bacteria 6509
594 Ga0495657_0171757 3300046675 Bacteria 1335
595 Ga0495599_0003940 3300046678 Bacteria 8732
596 Ga0495623_0005647 3300046679 Bacteria 8164
597 Ga0495623_0037635 3300046679 Bacteria 3095
598 Ga0495646_0001254 3300046680 Bacteria 14897
599 Ga0495658_0039652 3300046683 Bacteria 2614
600 Ga0495613_0005215 3300046689 Bacteria 9761
601 Ga0495624_0015328 3300046690 Bacteria 5178
602 Ga0495671_0164161 3300046692 Bacteria 1080
603 Ga0495649_0295535 3300046694 Bacteria 825
604 Ga0495589_0031769 3300046794 Bacteria 2657
605 Ga0495600_0044549 3300046809 Bacteria 2894
606 Ga0495581_0009248 3300047315 Bacteria 5702
607 Ga0495604_0345799 3300047317 Bacteria 989
608 Ga0495674_0024368 3300047319 Bacteria 5560
609 Ga0495674_0040147 3300047319 Bacteria 4189
610 Ga0495672_0077178 3300047320 Bacteria 1868
611 Ga0495676_0015142 3300047321 Bacteria 6881
612 Ga0495676_0256382 3300047321 Bacteria 1191
613 Ga0495680_0065373 3300047322 Bacteria 2785
614 Ga0495683_0003029 3300047323 Bacteria 9882
615 Ga0495675_0055253 3300047444 Bacteria 2518
616 Ga0495679_000078 3300047446 Bacteria 91220
617 Ga0495673_0003323 3300047469 Bacteria 10661
618 Ga0495686_0335300 3300047472 Unclassified 826
619 Ga0495593_0006054 3300047673 Bacteria 7114
620 Ga0495593_0117527 3300047673 Bacteria 1354
621 Ga0495602_0062316 3300048088 Bacteria 3235
622 Ga0495602_0194749 3300048088 Bacteria 1551
623 Ga0495602_0352797 3300048088 Unclassified 1061
624 Ga0495614_0000980 3300048089 Bacteria 12132
625 Ga0496102_0016863 3300048905 Bacteria 6390
626 Ga0496102_0204993 3300048905 Bacteria 1859
627 Ga0496102_0350438 3300048905 Bacteria 1390
628 Ga0496102_0651452 3300048905 Bacteria 976
629 Ga0496103_0001707 3300048906 Bacteria 14366
630 Ga0496103_0034303 3300048906 Bacteria 3103
631 Ga0496103_0119949 3300048906 Bacteria 1675
632 Ga0496104_0206576 3300048907 Bacteria 1876
633 Ga0496105_0311396 3300048908 Bacteria 1264
634 Ga0496106_0083903 3300048909 Bacteria 2451
635 Ga0496107_0091282 3300048910 Bacteria 2226
636 Ga0496107_0295783 3300048910 Bacteria 1205
637 Ga0496108_0292511 3300048911 Bacteria 1418
638 Ga0496108_0663672 3300048911 Unclassified 906
639 Ga0496109_0148514 3300048912 Bacteria 2194
640 Ga0496109_0694779 3300048912 Bacteria 955
641 Ga0496110_0082637 3300048913 Bacteria 2865
642 Ga0496110_0241074 3300048913 Bacteria 1645
643 Ga0496112_0000778 3300048915 Bacteria 22473
644 Ga0496112_0107736 3300048915 Bacteria 2757
645 Ga0496112_0710905 3300048915 Bacteria 932
646 Ga0496113_0000486 3300048916 Bacteria 19548
647 Ga0496115_0175082 3300048918 Bacteria 1774
648 Ga0496115_0324546 3300048918 Bacteria 1259
649 Ga0496117_0002917 3300048920 Bacteria 20689
650 Ga0496118_0000647 3300048921 Bacteria 56808
651 Ga0495682_0003827 3300049460 Bacteria 6600
652 Ga0501299_006373 3300049522 Bacteria 1850
653 Ga0501031_0052634 3300049568 Bacteria 2653
654 Ga0501032_0001691 3300049569 Bacteria 17484
655 Ga0501032_0069395 3300049569 Bacteria 2352
656 Ga0501033_0125846 3300049570 Bacteria 1858
657 Ga0501034_0001905 3300049571 Bacteria 26410
658 Ga0501034_0099943 3300049571 Bacteria 2895
659 Ga0501034_0118275 3300049571 Bacteria 2637
660 Ga0501034_0299060 3300049571 Bacteria 1546
661 Ga0501034_0343446 3300049571 Bacteria 1422
662 Ga0501034_0513375 3300049571 Bacteria 1111
663 Ga0501034_0570596 3300049571 Bacteria 1039
664 Ga0501036_0081298 3300049572 Bacteria 2738
665 Ga0501036_0104720 3300049572 Bacteria 2392
666 Ga0501036_0169180 3300049572 Bacteria 1841
667 Ga0501036_0216639 3300049572 Bacteria 1608
668 Ga0501037_0092490 3300049573 Bacteria 2187
669 Ga0501037_0130747 3300049573 Bacteria 1800
670 Ga0501038_0047589 3300049574 Bacteria 3714
671 Ga0501038_0282533 3300049574 Bacteria 1306
672 Ga0501038_0307628 3300049574 Bacteria 1242
673 Ga0501039_0086117 3300049575 Bacteria 2447
674 Ga0501039_0088359 3300049575 Bacteria 2414
675 Ga0501039_0453696 3300049575 Bacteria 1007
676 Ga0501043_0024334 3300049579 Bacteria 4752
677 Ga0501043_0027049 3300049579 Bacteria 4502
678 Ga0501043_0525751 3300049579 Bacteria 881
679 Ga0501043_0776817 3300049579 Bacteria 694
680 Ga0501046_0010200 3300049580 Bacteria 8084
681 Ga0501046_0028871 3300049580 Bacteria 4513
682 Ga0501046_0034470 3300049580 Bacteria 4084
683 Ga0501046_0278994 3300049580 Bacteria 1224
684 Ga0501047_0001035 3300049581 Bacteria 27861
685 Ga0501047_0036270 3300049581 Bacteria 4765
686 Ga0501047_0132346 3300049581 Bacteria 2374
687 Ga0501047_0137549 3300049581 Bacteria 2322
688 Ga0501047_0164698 3300049581 Bacteria 2088
689 Ga0501047_0456643 3300049581 Bacteria 1106
690 Ga0501048_0050065 3300049582 Bacteria 2976
691 Ga0501067_0025213 3300049583 Bacteria 3296
692 Ga0501067_0058650 3300049583 Bacteria 2131
693 Ga0501067_0144595 3300049583 Bacteria 1325
694 Ga0501068_0028009 3300049584 Bacteria 3329
695 Ga0501069_0007457 3300049585 Bacteria 5743
696 Ga0501069_0014264 3300049585 Bacteria 4246
697 Ga0501070_0084763 3300049586 Bacteria 2623
698 Ga0501070_0210903 3300049586 Bacteria 1594
699 Ga0501070_0379706 3300049586 Bacteria 1145
700 Ga0501070_0450061 3300049586 Bacteria 1038
701 Ga0501070_0897169 3300049586 Bacteria 692
702 Ga0501072_0050811 3300049588 Bacteria 3265
703 Ga0501072_0112095 3300049588 Bacteria 2172
704 Ga0501073_0008577 3300049589 Bacteria 7578
705 Ga0501073_0013165 3300049589 Bacteria 6030
706 Ga0501073_0056266 3300049589 Bacteria 2751
707 Ga0501073_0070825 3300049589 Bacteria 2429
708 Ga0501073_0211145 3300049589 Bacteria 1341
709 Ga0501073_0315567 3300049589 Bacteria 1078
710 Ga0501074_0077712 3300049590 Bacteria 2382
711 Ga0501074_0317509 3300049590 Bacteria 1106
712 Ga0501076_0206240 3300049592 Bacteria 1606
713 Ga0501202_001342 3300049652 Bacteria 3919
714 Ga0501207_000349 3300049654 Bacteria 4989
715 Ga0501211_009049 3300049658 Bacteria 974
716 Ga0501216_005177 3300049660 Bacteria 1955
717 Ga0501217_003466 3300049661 Bacteria 3186
718 Ga0501230_007794 3300049667 Bacteria 1599
719 Ga0501233_007205 3300049668 Bacteria 2112
720 Ga0501235_000580 3300049669 Bacteria 7358
721 Ga0501239_001170 3300049672 Bacteria 2210
722 Ga0501242_000413 3300049674 Bacteria 3662
723 Ga0501243_001182 3300049675 Bacteria 3727
724 Ga0501249_004894 3300049679 Bacteria 2732
725 Ga0501259_000815 3300049688 Bacteria 5118
726 Ga0501261_002241 3300049690 Bacteria 2374
727 Ga0501221_001803 3300049704 Bacteria 3578
728 Ga0501225_0023740 3300049705 Bacteria 1689
729 Ga0501080_0009528 3300049742 Bacteria 8864
730 Ga0501080_0040142 3300049742 Bacteria 4366
731 Ga0501080_0054699 3300049742 Bacteria 3716
732 Ga0501080_0526417 3300049742 Bacteria 1054
733 Ga0501083_0002234 3300049744 Bacteria 13232
734 Ga0501083_0009130 3300049744 Bacteria 7004
735 Ga0501083_0014388 3300049744 Bacteria 5532
736 Ga0501083_0045271 3300049744 Bacteria 2977
737 Ga0501083_0071133 3300049744 Bacteria 2313
738 Ga0501262_002710 3300049759 Unclassified 1996
739 Ga0501263_012594 3300049760 Unclassified 1062
740 Ga0501266_001622 3300049763 Bacteria 2866
741 Ga0501267_008934 3300049764 Unclassified 994
742 Ga0501268_000157 3300049765 Bacteria 6188
743 Ga0501272_000523 3300049769 Bacteria 3414
744 Ga0501035_0017757 3300049822 Bacteria 6562
745 Ga0501035_0611198 3300049822 Bacteria 887
746 Ga0501044_0011977 3300049823 Bacteria 9399
747 Ga0501044_0264238 3300049823 Bacteria 1658
748 nmdc:mga03n38_11107_c1 3300050490 Bacteria 3342
749 nmdc:mga00v17_24049_c1 3300050491 Bacteria 3530
750 nmdc:mga06z11_2761_c1 3300050494 Bacteria 6731
751 nmdc:mga05p37_35085_c1 3300050507 Bacteria 6149
752 nmdc:mga06r32_1074118_c1 3300050510 Bacteria 755
753 nmdc:mga06r32_530816_c1 3300050510 Bacteria 1152
754 nmdc:mga08y16_1261069_c1 3300050511 Unclassified 707
755 nmdc:mga08y16_180399_c1 3300050511 Bacteria 2192
756 nmdc:mga08y16_254895_c1 3300050511 Bacteria 1813
757 nmdc:mga08y16_4052_c1 3300050511 Bacteria 15291
758 nmdc:mga08y16_6635_c1 3300050511 Bacteria 12143
759 nmdc:mga08y16_90850_c1 3300050511 Bacteria 3183
760 nmdc:mga0n895_10785_c1 3300050512 Bacteria 8105
761 nmdc:mga08x19_5879_c1 3300050514 Bacteria 7256
762 nmdc:mga0a205_35914_c1 3300050515 Bacteria 4760
763 Ga0501084_0038944 3300054114 Bacteria 3975
764 Ga0501084_0202204 3300054114 Bacteria 1676
765 Ga0501084_0231760 3300054114 Bacteria 1559
766 Ga0501082_0007365 3300060353 Bacteria 9494
767 2509130499 2508501125 Bacteria 7208311
768 8055269225 8055266321 Bacteria 7999742
769 Ga0207674_10414125
770 Ga0065715_10040118
771 Ga0065715_10107365
772 Ga0065715_10126911
773 Ga0070658_10004464
774 Ga0070676_10001467
775 Ga0070676_10104773
776 Ga0070683_100000795
777 Ga0070683_100007143
778 Ga0070683_100109611
779 Ga0070683_100125297
780 Ga0070683_100212432
781 Ga0070683_100542898
782 Ga0070690_100038488
783 Ga0070690_100060200
784 Ga0070670_100226419
785 Ga0070670_100254883
786 Ga0070670_100432311
787 Ga0068869_100052723
788 Ga0068869_100267018
789 Ga0070666_10007556
790 Ga0070666_10043303
791 Ga0070666_10048229
792 Ga0070666_10143558
793 Ga0070682_100007915
794 Ga0070682_100280108
795 Ga0070682_100326297
796 Ga0068868_100002415
797 Ga0068868_100376485
798 Ga0068868_101302211
799 Ga0070660_100020628
800 Ga0070660_100240333
801 Ga0070660_100860087
802 Ga0070660_100909385
803 Ga0070689_100118810
804 Ga0070691_10028947
805 Ga0070687_100006786
806 Ga0070687_100145373
807 Ga0070687_100349317
808 Ga0070661_100009261
809 Ga0070661_100018820
810 Ga0070661_100101542
811 Ga0070661_100303413
812 Ga0070661_100748283
813 Ga0070668_100011189
814 Ga0070669_100067681
815 Ga0070669_100078274
816 Ga0070669_100111329
817 Ga0070669_100142059
818 Ga0070669_100519381
819 Ga0070675_100042568
820 Ga0070675_100164906
821 Ga0070675_100400163
822 Ga0070675_100420369
823 Ga0070671_100016552
824 Ga0070671_100031925
825 Ga0070671_100403739
826 Ga0070674_100575148
827 Ga0070673_100017713
828 Ga0070673_100112586
829 Ga0070673_100975905
830 Ga0070673_101057242
831 Ga0070688_100169800
832 Ga0070659_100041610
833 Ga0070659_100240732
834 Ga0070659_100435548
835 Ga0070667_100000129
836 Ga0070667_100004742
837 Ga0070667_100013626
838 Ga0070667_100031761
839 Ga0070667_100100550
840 Ga0070709_10061645
841 Ga0070709_10085847
842 Ga0070709_10918412
843 Ga0070714_100152368
844 Ga0070714_100504760
845 Ga0070714_100965144
846 Ga0070713_100001016
847 Ga0070713_100004083
848 Ga0070713_100093207
849 Ga0070713_100298439
850 Ga0070713_100740342
851 Ga0070701_10160587
852 Ga0070711_100000199
853 Ga0070711_100863173
854 Ga0070705_100010543
855 Ga0070700_100001944
856 Ga0070700_100240414
857 Ga0070694_100014427
858 Ga0070663_100003626
859 Ga0070663_100069973
860 Ga0070663_100679663
861 Ga0070678_100065502
862 Ga0070662_100002845
863 Ga0070662_100252299
864 Ga0070662_100367511
865 Ga0070681_10021742
866 Ga0070681_10106791
867 Ga0070681_10129992
868 Ga0070681_10303847
869 Ga0070681_10316107
870 Ga0070681_10527329
871 Ga0070681_10589727
872 Ga0070681_10719980
873 Ga0068867_100077592
874 Ga0068867_100082876
875 Ga0068867_100105529
876 Ga0068867_100635000
877 Ga0068867_100862911
878 Ga0070685_10036931
879 Ga0070685_10088076
880 Ga0070685_10102394
881 Ga0070699_100079576
882 Ga0070679_100001628
883 Ga0070679_100073184
884 Ga0070679_100098224
885 Ga0070679_100246882
886 Ga0070679_100436489
887 Ga0070679_100537071
888 Ga0070679_100939535
889 Ga0070684_100001729
890 Ga0070684_100025145
891 Ga0070684_100038613
892 Ga0070684_100176464
893 Ga0070684_100246557
894 Ga0070684_100249610
895 Ga0068853_100038442
896 Ga0068853_100041427
897 Ga0068853_100083208
898 Ga0068853_100161274
899 Ga0068853_100311279
900 Ga0068853_100671399
901 Ga0068853_101155073
902 Ga0068853_101179561
903 Ga0068853_101213757
904 Ga0070672_100018129
905 Ga0070686_100039984
906 Ga0070686_100512171
907 Ga0070695_100005501
908 Ga0070695_100087103
909 Ga0070695_100367697
910 Ga0070696_100004289
911 Ga0070696_100004520
912 Ga0070693_100241565
913 Ga0070693_100300624
914 Ga0070693_100454984
915 Ga0070665_100013453
916 Ga0070665_100068349
917 Ga0070665_100815909
918 Ga0068855_100190937
919 Ga0068855_100304962
920 Ga0068855_100325198
921 Ga0068855_100470403
922 Ga0068855_100554669
923 Ga0070664_100002294
924 Ga0070664_100007502
925 Ga0070664_100009554
926 Ga0070664_100035559
927 Ga0070664_100104037
928 Ga0068857_100297102
929 Ga0068857_100423703
930 Ga0068857_100689263
931 Ga0068854_100056768
932 Ga0068854_100100965
933 Ga0068854_100132981
934 Ga0068854_100159135
935 Ga0068854_100178603
936 Ga0068854_100266473
937 Ga0068856_100037956
938 Ga0070702_100001633
939 Ga0070702_100092446
940 Ga0068852_100029316
941 Ga0068852_100050119
942 Ga0068852_100064213
943 Ga0068852_100076792
944 Ga0068852_100360168
945 Ga0068852_101486089
946 Ga0068859_100031383
947 Ga0068864_100455521
948 Ga0068866_10026547
949 Ga0068861_100003061
950 Ga0068861_100038676
951 Ga0068861_100136080
952 Ga0068861_100462951
953 Ga0068861_101357677
954 Ga0068851_10013342
955 Ga0068851_10144312
956 Ga0068851_10221207
957 Ga0068870_10347916
958 Ga0068863_100015555
959 Ga0068863_100138441
960 Ga0068863_101154170
961 Ga0068858_100077734
962 Ga0068858_100101198
963 Ga0068858_100551972
964 Ga0068860_100030175
965 Ga0068860_100162747
966 Ga0068860_100221046
967 Ga0068860_100254419
968 Ga0068862_100021983
969 Ga0068862_100064251
970 Ga0068862_100103287
971 Ga0081455_10067561
972 Ga0070717_10363068
973 Ga0070717_10435112
974 Ga0070717_10447058
975 Ga0075363_100182710
976 Ga0070716_100019858
977 Ga0070712_100097309
978 Ga0070712_100276512
979 Ga0070712_100596331
980 Ga0075362_10040494
981 Ga0075367_10000686
982 Ga0075366_10001385
983 Ga0097621_100093146
984 Ga0075370_10031441
985 Ga0068871_100064103
986 Ga0075428_100012697
987 Ga0075428_100243428
988 Ga0075431_100075567
989 Ga0075431_101218597
990 Ga0075431_101276029
991 Ga0075433_10277255
992 Ga0075434_100045045
993 Ga0068865_100004047
994 Ga0068865_100550718
995 Ga0075436_100030280
996 Ga0097620_100031383
997 Ga0099795_10011947
998 Ga0105240_10055252
999 Ga0105240_10059013
1000 Ga0105240_10105303
1001 Ga0111539_10000734
1002 Ga0111539_10000994
1003 Ga0111539_10008471
1004 Ga0111539_10112731
1005 Ga0111539_10790585
1006 Ga0105245_10156238
1007 Ga0105245_10185077
1008 Ga0105247_10085705
1009 Ga0114129_10016679
1010 Ga0105243_10064032
1011 Ga0105243_10501130
1012 Ga0105243_10516203
1013 Ga0105241_10053698
1014 Ga0105241_10225498
1015 Ga0105242_10012408
1016 Ga0105242_10144801
1017 Ga0105242_10528383
1018 Ga0105242_10784484
1019 Ga0105248_10027917
1020 Ga0105248_10034437
1021 Ga0105248_10045550
1022 Ga0105248_10209937
1023 Ga0105248_11040294
1024 Ga0105237_10000049
1025 Ga0105237_10164203
1026 Ga0105238_10043645
1027 Ga0105238_11215491
1028 Ga0105249_10019079
1029 Ga0105249_10203251
1030 Ga0105249_10338935
1031 Ga0105239_10037969
1032 Ga0105239_10413120
1033 Ga0105239_10869090
1034 Ga0105246_10024901
1035 Ga0157373_10004182
1036 Ga0157373_10069264
1037 Ga0157373_10184280
1038 Ga0157373_10350004
1039 Ga0157373_10358638
1040 Ga0157371_10254621
1041 Ga0157370_10027797
1042 Ga0157370_10145508
1043 Ga0157370_10253064
1044 Ga0157370_10301892
1045 Ga0157370_10801025
1046 Ga0157369_10029444
1047 Ga0157369_10104622
1048 Ga0157369_10242558
1049 Ga0157369_11417801
1050 Ga0157374_10005768
1051 Ga0157374_10645448
1052 Ga0157378_10005847
1053 Ga0157378_10039511
1054 Ga0157378_10165484
1055 Ga0157378_10186811
1056 Ga0157378_10904369
1057 Ga0163162_10051416
1058 Ga0163162_10536455
1059 Ga0157372_10000829
1060 Ga0157372_10001054
1061 Ga0157372_10008051
1062 Ga0157372_10013269
1063 Ga0157372_10046972
1064 Ga0157372_10086858
1065 Ga0157372_10622277
1066 Ga0157375_10033217
1067 Ga0157375_10045806
1068 Ga0157375_10228956
1069 Ga0163163_10066886
1070 Ga0163163_10098534
1071 Ga0157380_10371072
1072 Ga0157377_10311463
1073 Ga0157377_10496985
1074 Ga0157379_10013757
1075 Ga0157379_10191724
1076 Ga0157379_10248132
1077 Ga0157376_10056243
1078 Ga0157376_10139622
1079 Ga0157376_11271121
1080 Ga0206353_10867396
1081 Ga0213871_10094795
1082 Ga0207673_1017059
1083 Ga0207697_10000173
1084 Ga0207697_10109255
1085 Ga0207656_10114408
1086 Ga0207656_10141780
1087 Ga0207642_10250137
1088 Ga0207710_10092432
1089 Ga0207688_10007915
1090 Ga0207688_10159972
1091 Ga0207680_10098172
1092 Ga0207680_10135026
1093 Ga0207680_10283679
1094 Ga0207680_10781966
1095 Ga0207645_10005656
1096 Ga0207645_10032873
1097 Ga0207645_10149544
1098 Ga0207705_10000867
1099 Ga0207654_10018736
1100 Ga0207707_10014017
1101 Ga0207707_10014058
1102 Ga0207707_10194121
1103 Ga0207707_10436684
1104 Ga0207695_10021244
1105 Ga0207695_10044548
1106 Ga0207695_10065541
1107 Ga0207695_10105006
1108 Ga0207671_10000004
1109 Ga0207671_10017884
1110 Ga0207671_10697774
1111 Ga0207693_10114039
1112 Ga0207693_10246672
1113 Ga0207693_10448121
1114 Ga0207663_10054228
1115 Ga0207663_10869541
1116 Ga0207660_10001655
1117 Ga0207660_11121550
1118 Ga0207662_10057735
1119 Ga0207662_10167867
1120 Ga0207657_10001939
1121 Ga0207657_10229669
1122 Ga0207657_10277867
1123 Ga0207649_10010248
1124 Ga0207649_10013548
1125 Ga0207649_10059441
1126 Ga0207649_10175694
1127 Ga0207649_10302371
1128 Ga0207649_10809638
1129 Ga0207652_10001455
1130 Ga0207652_10011529
1131 Ga0207652_10222928
1132 Ga0207652_10244886
1133 Ga0207652_10467252
1134 Ga0207681_10016432
1135 Ga0207681_10016751
1136 Ga0207681_10224373
1137 Ga0207681_10312724
1138 Ga0207681_10336267
1139 Ga0207694_10220774
1140 Ga0207694_10852550
1141 Ga0207650_10098636
1142 Ga0207650_10295490
1143 Ga0207650_10885159
1144 Ga0207659_10026197
1145 Ga0207659_10123308
1146 Ga0207659_10165697
1147 Ga0207659_10553707
1148 Ga0207687_10001094
1149 Ga0207700_10005781
1150 Ga0207700_10083651
1151 Ga0207664_10120938
1152 Ga0207664_10476081
1153 Ga0207664_10603412
1154 Ga0207644_10026392
1155 Ga0207644_10109130
1156 Ga0207690_10021830
1157 Ga0207690_10055598
1158 Ga0207690_10202907
1159 Ga0207706_10000520
1160 Ga0207706_10072695
1161 Ga0207706_10218458
1162 Ga0207686_10017948
1163 Ga0207686_10064746
1164 Ga0207686_11007491
1165 Ga0207709_10133283
1166 Ga0207709_10194903
1167 Ga0207670_10041546
1168 Ga0207669_10318434
1169 Ga0207669_10798539
1170 Ga0207704_10327157
1171 Ga0207704_10418891
1172 Ga0207704_10533973
1173 Ga0207665_10009293
1174 Ga0207691_10013388
1175 Ga0207711_10009104
1176 Ga0207711_10047301
1177 Ga0207711_10068530
1178 Ga0207689_10027261
1179 Ga0207689_10078950
1180 Ga0207661_10035131
1181 Ga0207661_10118209
1182 Ga0207661_10172092
1183 Ga0207661_10401905
1184 Ga0207679_10006902
1185 Ga0207679_10032904
1186 Ga0207679_10034339
1187 Ga0207679_10185535
1188 Ga0207679_10247672
1189 Ga0207679_10371549
1190 Ga0207679_10394307
1191 Ga0207679_10401351
1192 Ga0207667_10006739
1193 Ga0207667_10145977
1194 Ga0207667_10236962
1195 Ga0207667_11142121
1196 Ga0207651_10029425
1197 Ga0207651_10039374
1198 Ga0207651_10073034
1199 Ga0207712_10031036
1200 Ga0207712_10031572
1201 Ga0207668_10015023
1202 Ga0207668_10053146
1203 Ga0207668_10117100
1204 Ga0207640_10016974
1205 Ga0207640_10060777
1206 Ga0207640_10661337
1207 Ga0207640_10861990
1208 Ga0207658_10000126
1209 Ga0207658_10015990
1210 Ga0207658_10246104
1211 Ga0207677_10005303
1212 Ga0207677_10053474
1213 Ga0207677_10054322
1214 Ga0207677_10510666
1215 Ga0207703_10059145
1216 Ga0207703_10092690
1217 Ga0207639_10055129
1218 Ga0207639_10153858
1219 Ga0207639_10249966
1220 Ga0207639_10690361
1221 Ga0207639_11076296
1222 Ga0207678_10006010
1223 Ga0207678_10706502
1224 Ga0207708_10006637
1225 Ga0207708_10120497
1226 Ga0207708_10256946
1227 Ga0207702_10013324
1228 Ga0207702_10042416
1229 Ga0207641_10191557
1230 Ga0207648_10002220
1231 Ga0207648_10013389
1232 Ga0207648_10092526
1233 Ga0207648_10306086
1234 Ga0207676_10041682
1235 Ga0207674_10033656
1236 Ga0207674_10035827
1237 Ga0207674_10587782
1238 Ga0207675_100000371
1239 Ga0207675_100069702
1240 Ga0207675_100142861
1241 Ga0207675_100241092
1242 Ga0207675_100998216
1243 Ga0207683_10006929
1244 Ga0207683_10086652
1245 Ga0207683_10618121
1246 Ga0207698_10037816
1247 Ga0207698_10055847
1248 Ga0207698_10618003
1249 Ga0209371_1006695
1250 Ga0209967_1019945
1251 Ga0209995_1002812
1252 Ga0209999_1000731
1253 Ga0209966_1000275
1254 Ga0209998_10000191
1255 Ga0207428_10000070
1256 Ga0207428_10033077
1257 Ga0207428_10052216
1258 Ga0207428_10156327
1259 Ga0268266_10013297
1260 Ga0268266_10070048
1261 Ga0268266_10090123
1262 Ga0268265_10069590
1263 Ga0268265_10081975
1264 Ga0268265_10192822
1265 Ga0268264_10020380
1266 Ga0268264_10147554
1267 Ga0268264_10182900
1268 Ga0307515_10000019
1269 Ga0265338_10000613
1270 Ga0265338_10037851
1271 Ga0268256_1006731
1272 Ga0265332_10070390
1273 Ga0265325_10025593
1274 Ga0265325_10332114
1275 Ga0265327_10006752
1276 Ga0307408_100148296
1277 Ga0265314_10031389
1278 Ga0307405_10018831
1279 Ga0307413_10284594
1280 Ga0307410_10132607
1281 Ga0307406_10017722
1282 Ga0307407_10025970
1283 Ga0307409_100015935
1284 Ga0307409_100829237
1285 Ga0307409_101013643
1286 Ga0307416_100120759
1287 Ga0307414_10399606
1288 Ga0307415_100159130
1289 Ga0316212_1014589
1290 Ga0373930_0017646
1291 Ga0373934_0153406
1292 Ga0373923_0370929
1293 Ga0373932_0033333
1294 Ga0373939_0040833
1295 Ga0373941_0083917
1296 Ga0373960_0037453
1297 Ga0373960_0070228
1298 Ga0373943_0008200
1299 Ga0373943_0044220
1300 Ga0373942_0036522
1301 Ga0373961_0092705
1302 Ga0373931_0072490
1303 Ga0373927_0225459
1304 Ga0373927_0257663
1305 Ga0373927_0266129
1306 Ga0373947_0046354
1307 Ga0373947_0184016
1308 Ga0373925_0071106
1309 Ga0373925_0106130
1310 Ga0373925_0368765
1311 Ga0395905_0681021
1312 Ga0436360_1300662
1313 Ga0436363_1404847
1314 Ga0439448_0056445
1315 Ga0466969_0009518
1316 Ga0453683_0002671
1317 Ga0466966_0233240
1318 Ga0466966_0332379
1319 Ga0466959_0548057
1320 Ga0466958_0051235
1321 Ga0466967_1482811
1322 Ga0495592_0121852
1323 Ga0495603_0066492
1324 Ga0495591_000325
1325 Ga0495629_0002254
1326 Ga0495629_0106770
1327 Ga0495629_0161724
1328 Ga0495641_0054929
1329 Ga0495651_0063790
1330 Ga0495650_0005337
1331 Ga0495580_0003590
1332 Ga0495580_0022825
1333 Ga0495580_0026216
1334 Ga0495580_0218538
1335 Ga0495580_0392386
1336 Ga0495580_1040901
1337 Ga0495582_0025858
1338 Ga0495582_0129508
1339 Ga0495662_0081185
1340 Ga0495664_0115010
1341 Ga0495664_0229515
1342 Ga0495596_0002393
1343 Ga0495618_0001764
1344 Ga0495628_0102503
1345 Ga0495630_0012072
1346 Ga0495630_0015604
1347 Ga0495648_0004224
1348 Ga0495666_0005640
1349 Ga0495665_0000428
1350 Ga0495665_0451566
1351 Ga0495640_0014148
1352 Ga0495586_0028706
1353 Ga0495586_0060217
1354 Ga0495587_0009056
1355 Ga0495645_0086930
1356 Ga0495645_0329743
1357 Ga0495645_0375732
1358 Ga0495634_0016785
1359 Ga0495635_0002492
1360 Ga0495635_0111577
1361 Ga0495661_0009932
1362 Ga0495657_0171757
1363 Ga0495599_0003940
1364 Ga0495623_0005647
1365 Ga0495623_0037635
1366 Ga0495646_0001254
1367 Ga0495658_0039652
1368 Ga0495613_0005215
1369 Ga0495624_0015328
1370 Ga0495671_0164161
1371 Ga0495649_0295535
1372 Ga0495589_0031769
1373 Ga0495600_0044549
1374 Ga0495581_0009248
1375 Ga0495604_0345799
1376 Ga0495674_0024368
1377 Ga0495674_0040147
1378 Ga0495672_0077178
1379 Ga0495676_0015142
1380 Ga0495676_0256382
1381 Ga0495680_0065373
1382 Ga0495683_0003029
1383 Ga0495675_0055253
1384 Ga0495679_000078
1385 Ga0495673_0003323
1386 Ga0495686_0335300
1387 Ga0495593_0006054
1388 Ga0495593_0117527
1389 Ga0495602_0062316
1390 Ga0495602_0194749
1391 Ga0495602_0352797
1392 Ga0495614_0000980
1393 Ga0496102_0016863
1394 Ga0496102_0204993
1395 Ga0496102_0350438
1396 Ga0496102_0651452
1397 Ga0496103_0001707
1398 Ga0496103_0034303
1399 Ga0496103_0119949
1400 Ga0496104_0206576
1401 Ga0496105_0311396
1402 Ga0496106_0083903
1403 Ga0496107_0091282
1404 Ga0496107_0295783
1405 Ga0496108_0292511
1406 Ga0496108_0663672
1407 Ga0496109_0148514
1408 Ga0496109_0694779
1409 Ga0496110_0082637
1410 Ga0496110_0241074
1411 Ga0496112_0000778
1412 Ga0496112_0107736
1413 Ga0496112_0710905
1414 Ga0496113_0000486
1415 Ga0496115_0175082
1416 Ga0496115_0324546
1417 Ga0496117_0002917
1418 Ga0496118_0000647
1419 Ga0495682_0003827
1420 Ga0501299_006373
1421 Ga0501031_0052634
1422 Ga0501032_0001691
1423 Ga0501032_0069395
1424 Ga0501033_0125846
1425 Ga0501034_0001905
1426 Ga0501034_0099943
1427 Ga0501034_0118275
1428 Ga0501034_0299060
1429 Ga0501034_0343446
1430 Ga0501034_0513375
1431 Ga0501034_0570596
1432 Ga0501036_0081298
1433 Ga0501036_0104720
1434 Ga0501036_0169180
1435 Ga0501036_0216639
1436 Ga0501037_0092490
1437 Ga0501037_0130747
1438 Ga0501038_0047589
1439 Ga0501038_0282533
1440 Ga0501038_0307628
1441 Ga0501039_0086117
1442 Ga0501039_0088359
1443 Ga0501039_0453696
1444 Ga0501043_0024334
1445 Ga0501043_0027049
1446 Ga0501043_0525751
1447 Ga0501043_0776817
1448 Ga0501046_0010200
1449 Ga0501046_0028871
1450 Ga0501046_0034470
1451 Ga0501046_0278994
1452 Ga0501047_0001035
1453 Ga0501047_0036270
1454 Ga0501047_0132346
1455 Ga0501047_0137549
1456 Ga0501047_0164698
1457 Ga0501047_0456643
1458 Ga0501048_0050065
1459 Ga0501067_0025213
1460 Ga0501067_0058650
1461 Ga0501067_0144595
1462 Ga0501068_0028009
1463 Ga0501069_0007457
1464 Ga0501069_0014264
1465 Ga0501070_0084763
1466 Ga0501070_0210903
1467 Ga0501070_0379706
1468 Ga0501070_0450061
1469 Ga0501070_0897169
1470 Ga0501072_0050811
1471 Ga0501072_0112095
1472 Ga0501073_0008577
1473 Ga0501073_0013165
1474 Ga0501073_0056266
1475 Ga0501073_0070825
1476 Ga0501073_0211145
1477 Ga0501073_0315567
1478 Ga0501074_0077712
1479 Ga0501074_0317509
1480 Ga0501076_0206240
1481 Ga0501202_001342
1482 Ga0501207_000349
1483 Ga0501211_009049
1484 Ga0501216_005177
1485 Ga0501217_003466
1486 Ga0501230_007794
1487 Ga0501233_007205
1488 Ga0501235_000580
1489 Ga0501239_001170
1490 Ga0501242_000413
1491 Ga0501243_001182
1492 Ga0501249_004894
1493 Ga0501259_000815
1494 Ga0501261_002241
1495 Ga0501221_001803
1496 Ga0501225_0023740
1497 Ga0501080_0009528
1498 Ga0501080_0040142
1499 Ga0501080_0054699
1500 Ga0501080_0526417
1501 Ga0501083_0002234
1502 Ga0501083_0009130
1503 Ga0501083_0014388
1504 Ga0501083_0045271
1505 Ga0501083_0071133
1506 Ga0501262_002710
1507 Ga0501263_012594
1508 Ga0501266_001622
1509 Ga0501267_008934
1510 Ga0501268_000157
1511 Ga0501272_000523
1512 Ga0501035_0017757
1513 Ga0501035_0611198
1514 Ga0501044_0011977
1515 Ga0501044_0264238
1516 nmdc:mga03n38_11107_c1
1517 nmdc:mga00v17_24049_c1
1518 nmdc:mga06z11_2761_c1
1519 nmdc:mga05p37_35085_c1
1520 nmdc:mga06r32_1074118_c1
1521 nmdc:mga06r32_530816_c1
1522 nmdc:mga08y16_1261069_c1
1523 nmdc:mga08y16_180399_c1
1524 nmdc:mga08y16_254895_c1
1525 nmdc:mga08y16_4052_c1
1526 nmdc:mga08y16_6635_c1
1527 nmdc:mga08y16_90850_c1
1528 nmdc:mga0n895_10785_c1
1529 nmdc:mga08x19_5879_c1
1530 nmdc:mga0a205_35914_c1
1531 Ga0501084_0038944
1532 Ga0501084_0202204
1533 Ga0501084_0231760
1534 Ga0501082_0007365
1535 2509130499
1536 8055269225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

69

182

0.83

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

59

171

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8611 25 146
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8534 25 147
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.834 27 145
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.827 25 154
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8267 19 147
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8273 27 151 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8193 25 148 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8167 22 147 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8066 27 154 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7998 25 147 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.978 4 177
AF-A0A2V9UXS0-F1-model_v4 Polyketide cyclase 0.9723 1 181
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.972 1 177
AF-A0A2V9UXS0-F1-model_v4 Polyketide cyclase 0.967 1 181
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9666 1 177

Map