F479916
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 767 | 356 | 1534 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300046664|Ga0495659_0051382|Ga0495659_0051382_211_1404 |
| Length | 397 |
| Sequence | MPELAEIFRAAGPRYREVHAGRLLPSHRRAMADIERCRTPALGGSLYACDACGSLDYAYHSCRNRHCPTCQADRANDWLRFTRERLLPCDHYLLTFTLPEQLRGVARSHQHVVYSTLFQAAAAAVQTLAADRRWIGGTVGILAVLHTWTRTMEYHPHVHLLVTAGGLSSGGDADGAADGDAWVKPAHWRFLMPGYMLSELFRAKVRDALTRADVVRDVDPAVWDRAWTVHVQQIGRGEQAARYLSRYIYKVALTNDRIERFEHGKNGENAHVTFRYIHADTGDTRRQTLPVDTFIGRFLQHVLPRGFTKVRSYGLLSPTHRPKLERARHLLQLHAQTTALQSPPSDVEPNVGSNGSIGTDGALPDTATASRAVRCCPACHRGTLRRIGTIPRPRAPP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 107 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 220 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 221 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 222 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 228 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 229 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 230 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 3.26 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495659_0051382 | 3300046664 | Bacteria | 1501 |
| 2 | CNAas_1001119 | 3300000532 | Unclassified | 2443 |
| 3 | LJNas_1002875 | 3300000546 | Bacteria | 2029 |
| 4 | JGI24738J21930_10008914 | 3300002075 | Bacteria | 2273 |
| 5 | JGI24744J21845_10006485 | 3300002077 | Bacteria | 2427 |
| 6 | Ga0070658_10079347 | 3300005327 | Bacteria | 2695 |
| 7 | Ga0070658_10119847 | 3300005327 | Bacteria | 2186 |
| 8 | Ga0070676_10041364 | 3300005328 | Bacteria | 2673 |
| 9 | Ga0070676_10051409 | 3300005328 | Bacteria | 2419 |
| 10 | Ga0070690_100058593 | 3300005330 | Bacteria | 2474 |
| 11 | Ga0070670_100045004 | 3300005331 | Bacteria | 3794 |
| 12 | Ga0070670_100101394 | 3300005331 | Bacteria | 2478 |
| 13 | Ga0068869_100052168 | 3300005334 | Bacteria | 2969 |
| 14 | Ga0068869_100107430 | 3300005334 | Bacteria | 2119 |
| 15 | Ga0070666_10057003 | 3300005335 | Bacteria | 2639 |
| 16 | Ga0070666_10066780 | 3300005335 | Bacteria | 2441 |
| 17 | Ga0070666_10083154 | 3300005335 | Bacteria | 2190 |
| 18 | Ga0070680_100243139 | 3300005336 | Bacteria | 1521 |
| 19 | Ga0070682_100056016 | 3300005337 | Bacteria | 2478 |
| 20 | Ga0068868_100026004 | 3300005338 | Bacteria | 4457 |
| 21 | Ga0068868_100139302 | 3300005338 | Bacteria | 1990 |
| 22 | Ga0070660_100079734 | 3300005339 | Bacteria | 2569 |
| 23 | Ga0070689_100075524 | 3300005340 | Bacteria | 2639 |
| 24 | Ga0070687_100019718 | 3300005343 | Bacteria | 3142 |
| 25 | Ga0070687_100095023 | 3300005343 | Unclassified | 1657 |
| 26 | Ga0070692_10110197 | 3300005345 | Unclassified | 1521 |
| 27 | Ga0070669_100050012 | 3300005353 | Bacteria | 3052 |
| 28 | Ga0070669_100064557 | 3300005353 | Bacteria | 2696 |
| 29 | Ga0070675_100087752 | 3300005354 | Bacteria | 2601 |
| 30 | Ga0070671_100067269 | 3300005355 | Bacteria | 2987 |
| 31 | Ga0070671_100087784 | 3300005355 | Bacteria | 2603 |
| 32 | Ga0070673_100012684 | 3300005364 | Bacteria | 5796 |
| 33 | Ga0070673_100074575 | 3300005364 | Bacteria | 2734 |
| 34 | Ga0070673_100079767 | 3300005364 | Bacteria | 2651 |
| 35 | Ga0070688_100088177 | 3300005365 | Bacteria | 2022 |
| 36 | Ga0070659_100088529 | 3300005366 | Bacteria | 2479 |
| 37 | Ga0070667_100017724 | 3300005367 | Bacteria | 5902 |
| 38 | Ga0070667_100062090 | 3300005367 | Bacteria | 3164 |
| 39 | Ga0070709_10047024 | 3300005434 | Bacteria | 2686 |
| 40 | Ga0070709_10054629 | 3300005434 | Plasmid | 2519 |
| 41 | Ga0070709_10065994 | 3300005434 | Bacteria | 2319 |
| 42 | Ga0070709_10106303 | 3300005434 | Bacteria | 1879 |
| 43 | Ga0070714_100073738 | 3300005435 | Bacteria | 2958 |
| 44 | Ga0070714_100077890 | 3300005435 | Plasmid | 2880 |
| 45 | Ga0070713_100069216 | 3300005436 | Plasmid | 2975 |
| 46 | Ga0070713_100091406 | 3300005436 | Plasmid | 2618 |
| 47 | Ga0070713_100103023 | 3300005436 | Unclassified | 2476 |
| 48 | Ga0070713_100152445 | 3300005436 | Bacteria | 2057 |
| 49 | Ga0070713_100269292 | 3300005436 | Bacteria | 1559 |
| 50 | Ga0070710_10016423 | 3300005437 | Bacteria | 3766 |
| 51 | Ga0070710_10044129 | 3300005437 | Unclassified | 2472 |
| 52 | Ga0070710_10086224 | 3300005437 | Bacteria | 1844 |
| 53 | Ga0070701_10051034 | 3300005438 | Bacteria | 2145 |
| 54 | Ga0070711_100060390 | 3300005439 | Bacteria | 2635 |
| 55 | Ga0070711_100060763 | 3300005439 | Plasmid | 2628 |
| 56 | Ga0070711_100063214 | 3300005439 | Plasmid | 2583 |
| 57 | Ga0070711_100107429 | 3300005439 | Bacteria | 2042 |
| 58 | Ga0070700_100034122 | 3300005441 | Bacteria | 3070 |
| 59 | Ga0070708_100133601 | 3300005445 | Bacteria | 2298 |
| 60 | Ga0070663_100063498 | 3300005455 | Bacteria | 2667 |
| 61 | Ga0070663_100147205 | 3300005455 | Bacteria | 1803 |
| 62 | Ga0070662_100065607 | 3300005457 | Bacteria | 2661 |
| 63 | Ga0070681_10087703 | 3300005458 | Bacteria | 3064 |
| 64 | Ga0070685_10033118 | 3300005466 | Bacteria | 2899 |
| 65 | Ga0070685_10048548 | 3300005466 | Bacteria | 2445 |
| 66 | Ga0070685_10049149 | 3300005466 | Bacteria | 2432 |
| 67 | Ga0070707_100170165 | 3300005468 | Bacteria | 2123 |
| 68 | Ga0070679_100226155 | 3300005530 | Unclassified | 1831 |
| 69 | Ga0070684_100075114 | 3300005535 | Bacteria | 2980 |
| 70 | Ga0068853_100087382 | 3300005539 | Bacteria | 2736 |
| 71 | Ga0070672_100048002 | 3300005543 | Bacteria | 3315 |
| 72 | Ga0070672_100067554 | 3300005543 | Bacteria | 2833 |
| 73 | Ga0070672_100084688 | 3300005543 | Bacteria | 2546 |
| 74 | Ga0070693_100045404 | 3300005547 | Bacteria | 2490 |
| 75 | Ga0070665_100094957 | 3300005548 | Plasmid | 2986 |
| 76 | Ga0070665_100119095 | 3300005548 | Bacteria | 2642 |
| 77 | Ga0070665_100147110 | 3300005548 | Bacteria | 2359 |
| 78 | Ga0070665_100281635 | 3300005548 | Bacteria | 1665 |
| 79 | Ga0068855_100360016 | 3300005563 | Unclassified | 1601 |
| 80 | Ga0070664_100094839 | 3300005564 | Bacteria | 2588 |
| 81 | Ga0068857_100040160 | 3300005577 | Bacteria | 4149 |
| 82 | Ga0068854_100073340 | 3300005578 | Bacteria | 2508 |
| 83 | Ga0068854_100228991 | 3300005578 | Bacteria | 1474 |
| 84 | Ga0068856_100039596 | 3300005614 | Bacteria | 4627 |
| 85 | Ga0068856_100117221 | 3300005614 | Bacteria | 2663 |
| 86 | Ga0068856_100206708 | 3300005614 | Bacteria | 1978 |
| 87 | Ga0070702_100140476 | 3300005615 | Unclassified | 1537 |
| 88 | Ga0068859_100094114 | 3300005617 | Bacteria | 3048 |
| 89 | Ga0068859_100116666 | 3300005617 | Bacteria | 2734 |
| 90 | Ga0068864_100067198 | 3300005618 | Bacteria | 3113 |
| 91 | Ga0068864_100157479 | 3300005618 | Bacteria | 2062 |
| 92 | Ga0068864_100458735 | 3300005618 | Bacteria | 1220 |
| 93 | Ga0068866_10028223 | 3300005718 | Unclassified | 2672 |
| 94 | Ga0068861_100029462 | 3300005719 | Unclassified | 4016 |
| 95 | Ga0068861_100077966 | 3300005719 | Bacteria | 2586 |
| 96 | Ga0068851_10057785 | 3300005834 | Bacteria | 1981 |
| 97 | Ga0068870_10035468 | 3300005840 | Bacteria | 2559 |
| 98 | Ga0068863_100093280 | 3300005841 | Bacteria | 2857 |
| 99 | Ga0068863_100180102 | 3300005841 | Bacteria | 2029 |
| 100 | Ga0068858_100079222 | 3300005842 | Bacteria | 3053 |
| 101 | Ga0068858_100120636 | 3300005842 | Bacteria | 2452 |
| 102 | Ga0068860_100107318 | 3300005843 | Bacteria | 2668 |
| 103 | Ga0068860_100124946 | 3300005843 | Bacteria | 2466 |
| 104 | Ga0068862_100065978 | 3300005844 | Bacteria | 3118 |
| 105 | Ga0068862_100103158 | 3300005844 | Bacteria | 2497 |
| 106 | Ga0081455_10000879 | 3300005937 | Bacteria | 38878 |
| 107 | Ga0081455_10041123 | 3300005937 | Bacteria | 4070 |
| 108 | Ga0081455_10056590 | 3300005937 | Bacteria | 3328 |
| 109 | Ga0081540_1006008 | 3300005983 | Bacteria | 8941 |
| 110 | Ga0081540_1038963 | 3300005983 | Unclassified | 2497 |
| 111 | Ga0070717_10034411 | 3300006028 | Bacteria | 4095 |
| 112 | Ga0070717_10071929 | 3300006028 | Plasmid | 2886 |
| 113 | Ga0070717_10096586 | 3300006028 | Plasmid | 2503 |
| 114 | Ga0070717_10098948 | 3300006028 | Bacteria | 2474 |
| 115 | Ga0070715_10005934 | 3300006163 | Bacteria | 4117 |
| 116 | Ga0070716_100021878 | 3300006173 | Bacteria | 3373 |
| 117 | Ga0070712_100062317 | 3300006175 | Bacteria | 2636 |
| 118 | Ga0070712_100068171 | 3300006175 | Bacteria | 2534 |
| 119 | Ga0070712_100105104 | 3300006175 | Bacteria | 2096 |
| 120 | Ga0070712_100113359 | 3300006175 | Bacteria | 2027 |
| 121 | Ga0070712_100128268 | 3300006175 | Bacteria | 1919 |
| 122 | Ga0070712_100151798 | 3300006175 | Unclassified | 1779 |
| 123 | Ga0070712_100320911 | 3300006175 | Bacteria | 1259 |
| 124 | Ga0097621_100085350 | 3300006237 | Bacteria | 2633 |
| 125 | Ga0068871_100160685 | 3300006358 | Bacteria | 1921 |
| 126 | Ga0075428_100106211 | 3300006844 | Bacteria | 3061 |
| 127 | Ga0075431_100200724 | 3300006847 | Unclassified | 2040 |
| 128 | Ga0075433_10063393 | 3300006852 | Archaea | 3238 |
| 129 | Ga0075434_100094887 | 3300006871 | Archaea | 2988 |
| 130 | Ga0068865_100052827 | 3300006881 | Bacteria | 2817 |
| 131 | Ga0068865_100073457 | 3300006881 | Bacteria | 2432 |
| 132 | Ga0068865_100076192 | 3300006881 | Unclassified | 2394 |
| 133 | Ga0068865_100162515 | 3300006881 | Bacteria | 1705 |
| 134 | Ga0075436_100029193 | 3300006914 | Archaea | 3793 |
| 135 | Ga0075436_100066870 | 3300006914 | Bacteria | 2484 |
| 136 | Ga0097620_100094109 | 3300006931 | Bacteria | 3048 |
| 137 | Ga0097620_100116663 | 3300006931 | Bacteria | 2734 |
| 138 | Ga0075435_100060110 | 3300007076 | Archaea | 3080 |
| 139 | Ga0075435_100093157 | 3300007076 | Bacteria | 2489 |
| 140 | Ga0099795_10011103 | 3300007788 | Bacteria | 2677 |
| 141 | Ga0111539_10039356 | 3300009094 | Bacteria | 5700 |
| 142 | Ga0111539_10255809 | 3300009094 | Bacteria | 2039 |
| 143 | Ga0105245_10044493 | 3300009098 | Bacteria | 3963 |
| 144 | Ga0105245_10052564 | 3300009098 | Bacteria | 3654 |
| 145 | Ga0105245_10106775 | 3300009098 | Unclassified | 2598 |
| 146 | Ga0105247_10022639 | 3300009101 | Bacteria | 3784 |
| 147 | Ga0114129_10213224 | 3300009147 | Bacteria | 2609 |
| 148 | Ga0105243_10052824 | 3300009148 | Bacteria | 3221 |
| 149 | Ga0105241_10048325 | 3300009174 | Bacteria | 3238 |
| 150 | Ga0105241_10224305 | 3300009174 | Bacteria | 1581 |
| 151 | Ga0105242_10091640 | 3300009176 | Bacteria | 2559 |
| 152 | Ga0105242_10092518 | 3300009176 | Bacteria | 2547 |
| 153 | Ga0105242_10101000 | 3300009176 | Unclassified | 2444 |
| 154 | Ga0105248_10094610 | 3300009177 | Unclassified | 3364 |
| 155 | Ga0105248_10129569 | 3300009177 | Bacteria | 2846 |
| 156 | Ga0105248_10164384 | 3300009177 | Bacteria | 2502 |
| 157 | Ga0105248_10253810 | 3300009177 | Bacteria | 1979 |
| 158 | Ga0105237_10112461 | 3300009545 | Bacteria | 2715 |
| 159 | Ga0105237_10195366 | 3300009545 | Bacteria | 2023 |
| 160 | Ga0105238_10048435 | 3300009551 | Bacteria | 4284 |
| 161 | Ga0105249_10045967 | 3300009553 | Bacteria | 3973 |
| 162 | Ga0105249_10064391 | 3300009553 | Bacteria | 3370 |
| 163 | Ga0105249_10081301 | 3300009553 | Plasmid | 3011 |
| 164 | Ga0105249_10101156 | 3300009553 | Bacteria | 2711 |
| 165 | Ga0099796_10008293 | 3300010159 | Bacteria | 2765 |
| 166 | Ga0105239_10102519 | 3300010375 | Bacteria | 3167 |
| 167 | Ga0105239_10106262 | 3300010375 | Bacteria | 3109 |
| 168 | Ga0105239_10294166 | 3300010375 | Unclassified | 1828 |
| 169 | Ga0105246_10050420 | 3300011119 | Bacteria | 2855 |
| 170 | Ga0105246_10071063 | 3300011119 | Bacteria | 2450 |
| 171 | Ga0105246_10110722 | 3300011119 | Bacteria | 2017 |
| 172 | Ga0157374_10104469 | 3300013296 | Bacteria | 2719 |
| 173 | Ga0157374_10265296 | 3300013296 | Bacteria | 1692 |
| 174 | Ga0157378_10061529 | 3300013297 | Bacteria | 3351 |
| 175 | Ga0157378_10140019 | 3300013297 | Bacteria | 2246 |
| 176 | Ga0163162_10107208 | 3300013306 | Bacteria | 2889 |
| 177 | Ga0157372_10482416 | 3300013307 | Bacteria | 1445 |
| 178 | Ga0157375_10067486 | 3300013308 | Bacteria | 3574 |
| 179 | Ga0157375_10146705 | 3300013308 | Bacteria | 2490 |
| 180 | Ga0157375_10182739 | 3300013308 | Bacteria | 2249 |
| 181 | Ga0163163_10121480 | 3300014325 | Bacteria | 2646 |
| 182 | Ga0163163_10316214 | 3300014325 | Bacteria | 1615 |
| 183 | Ga0157380_10082972 | 3300014326 | Bacteria | 2624 |
| 184 | Ga0157380_10125867 | 3300014326 | Unclassified | 2178 |
| 185 | Ga0157377_10124523 | 3300014745 | Unclassified | 1566 |
| 186 | Ga0157376_10056433 | 3300014969 | Bacteria | 3281 |
| 187 | Ga0163161_10055415 | 3300017792 | Plasmid | 2878 |
| 188 | Ga0163161_10055550 | 3300017792 | Bacteria | 2875 |
| 189 | Ga0163161_10172212 | 3300017792 | Bacteria | 1656 |
| 190 | Ga0213873_10004325 | 3300021358 | Plasmid | 2640 |
| 191 | Ga0213873_10036746 | 3300021358 | Bacteria | 1245 |
| 192 | Ga0213874_10008603 | 3300021377 | Unclassified | 2493 |
| 193 | Ga0213874_10009071 | 3300021377 | Bacteria | 2446 |
| 194 | Ga0213876_10030729 | 3300021384 | Plasmid | 2833 |
| 195 | Ga0213876_10042021 | 3300021384 | Bacteria | 2415 |
| 196 | Ga0213871_10006837 | 3300021441 | Bacteria | 2434 |
| 197 | Ga0224572_1000068 | 3300024225 | Bacteria | 7115 |
| 198 | Ga0224572_1004346 | 3300024225 | Bacteria | 2457 |
| 199 | Ga0224572_1004640 | 3300024225 | Bacteria | 2405 |
| 200 | Ga0224572_1004725 | 3300024225 | Bacteria | 2391 |
| 201 | Ga0228598_1005455 | 3300024227 | Bacteria | 2659 |
| 202 | Ga0207697_10020892 | 3300025315 | Bacteria | 2680 |
| 203 | Ga0207656_10032488 | 3300025321 | Bacteria | 2168 |
| 204 | Ga0207682_10013269 | 3300025893 | Bacteria | 3210 |
| 205 | Ga0207692_10031416 | 3300025898 | Plasmid | 2543 |
| 206 | Ga0207692_10034465 | 3300025898 | Unclassified | 2451 |
| 207 | Ga0207710_10047984 | 3300025900 | Bacteria | 1910 |
| 208 | Ga0207688_10039481 | 3300025901 | Bacteria | 2621 |
| 209 | Ga0207680_10072142 | 3300025903 | Bacteria | 2143 |
| 210 | Ga0207647_10052045 | 3300025904 | Bacteria | 2528 |
| 211 | Ga0207685_10014491 | 3300025905 | Unclassified | 2470 |
| 212 | Ga0207699_10042525 | 3300025906 | Bacteria | 2633 |
| 213 | Ga0207699_10050641 | 3300025906 | Unclassified | 2450 |
| 214 | Ga0207699_10114725 | 3300025906 | Bacteria | 1733 |
| 215 | Ga0207645_10062013 | 3300025907 | Bacteria | 2388 |
| 216 | Ga0207643_10020776 | 3300025908 | Bacteria | 3604 |
| 217 | Ga0207643_10041727 | 3300025908 | Bacteria | 2586 |
| 218 | Ga0207705_10036735 | 3300025909 | Bacteria | 3505 |
| 219 | Ga0207705_10095024 | 3300025909 | Bacteria | 2187 |
| 220 | Ga0207654_10137364 | 3300025911 | Bacteria | 1555 |
| 221 | Ga0207707_10102335 | 3300025912 | Bacteria | 2503 |
| 222 | Ga0207671_10073555 | 3300025914 | Bacteria | 2553 |
| 223 | Ga0207693_10029263 | 3300025915 | Bacteria | 4353 |
| 224 | Ga0207693_10071667 | 3300025915 | Bacteria | 2713 |
| 225 | Ga0207693_10088953 | 3300025915 | Bacteria | 2420 |
| 226 | Ga0207693_10124215 | 3300025915 | Unclassified | 2028 |
| 227 | Ga0207693_10130164 | 3300025915 | Bacteria | 1978 |
| 228 | Ga0207663_10045001 | 3300025916 | Bacteria | 2712 |
| 229 | Ga0207663_10056923 | 3300025916 | Unclassified | 2461 |
| 230 | Ga0207663_10110009 | 3300025916 | Bacteria | 1868 |
| 231 | Ga0207663_10142773 | 3300025916 | Bacteria | 1670 |
| 232 | Ga0207662_10016399 | 3300025918 | Bacteria | 4181 |
| 233 | Ga0207662_10032372 | 3300025918 | Bacteria | 3043 |
| 234 | Ga0207657_10083133 | 3300025919 | Bacteria | 2686 |
| 235 | Ga0207649_10064632 | 3300025920 | Bacteria | 2314 |
| 236 | Ga0207652_10186231 | 3300025921 | Bacteria | 1867 |
| 237 | Ga0207681_10003810 | 3300025923 | Bacteria | 9355 |
| 238 | Ga0207681_10042646 | 3300025923 | Bacteria | 3032 |
| 239 | Ga0207681_10212935 | 3300025923 | Unclassified | 1490 |
| 240 | Ga0207694_10151809 | 3300025924 | Bacteria | 1867 |
| 241 | Ga0207650_10073191 | 3300025925 | Bacteria | 2580 |
| 242 | Ga0207659_10059273 | 3300025926 | Bacteria | 2751 |
| 243 | Ga0207659_10078268 | 3300025926 | Bacteria | 2436 |
| 244 | Ga0207687_10050358 | 3300025927 | Bacteria | 2899 |
| 245 | Ga0207687_10059670 | 3300025927 | Bacteria | 2688 |
| 246 | Ga0207700_10081239 | 3300025928 | Bacteria | 2530 |
| 247 | Ga0207700_10087050 | 3300025928 | Unclassified | 2456 |
| 248 | Ga0207700_10087144 | 3300025928 | Bacteria | 2455 |
| 249 | Ga0207700_10087302 | 3300025928 | Unclassified | 2453 |
| 250 | Ga0207700_10091714 | 3300025928 | Bacteria | 2400 |
| 251 | Ga0207700_10209356 | 3300025928 | Bacteria | 1648 |
| 252 | Ga0207700_10244652 | 3300025928 | Bacteria | 1530 |
| 253 | Ga0207664_10063466 | 3300025929 | Bacteria | 2952 |
| 254 | Ga0207664_10095274 | 3300025929 | Unclassified | 2448 |
| 255 | Ga0207664_10129327 | 3300025929 | Bacteria | 2124 |
| 256 | Ga0207644_10066848 | 3300025931 | Bacteria | 2618 |
| 257 | Ga0207644_10075522 | 3300025931 | Bacteria | 2476 |
| 258 | Ga0207706_10047047 | 3300025933 | Bacteria | 3818 |
| 259 | Ga0207706_10199535 | 3300025933 | Bacteria | 1755 |
| 260 | Ga0207686_10055511 | 3300025934 | Bacteria | 2485 |
| 261 | Ga0207686_10058554 | 3300025934 | Bacteria | 2429 |
| 262 | Ga0207709_10055779 | 3300025935 | Bacteria | 2443 |
| 263 | Ga0207670_10063668 | 3300025936 | Bacteria | 2524 |
| 264 | Ga0207669_10046765 | 3300025937 | Bacteria | 2559 |
| 265 | Ga0207669_10053437 | 3300025937 | Bacteria | 2433 |
| 266 | Ga0207669_10135152 | 3300025937 | Bacteria | 1702 |
| 267 | Ga0207704_10049954 | 3300025938 | Plasmid | 2520 |
| 268 | Ga0207704_10164874 | 3300025938 | Unclassified | 1581 |
| 269 | Ga0207665_10026357 | 3300025939 | Bacteria | 3838 |
| 270 | Ga0207691_10050138 | 3300025940 | Bacteria | 3823 |
| 271 | Ga0207691_10073645 | 3300025940 | Bacteria | 3080 |
| 272 | Ga0207691_10094272 | 3300025940 | Bacteria | 2679 |
| 273 | Ga0207711_10057108 | 3300025941 | Unclassified | 3355 |
| 274 | Ga0207711_10104454 | 3300025941 | Bacteria | 2510 |
| 275 | Ga0207711_10134898 | 3300025941 | Bacteria | 2216 |
| 276 | Ga0207689_10023026 | 3300025942 | Bacteria | 5231 |
| 277 | Ga0207689_10101238 | 3300025942 | Bacteria | 2366 |
| 278 | Ga0207661_10093600 | 3300025944 | Bacteria | 2508 |
| 279 | Ga0207679_10062034 | 3300025945 | Bacteria | 2784 |
| 280 | Ga0207651_10071748 | 3300025960 | Bacteria | 2456 |
| 281 | Ga0207651_10073052 | 3300025960 | Bacteria | 2437 |
| 282 | Ga0207651_10073148 | 3300025960 | Bacteria | 2436 |
| 283 | Ga0207651_10140201 | 3300025960 | Bacteria | 1866 |
| 284 | Ga0207712_10025050 | 3300025961 | Bacteria | 3960 |
| 285 | Ga0207668_10034635 | 3300025972 | Plasmid | 3355 |
| 286 | Ga0207668_10061642 | 3300025972 | Bacteria | 2638 |
| 287 | Ga0207668_10065498 | 3300025972 | Bacteria | 2572 |
| 288 | Ga0207640_10164730 | 3300025981 | Bacteria | 1645 |
| 289 | Ga0207658_10115749 | 3300025986 | Bacteria | 2128 |
| 290 | Ga0207677_10049269 | 3300026023 | Bacteria | 2841 |
| 291 | Ga0207677_10069674 | 3300026023 | Bacteria | 2474 |
| 292 | Ga0207677_10115941 | 3300026023 | Bacteria | 2005 |
| 293 | Ga0207703_10081311 | 3300026035 | Bacteria | 2700 |
| 294 | Ga0207639_10074841 | 3300026041 | Bacteria | 2661 |
| 295 | Ga0207678_10026635 | 3300026067 | Bacteria | 5044 |
| 296 | Ga0207678_10077719 | 3300026067 | Bacteria | 2843 |
| 297 | Ga0207708_10046530 | 3300026075 | Bacteria | 3304 |
| 298 | Ga0207708_10066138 | 3300026075 | Plasmid | 2764 |
| 299 | Ga0207708_10232939 | 3300026075 | Bacteria | 1479 |
| 300 | Ga0207702_10033722 | 3300026078 | Bacteria | 4277 |
| 301 | Ga0207702_10130598 | 3300026078 | Bacteria | 2260 |
| 302 | Ga0207641_10109358 | 3300026088 | Bacteria | 2448 |
| 303 | Ga0207641_10109612 | 3300026088 | Bacteria | 2445 |
| 304 | Ga0207641_10115331 | 3300026088 | Bacteria | 2388 |
| 305 | Ga0207648_10055121 | 3300026089 | Bacteria | 3471 |
| 306 | Ga0207648_10090361 | 3300026089 | Bacteria | 2676 |
| 307 | Ga0207648_10118056 | 3300026089 | Unclassified | 2331 |
| 308 | Ga0207676_10021831 | 3300026095 | Bacteria | 4702 |
| 309 | Ga0207676_10095686 | 3300026095 | Bacteria | 2449 |
| 310 | Ga0207676_10417651 | 3300026095 | Bacteria | 1257 |
| 311 | Ga0207674_10008547 | 3300026116 | Bacteria | 11808 |
| 312 | Ga0207674_10171211 | 3300026116 | Bacteria | 2125 |
| 313 | Ga0207675_100100768 | 3300026118 | Bacteria | 2721 |
| 314 | Ga0207675_100127408 | 3300026118 | Unclassified | 2412 |
| 315 | Ga0207683_10053914 | 3300026121 | Bacteria | 3526 |
| 316 | Ga0207683_10082655 | 3300026121 | Bacteria | 2853 |
| 317 | Ga0207683_10369441 | 3300026121 | Bacteria | 1318 |
| 318 | Ga0268266_10097428 | 3300028379 | Bacteria | 2586 |
| 319 | Ga0268266_10200565 | 3300028379 | Bacteria | 1826 |
| 320 | Ga0268266_10230022 | 3300028379 | Unclassified | 1707 |
| 321 | Ga0268265_10091697 | 3300028380 | Bacteria | 2430 |
| 322 | Ga0268264_10114663 | 3300028381 | Bacteria | 2366 |
| 323 | Ga0268264_10180687 | 3300028381 | Bacteria | 1916 |
| 324 | Ga0265337_1043048 | 3300028556 | Unclassified | 1292 |
| 325 | Ga0265338_10070076 | 3300028800 | Bacteria | 3008 |
| 326 | Ga0265770_1003786 | 3300030878 | Bacteria | 2056 |
| 327 | Ga0265760_10010376 | 3300031090 | Bacteria | 2660 |
| 328 | Ga0265330_10029221 | 3300031235 | Unclassified | 2481 |
| 329 | Ga0265331_10026155 | 3300031250 | Bacteria | 2937 |
| 330 | Ga0265316_10066088 | 3300031344 | Bacteria | 2799 |
| 331 | Ga0265316_10067947 | 3300031344 | Plasmid | 2755 |
| 332 | Ga0316575_10030058 | 3300031665 | Unclassified | 2123 |
| 333 | Ga0265342_10067444 | 3300031712 | Unclassified | 2093 |
| 334 | Ga0316576_10062210 | 3300031727 | Plasmid | 2737 |
| 335 | Ga0316578_10055858 | 3300031728 | Unclassified | 2318 |
| 336 | Ga0307410_10064000 | 3300031852 | Bacteria | 2525 |
| 337 | Ga0307406_10052340 | 3300031901 | Bacteria | 2596 |
| 338 | Ga0307407_10020469 | 3300031903 | Bacteria | 3391 |
| 339 | Ga0307409_100129065 | 3300031995 | Bacteria | 2156 |
| 340 | Ga0307416_100112631 | 3300032002 | Bacteria | 2401 |
| 341 | Ga0307414_10068846 | 3300032004 | Bacteria | 2541 |
| 342 | Ga0307411_10186681 | 3300032005 | Bacteria | 1579 |
| 343 | Ga0307415_100053765 | 3300032126 | Bacteria | 2745 |
| 344 | Ga0316583_10006576 | 3300032133 | Bacteria | 4178 |
| 345 | Ga0373926_0008846 | 3300035083 | Bacteria | 3354 |
| 346 | Ga0373926_0018570 | 3300035083 | Bacteria | 2393 |
| 347 | Ga0373928_0012056 | 3300035084 | Bacteria | 1719 |
| 348 | Ga0373929_0005160 | 3300035085 | Bacteria | 2347 |
| 349 | Ga0373934_0003928 | 3300035086 | Bacteria | 5461 |
| 350 | Ga0373934_0012101 | 3300035086 | Bacteria | 3254 |
| 351 | Ga0373934_0020169 | 3300035086 | Bacteria | 2561 |
| 352 | Ga0373934_0020626 | 3300035086 | Bacteria | 2533 |
| 353 | Ga0373944_0008029 | 3300035089 | Bacteria | 2845 |
| 354 | Ga0373944_0018915 | 3300035089 | Bacteria | 1971 |
| 355 | Ga0373923_0008764 | 3300035111 | Bacteria | 3625 |
| 356 | Ga0373923_0017114 | 3300035111 | Bacteria | 2766 |
| 357 | Ga0373923_0022689 | 3300035111 | Bacteria | 2463 |
| 358 | Ga0373923_0028346 | 3300035111 | Bacteria | 2239 |
| 359 | Ga0373923_0061086 | 3300035111 | Unclassified | 1600 |
| 360 | Ga0373932_0004147 | 3300035112 | Bacteria | 3442 |
| 361 | Ga0373936_0019437 | 3300035113 | Bacteria | 2632 |
| 362 | Ga0373936_0023293 | 3300035113 | Bacteria | 2412 |
| 363 | Ga0373936_0025728 | 3300035113 | Bacteria | 2302 |
| 364 | Ga0373936_0053143 | 3300035113 | Unclassified | 1642 |
| 365 | Ga0373939_0009373 | 3300035114 | Bacteria | 2426 |
| 366 | Ga0373945_0009848 | 3300035116 | Bacteria | 3135 |
| 367 | Ga0373945_0015417 | 3300035116 | Bacteria | 2571 |
| 368 | Ga0373945_0031724 | 3300035116 | Bacteria | 1868 |
| 369 | Ga0373953_0002714 | 3300035117 | Bacteria | 5368 |
| 370 | Ga0373953_0012925 | 3300035117 | Bacteria | 2968 |
| 371 | Ga0373954_0017852 | 3300035118 | Bacteria | 3190 |
| 372 | Ga0373954_0027230 | 3300035118 | Bacteria | 2622 |
| 373 | Ga0373954_0028453 | 3300035118 | Bacteria | 2569 |
| 374 | Ga0373954_0033323 | 3300035118 | Bacteria | 2383 |
| 375 | Ga0373954_0033524 | 3300035118 | Bacteria | 2376 |
| 376 | Ga0373956_0007623 | 3300035119 | Bacteria | 4361 |
| 377 | Ga0373956_0025202 | 3300035119 | Bacteria | 2568 |
| 378 | Ga0373956_0026354 | 3300035119 | Bacteria | 2517 |
| 379 | Ga0373957_0001705 | 3300035120 | Bacteria | 6030 |
| 380 | Ga0373957_0005579 | 3300035120 | Bacteria | 3907 |
| 381 | Ga0373957_0017222 | 3300035120 | Bacteria | 2512 |
| 382 | Ga0373960_0012821 | 3300035121 | Bacteria | 2089 |
| 383 | Ga0373943_0015640 | 3300035170 | Bacteria | 3450 |
| 384 | Ga0373943_0029718 | 3300035170 | Bacteria | 2582 |
| 385 | Ga0373943_0032538 | 3300035170 | Bacteria | 2479 |
| 386 | Ga0373946_0005661 | 3300035171 | Bacteria | 4514 |
| 387 | Ga0373946_0015401 | 3300035171 | Bacteria | 2899 |
| 388 | Ga0373946_0030349 | 3300035171 | Bacteria | 2157 |
| 389 | Ga0373955_0007099 | 3300035172 | Bacteria | 5131 |
| 390 | Ga0373955_0018026 | 3300035172 | Bacteria | 3503 |
| 391 | Ga0373955_0023869 | 3300035172 | Bacteria | 3120 |
| 392 | Ga0373955_0037821 | 3300035172 | Bacteria | 2567 |
| 393 | Ga0373955_0039860 | 3300035172 | Bacteria | 2509 |
| 394 | Ga0373942_0018086 | 3300035207 | Bacteria | 1745 |
| 395 | Ga0316574_0021836 | 3300035398 | Unclassified | 3804 |
| 396 | Ga0373924_0016088 | 3300035410 | Plasmid | 2852 |
| 397 | Ga0373924_0020702 | 3300035410 | Bacteria | 2559 |
| 398 | Ga0373924_0021625 | 3300035410 | Bacteria | 2509 |
| 399 | Ga0373931_0044801 | 3300035691 | Bacteria | 2334 |
| 400 | Ga0373931_0052074 | 3300035691 | Bacteria | 2182 |
| 401 | Ga0373935_0046498 | 3300035692 | Bacteria | 2741 |
| 402 | Ga0373935_0058004 | 3300035692 | Bacteria | 2471 |
| 403 | Ga0373935_0058776 | 3300035692 | Bacteria | 2456 |
| 404 | Ga0373927_0019437 | 3300035695 | Bacteria | 4454 |
| 405 | Ga0373927_0031455 | 3300035695 | Bacteria | 3458 |
| 406 | Ga0373927_0044493 | 3300035695 | Bacteria | 2872 |
| 407 | Ga0373933_0006647 | 3300035724 | Bacteria | 6298 |
| 408 | Ga0373933_0026954 | 3300035724 | Bacteria | 3305 |
| 409 | Ga0373933_0040596 | 3300035724 | Bacteria | 2742 |
| 410 | Ga0373933_0066427 | 3300035724 | Bacteria | 2185 |
| 411 | Ga0373947_0030933 | 3300035725 | Bacteria | 3147 |
| 412 | Ga0373947_0039197 | 3300035725 | Bacteria | 2818 |
| 413 | Ga0373947_0045958 | 3300035725 | Bacteria | 2613 |
| 414 | Ga0373947_0046982 | 3300035725 | Bacteria | 2586 |
| 415 | Ga0373947_0048331 | 3300035725 | Bacteria | 2552 |
| 416 | Ga0373947_0148298 | 3300035725 | Bacteria | 1509 |
| 417 | Ga0373937_0013810 | 3300036401 | Bacteria | 7115 |
| 418 | Ga0373937_0031636 | 3300036401 | Bacteria | 4795 |
| 419 | Ga0373937_0091660 | 3300036401 | Bacteria | 2816 |
| 420 | Ga0373937_0129903 | 3300036401 | Bacteria | 2352 |
| 421 | Ga0373937_0142295 | 3300036401 | Bacteria | 2244 |
| 422 | Ga0373937_0272683 | 3300036401 | Unclassified | 1597 |
| 423 | Ga0316584_0064626 | 3300036712 | Bacteria | 2740 |
| 424 | Ga0316584_0102834 | 3300036712 | Bacteria | 2139 |
| 425 | Ga0373925_0093480 | 3300037068 | Bacteria | 2301 |
| 426 | Ga0373925_0114204 | 3300037068 | Bacteria | 2089 |
| 427 | Ga0373925_0145579 | 3300037068 | Bacteria | 1857 |
| 428 | Ga0400490_52328 | 3300038726 | Bacteria | 1379 |
| 429 | Ga0400485_16878 | 3300038735 | Plasmid | 2682 |
| 430 | Ga0400486_26978 | 3300038742 | Plasmid | 2576 |
| 431 | Ga0400483_098340 | 3300039062 | Bacteria | 2730 |
| 432 | Ga0400483_099422 | 3300039062 | Bacteria | 1765 |
| 433 | Ga0400483_102513 | 3300039062 | Bacteria | 1067 |
| 434 | Ga0436365_0562279 | 3300039437 | Unclassified | 4634 |
| 435 | Ga0436365_0775127 | 3300039437 | Bacteria | 2379 |
| 436 | Ga0436360_0217073 | 3300039438 | Bacteria | 3442 |
| 437 | Ga0436360_1125868 | 3300039438 | Bacteria | 2921 |
| 438 | Ga0436363_0394151 | 3300039450 | Bacteria | 2339 |
| 439 | Ga0436363_0414266 | 3300039450 | Bacteria | 4634 |
| 440 | Ga0436363_0848767 | 3300039450 | Bacteria | 2341 |
| 441 | Ga0436362_0857593 | 3300039453 | Bacteria | 3443 |
| 442 | Ga0439432_039374 | 3300042006 | Bacteria | 1503 |
| 443 | Ga0439450_024356 | 3300042008 | Bacteria | 1320 |
| 444 | Ga0439457_018057 | 3300042014 | Bacteria | 1566 |
| 445 | Ga0450900_004997 | 3300042136 | Bacteria | 1550 |
| 446 | Ga0466965_0058208 | 3300044683 | Bacteria | 1927 |
| 447 | Ga0466963_0097424 | 3300044694 | Bacteria | 2009 |
| 448 | Ga0466964_0066172 | 3300044706 | Bacteria | 1516 |
| 449 | Ga0466971_0080045 | 3300044719 | Bacteria | 1489 |
| 450 | Ga0466967_0107871 | 3300045976 | Plasmid | 2554 |
| 451 | Ga0495617_016590 | 3300046452 | Bacteria | 2492 |
| 452 | Ga0495627_016262 | 3300046453 | Plasmid | 2551 |
| 453 | Ga0495627_024309 | 3300046453 | Bacteria | 1976 |
| 454 | Ga0495592_0059869 | 3300046454 | Bacteria | 2802 |
| 455 | Ga0495592_0067034 | 3300046454 | Bacteria | 2624 |
| 456 | Ga0495592_0073615 | 3300046454 | Bacteria | 2483 |
| 457 | Ga0495592_0090889 | 3300046454 | Bacteria | 2190 |
| 458 | Ga0495603_0047039 | 3300046455 | Bacteria | 2570 |
| 459 | Ga0495591_025067 | 3300046458 | Bacteria | 1877 |
| 460 | Ga0495629_0026488 | 3300046459 | Bacteria | 4119 |
| 461 | Ga0495629_0038101 | 3300046459 | Bacteria | 3388 |
| 462 | Ga0495629_0050633 | 3300046459 | Bacteria | 2908 |
| 463 | Ga0495629_0060186 | 3300046459 | Bacteria | 2654 |
| 464 | Ga0495629_0065003 | 3300046459 | Bacteria | 2547 |
| 465 | Ga0495629_0071881 | 3300046459 | Bacteria | 2414 |
| 466 | Ga0495638_0076911 | 3300046460 | Bacteria | 2033 |
| 467 | Ga0495641_0028756 | 3300046461 | Bacteria | 2685 |
| 468 | Ga0495651_0040151 | 3300046462 | Bacteria | 3640 |
| 469 | Ga0495651_0048942 | 3300046462 | Bacteria | 3263 |
| 470 | Ga0495651_0089386 | 3300046462 | Bacteria | 2312 |
| 471 | Ga0495651_0089834 | 3300046462 | Bacteria | 2305 |
| 472 | Ga0495653_0018002 | 3300046463 | Bacteria | 5742 |
| 473 | Ga0495653_0022589 | 3300046463 | Bacteria | 5087 |
| 474 | Ga0495653_0073657 | 3300046463 | Bacteria | 2547 |
| 475 | Ga0495653_0082398 | 3300046463 | Bacteria | 2374 |
| 476 | Ga0495582_0044663 | 3300046473 | Bacteria | 2440 |
| 477 | Ga0495582_0149127 | 3300046473 | Unclassified | 1327 |
| 478 | Ga0495605_0050449 | 3300046474 | Bacteria | 2030 |
| 479 | Ga0495605_0102197 | 3300046474 | Bacteria | 1316 |
| 480 | Ga0495639_0027380 | 3300046475 | Bacteria | 2523 |
| 481 | Ga0495639_0027771 | 3300046475 | Bacteria | 2505 |
| 482 | Ga0495639_0033068 | 3300046475 | Bacteria | 2308 |
| 483 | Ga0495639_0100205 | 3300046475 | Unclassified | 1367 |
| 484 | Ga0495662_0028007 | 3300046476 | Bacteria | 2720 |
| 485 | Ga0495662_0030633 | 3300046476 | Bacteria | 2597 |
| 486 | Ga0495662_0030637 | 3300046476 | Bacteria | 2597 |
| 487 | Ga0495662_0052430 | 3300046476 | Bacteria | 1969 |
| 488 | Ga0495664_0036911 | 3300046477 | Plasmid | 2882 |
| 489 | Ga0495664_0038331 | 3300046477 | Bacteria | 2829 |
| 490 | Ga0495664_0039625 | 3300046477 | Bacteria | 2784 |
| 491 | Ga0495664_0053671 | 3300046477 | Bacteria | 2396 |
| 492 | Ga0495584_0024115 | 3300046491 | Bacteria | 3084 |
| 493 | Ga0495584_0032445 | 3300046491 | Unclassified | 2643 |
| 494 | Ga0495584_0036034 | 3300046491 | Bacteria | 2499 |
| 495 | Ga0495584_0078360 | 3300046491 | Bacteria | 1663 |
| 496 | Ga0495585_0034330 | 3300046492 | Plasmid | 2867 |
| 497 | Ga0495585_0060673 | 3300046492 | Bacteria | 2081 |
| 498 | Ga0495585_0078004 | 3300046492 | Bacteria | 1797 |
| 499 | Ga0495585_0123512 | 3300046492 | Bacteria | 1368 |
| 500 | Ga0495596_0029355 | 3300046500 | Bacteria | 2205 |
| 501 | Ga0495607_0049863 | 3300046501 | Unclassified | 2439 |
| 502 | Ga0495607_0050788 | 3300046501 | Bacteria | 2412 |
| 503 | Ga0495608_0011748 | 3300046511 | Bacteria | 6089 |
| 504 | Ga0495608_0053896 | 3300046511 | Bacteria | 2659 |
| 505 | Ga0495608_0055791 | 3300046511 | Bacteria | 2610 |
| 506 | Ga0495608_0059997 | 3300046511 | Bacteria | 2504 |
| 507 | Ga0495608_0060427 | 3300046511 | Bacteria | 2493 |
| 508 | Ga0495616_0046106 | 3300046513 | Unclassified | 2202 |
| 509 | Ga0495616_0047392 | 3300046513 | Bacteria | 2165 |
| 510 | Ga0495618_0013907 | 3300046514 | Bacteria | 4898 |
| 511 | Ga0495618_0036588 | 3300046514 | Bacteria | 3080 |
| 512 | Ga0495618_0051692 | 3300046514 | Bacteria | 2596 |
| 513 | Ga0495618_0055478 | 3300046514 | Bacteria | 2508 |
| 514 | Ga0495628_0061026 | 3300046516 | Bacteria | 2957 |
| 515 | Ga0495628_0076002 | 3300046516 | Bacteria | 2614 |
| 516 | Ga0495628_0080399 | 3300046516 | Bacteria | 2533 |
| 517 | Ga0495630_0033825 | 3300046517 | Bacteria | 3812 |
| 518 | Ga0495630_0066741 | 3300046517 | Bacteria | 2704 |
| 519 | Ga0495630_0068199 | 3300046517 | Bacteria | 2674 |
| 520 | Ga0495630_0074110 | 3300046517 | Bacteria | 2563 |
| 521 | Ga0495630_0076221 | 3300046517 | Bacteria | 2526 |
| 522 | Ga0495631_0047352 | 3300046518 | Bacteria | 1888 |
| 523 | Ga0495637_0028636 | 3300046520 | Bacteria | 2486 |
| 524 | Ga0495637_0095490 | 3300046520 | Unclassified | 1167 |
| 525 | Ga0495644_0019206 | 3300046523 | Plasmid | 2609 |
| 526 | Ga0495644_0032550 | 3300046523 | Unclassified | 1970 |
| 527 | Ga0495644_0036637 | 3300046523 | Bacteria | 1850 |
| 528 | Ga0495644_0081175 | 3300046523 | Unclassified | 1222 |
| 529 | Ga0495663_0010814 | 3300046525 | Bacteria | 2539 |
| 530 | Ga0495663_0012740 | 3300046525 | Bacteria | 2346 |
| 531 | Ga0495666_0058143 | 3300046526 | Bacteria | 1850 |
| 532 | Ga0495642_0027185 | 3300046528 | Bacteria | 2275 |
| 533 | Ga0495652_0011404 | 3300046529 | Bacteria | 8038 |
| 534 | Ga0495652_0078424 | 3300046529 | Bacteria | 2734 |
| 535 | Ga0495652_0088124 | 3300046529 | Bacteria | 2544 |
| 536 | Ga0495665_0029415 | 3300046531 | Bacteria | 2943 |
| 537 | Ga0495665_0043505 | 3300046531 | Unclassified | 2388 |
| 538 | Ga0495665_0059441 | 3300046531 | Bacteria | 2017 |
| 539 | Ga0495640_0020732 | 3300046533 | Bacteria | 4833 |
| 540 | Ga0495640_0043757 | 3300046533 | Bacteria | 3116 |
| 541 | Ga0495640_0050937 | 3300046533 | Bacteria | 2849 |
| 542 | Ga0495640_0056794 | 3300046533 | Bacteria | 2672 |
| 543 | Ga0495640_0064697 | 3300046533 | Bacteria | 2471 |
| 544 | Ga0495640_0068199 | 3300046533 | Bacteria | 2394 |
| 545 | Ga0495586_0006627 | 3300046535 | Bacteria | 6183 |
| 546 | Ga0495587_0016279 | 3300046536 | Bacteria | 4627 |
| 547 | Ga0495587_0033068 | 3300046536 | Bacteria | 3123 |
| 548 | Ga0495587_0045282 | 3300046536 | Bacteria | 2615 |
| 549 | Ga0495587_0047717 | 3300046536 | Bacteria | 2538 |
| 550 | Ga0495598_0007147 | 3300046537 | Plasmid | 2549 |
| 551 | Ga0495598_0020384 | 3300046537 | Bacteria | 1749 |
| 552 | Ga0495609_0028461 | 3300046538 | Bacteria | 2549 |
| 553 | Ga0495609_0029491 | 3300046538 | Unclassified | 2498 |
| 554 | Ga0495621_0007799 | 3300046539 | Bacteria | 3181 |
| 555 | Ga0495645_0057621 | 3300046543 | Bacteria | 2819 |
| 556 | Ga0495645_0088257 | 3300046543 | Bacteria | 2218 |
| 557 | Ga0495622_0062961 | 3300046557 | Bacteria | 1717 |
| 558 | Ga0495633_0027867 | 3300046558 | Bacteria | 2756 |
| 559 | Ga0495633_0066478 | 3300046558 | Bacteria | 1683 |
| 560 | Ga0495667_0011340 | 3300046559 | Bacteria | 6035 |
| 561 | Ga0495667_0027955 | 3300046559 | Bacteria | 3797 |
| 562 | Ga0495667_0052779 | 3300046559 | Bacteria | 2677 |
| 563 | Ga0495667_0057707 | 3300046559 | Bacteria | 2551 |
| 564 | Ga0495667_0060677 | 3300046559 | Bacteria | 2480 |
| 565 | Ga0495667_0061606 | 3300046559 | Bacteria | 2459 |
| 566 | Ga0495667_0064995 | 3300046559 | Bacteria | 2386 |
| 567 | Ga0495656_0016585 | 3300046615 | Bacteria | 2797 |
| 568 | Ga0495656_0027760 | 3300046615 | Unclassified | 2263 |
| 569 | Ga0495656_0046738 | 3300046615 | Bacteria | 1832 |
| 570 | Ga0495656_0074977 | 3300046615 | Bacteria | 1512 |
| 571 | Ga0495668_0052516 | 3300046616 | Bacteria | 2255 |
| 572 | Ga0495634_0020223 | 3300046642 | Bacteria | 4722 |
| 573 | Ga0495634_0031252 | 3300046642 | Plasmid | 3668 |
| 574 | Ga0495634_0038192 | 3300046642 | Bacteria | 3274 |
| 575 | Ga0495634_0053765 | 3300046642 | Bacteria | 2696 |
| 576 | Ga0495634_0058668 | 3300046642 | Bacteria | 2564 |
| 577 | Ga0495634_0064258 | 3300046642 | Bacteria | 2433 |
| 578 | Ga0495634_0094369 | 3300046642 | Bacteria | 1939 |
| 579 | Ga0495611_0032982 | 3300046648 | Unclassified | 2284 |
| 580 | Ga0495611_0038563 | 3300046648 | Bacteria | 2126 |
| 581 | Ga0495611_0045782 | 3300046648 | Bacteria | 1960 |
| 582 | Ga0495611_0107051 | 3300046648 | Bacteria | 1300 |
| 583 | Ga0495635_0035565 | 3300046663 | Bacteria | 3453 |
| 584 | Ga0495635_0048630 | 3300046663 | Bacteria | 2923 |
| 585 | Ga0495635_0057547 | 3300046663 | Bacteria | 2674 |
| 586 | Ga0495635_0074505 | 3300046663 | Bacteria | 2325 |
| 587 | Ga0495659_0014913 | 3300046664 | Plasmid | 2549 |
| 588 | Ga0495659_0015646 | 3300046664 | Bacteria | 2495 |
| 589 | Ga0495659_0018722 | 3300046664 | Bacteria | 2310 |
| 590 | Ga0495659_0027284 | 3300046664 | Bacteria | 1969 |
| 591 | Ga0495661_0025067 | 3300046665 | Bacteria | 3858 |
| 592 | Ga0495661_0052573 | 3300046665 | Bacteria | 2454 |
| 593 | Ga0495661_0107815 | 3300046665 | Bacteria | 1557 |
| 594 | Ga0495657_0042708 | 3300046675 | Bacteria | 3093 |
| 595 | Ga0495657_0054197 | 3300046675 | Bacteria | 2680 |
| 596 | Ga0495657_0056664 | 3300046675 | Bacteria | 2608 |
| 597 | Ga0495657_0062028 | 3300046675 | Bacteria | 2471 |
| 598 | Ga0495599_0017707 | 3300046678 | Bacteria | 4432 |
| 599 | Ga0495599_0041054 | 3300046678 | Bacteria | 2905 |
| 600 | Ga0495599_0054957 | 3300046678 | Bacteria | 2494 |
| 601 | Ga0495623_0047441 | 3300046679 | Bacteria | 2726 |
| 602 | Ga0495623_0054129 | 3300046679 | Bacteria | 2532 |
| 603 | Ga0495623_0055765 | 3300046679 | Bacteria | 2489 |
| 604 | Ga0495646_0031092 | 3300046680 | Bacteria | 3330 |
| 605 | Ga0495646_0043658 | 3300046680 | Bacteria | 2743 |
| 606 | Ga0495646_0051760 | 3300046680 | Bacteria | 2483 |
| 607 | Ga0495646_0082301 | 3300046680 | Bacteria | 1873 |
| 608 | Ga0495647_0015140 | 3300046681 | Bacteria | 2697 |
| 609 | Ga0495647_0015664 | 3300046681 | Bacteria | 2660 |
| 610 | Ga0495647_0018650 | 3300046681 | Bacteria | 2473 |
| 611 | Ga0495658_0037572 | 3300046683 | Bacteria | 2677 |
| 612 | Ga0495658_0038110 | 3300046683 | Bacteria | 2660 |
| 613 | Ga0495658_0041674 | 3300046683 | Plasmid | 2559 |
| 614 | Ga0495658_0042515 | 3300046683 | Bacteria | 2537 |
| 615 | Ga0495658_0045956 | 3300046683 | Bacteria | 2452 |
| 616 | Ga0495658_0050961 | 3300046683 | Bacteria | 2343 |
| 617 | Ga0495658_0062581 | 3300046683 | Bacteria | 2139 |
| 618 | Ga0495669_0026968 | 3300046684 | Bacteria | 2511 |
| 619 | Ga0495669_0031426 | 3300046684 | Unclassified | 2332 |
| 620 | Ga0495669_0070863 | 3300046684 | Unclassified | 1588 |
| 621 | Ga0495669_0082774 | 3300046684 | Bacteria | 1475 |
| 622 | Ga0495613_0035916 | 3300046689 | Bacteria | 3676 |
| 623 | Ga0495613_0036694 | 3300046689 | Bacteria | 3634 |
| 624 | Ga0495613_0057316 | 3300046689 | Bacteria | 2860 |
| 625 | Ga0495613_0122308 | 3300046689 | Bacteria | 1868 |
| 626 | Ga0495624_0046894 | 3300046690 | Bacteria | 2746 |
| 627 | Ga0495624_0052072 | 3300046690 | Bacteria | 2588 |
| 628 | Ga0495624_0052076 | 3300046690 | Bacteria | 2588 |
| 629 | Ga0495624_0054045 | 3300046690 | Bacteria | 2533 |
| 630 | Ga0495670_0025605 | 3300046691 | Plasmid | 2918 |
| 631 | Ga0495670_0068644 | 3300046691 | Bacteria | 1791 |
| 632 | Ga0495671_0054109 | 3300046692 | Unclassified | 1990 |
| 633 | Ga0495589_0102728 | 3300046794 | Bacteria | 1382 |
| 634 | Ga0495600_0008445 | 3300046809 | Bacteria | 6326 |
| 635 | Ga0495600_0020651 | 3300046809 | Bacteria | 4211 |
| 636 | Ga0495600_0059423 | 3300046809 | Bacteria | 2497 |
| 637 | Ga0495600_0067191 | 3300046809 | Bacteria | 2343 |
| 638 | Ga0495581_0043302 | 3300047315 | Bacteria | 2604 |
| 639 | Ga0495581_0045057 | 3300047315 | Bacteria | 2550 |
| 640 | Ga0495581_0124818 | 3300047315 | Unclassified | 1499 |
| 641 | Ga0495604_0027274 | 3300047317 | Bacteria | 4543 |
| 642 | Ga0495604_0062895 | 3300047317 | Bacteria | 2833 |
| 643 | Ga0495636_0021852 | 3300047318 | Bacteria | 2584 |
| 644 | Ga0495636_0025233 | 3300047318 | Unclassified | 2412 |
| 645 | Ga0495636_0062709 | 3300047318 | Bacteria | 1574 |
| 646 | Ga0495674_0031964 | 3300047319 | Bacteria | 4776 |
| 647 | Ga0495674_0050305 | 3300047319 | Plasmid | 3677 |
| 648 | Ga0495674_0051668 | 3300047319 | Bacteria | 3622 |
| 649 | Ga0495674_0077781 | 3300047319 | Bacteria | 2851 |
| 650 | Ga0495674_0242319 | 3300047319 | Bacteria | 1485 |
| 651 | Ga0495676_0068866 | 3300047321 | Bacteria | 2732 |
| 652 | Ga0495676_0107731 | 3300047321 | Bacteria | 2051 |
| 653 | Ga0495676_0135158 | 3300047321 | Bacteria | 1774 |
| 654 | Ga0495676_0159364 | 3300047321 | Unclassified | 1598 |
| 655 | Ga0495680_0057003 | 3300047322 | Bacteria | 3023 |
| 656 | Ga0495680_0059647 | 3300047322 | Bacteria | 2944 |
| 657 | Ga0495680_0069761 | 3300047322 | Bacteria | 2680 |
| 658 | Ga0495680_0071432 | 3300047322 | Bacteria | 2642 |
| 659 | Ga0495680_0079836 | 3300047322 | Bacteria | 2473 |
| 660 | Ga0495680_0092039 | 3300047322 | Bacteria | 2272 |
| 661 | Ga0495680_0116471 | 3300047322 | Bacteria | 1976 |
| 662 | Ga0495680_0140898 | 3300047322 | Unclassified | 1764 |
| 663 | Ga0495680_0162726 | 3300047322 | Bacteria | 1619 |
| 664 | Ga0495683_0039517 | 3300047323 | Unclassified | 2384 |
| 665 | Ga0495683_0071754 | 3300047323 | Bacteria | 1699 |
| 666 | Ga0495675_0019392 | 3300047444 | Bacteria | 4321 |
| 667 | Ga0495675_0051165 | 3300047444 | Bacteria | 2624 |
| 668 | Ga0495675_0054083 | 3300047444 | Bacteria | 2548 |
| 669 | Ga0495675_0066390 | 3300047444 | Bacteria | 2280 |
| 670 | Ga0495677_0018993 | 3300047445 | Bacteria | 2492 |
| 671 | Ga0495677_0019256 | 3300047445 | Bacteria | 2476 |
| 672 | Ga0495677_0019921 | 3300047445 | Unclassified | 2432 |
| 673 | Ga0495679_023861 | 3300047446 | Unclassified | 2069 |
| 674 | Ga0495673_0064484 | 3300047469 | Bacteria | 1558 |
| 675 | Ga0495673_0096153 | 3300047469 | Bacteria | 1204 |
| 676 | Ga0495681_0057650 | 3300047470 | Unclassified | 1803 |
| 677 | Ga0495684_0065336 | 3300047471 | Bacteria | 2765 |
| 678 | Ga0495684_0074235 | 3300047471 | Bacteria | 2584 |
| 679 | Ga0495684_0076709 | 3300047471 | Bacteria | 2538 |
| 680 | Ga0495684_0079062 | 3300047471 | Bacteria | 2496 |
| 681 | Ga0495684_0098268 | 3300047471 | Unclassified | 2213 |
| 682 | Ga0495684_0128265 | 3300047471 | Bacteria | 1907 |
| 683 | Ga0495684_0187139 | 3300047471 | Bacteria | 1532 |
| 684 | Ga0495593_0007737 | 3300047673 | Bacteria | 6266 |
| 685 | Ga0495593_0033834 | 3300047673 | Bacteria | 2781 |
| 686 | Ga0495593_0041705 | 3300047673 | Bacteria | 2466 |
| 687 | Ga0495602_0018821 | 3300048088 | Bacteria | 6877 |
| 688 | Ga0495602_0087861 | 3300048088 | Bacteria | 2589 |
| 689 | Ga0495614_0025293 | 3300048089 | Bacteria | 2560 |
| 690 | Ga0495614_0046306 | 3300048089 | Bacteria | 1865 |
| 691 | Ga0495614_0091822 | 3300048089 | Bacteria | 1321 |
| 692 | Ga0495615_0003984 | 3300048090 | Bacteria | 2532 |
| 693 | Ga0496100_0014611 | 3300048903 | Bacteria | 4562 |
| 694 | Ga0496100_0140353 | 3300048903 | Bacteria | 1712 |
| 695 | Ga0496101_0022469 | 3300048904 | Bacteria | 4342 |
| 696 | Ga0496101_0232791 | 3300048904 | Bacteria | 1432 |
| 697 | Ga0496102_0083871 | 3300048905 | Bacteria | 2940 |
| 698 | Ga0496102_0090768 | 3300048905 | Plasmid | 2827 |
| 699 | Ga0496103_0047059 | 3300048906 | Plasmid | 2664 |
| 700 | Ga0496104_0051107 | 3300048907 | Bacteria | 3900 |
| 701 | Ga0496104_0102706 | 3300048907 | Bacteria | 2738 |
| 702 | Ga0496104_0108244 | 3300048907 | Bacteria | 2663 |
| 703 | Ga0496105_0028112 | 3300048908 | Bacteria | 4599 |
| 704 | Ga0496105_0174620 | 3300048908 | Bacteria | 1760 |
| 705 | Ga0496105_0176417 | 3300048908 | Bacteria | 1750 |
| 706 | Ga0496106_0114201 | 3300048909 | Bacteria | 2105 |
| 707 | Ga0496106_0124614 | 3300048909 | Bacteria | 2016 |
| 708 | Ga0496107_0037303 | 3300048910 | Bacteria | 3487 |
| 709 | Ga0496107_0177384 | 3300048910 | Bacteria | 1582 |
| 710 | Ga0496110_0189767 | 3300048913 | Bacteria | 1866 |
| 711 | Ga0496111_0096144 | 3300048914 | Bacteria | 2174 |
| 712 | Ga0496112_0050821 | 3300048915 | Bacteria | 4065 |
| 713 | Ga0496114_0071988 | 3300048917 | Bacteria | 2906 |
| 714 | Ga0496114_0098617 | 3300048917 | Bacteria | 2491 |
| 715 | Ga0496114_0228334 | 3300048917 | Bacteria | 1635 |
| 716 | Ga0496115_0088776 | 3300048918 | Bacteria | 2524 |
| 717 | Ga0496115_0136144 | 3300048918 | Bacteria | 2025 |
| 718 | Ga0501033_0075207 | 3300049570 | Bacteria | 2479 |
| 719 | Ga0501036_0102457 | 3300049572 | Bacteria | 2421 |
| 720 | Ga0501039_0038898 | 3300049575 | Bacteria | 3673 |
| 721 | Ga0501039_0094815 | 3300049575 | Bacteria | 2326 |
| 722 | Ga0501040_0081507 | 3300049576 | Bacteria | 2242 |
| 723 | Ga0501040_0119809 | 3300049576 | Bacteria | 1846 |
| 724 | Ga0501040_0221631 | 3300049576 | Bacteria | 1346 |
| 725 | Ga0501046_0148229 | 3300049580 | Bacteria | 1771 |
| 726 | Ga0501047_0302142 | 3300049581 | Bacteria | 1443 |
| 727 | Ga0501048_0089272 | 3300049582 | Bacteria | 2174 |
| 728 | Ga0501070_0238332 | 3300049586 | Bacteria | 1489 |
| 729 | Ga0501071_0015100 | 3300049587 | Bacteria | 5296 |
| 730 | Ga0501072_0084273 | 3300049588 | Bacteria | 2520 |
| 731 | Ga0501073_0093634 | 3300049589 | Bacteria | 2087 |
| 732 | Ga0501075_0091252 | 3300049591 | Bacteria | 2312 |
| 733 | Ga0501079_0089225 | 3300049741 | Bacteria | 2387 |
| 734 | Ga0501081_0046685 | 3300049743 | Bacteria | 2978 |
| 735 | Ga0501081_0150210 | 3300049743 | Bacteria | 1673 |
| 736 | Ga0501044_0147310 | 3300049823 | Bacteria | 2339 |
| 737 | nmdc:mga05p37_193715_c1 | 3300050507 | Bacteria | 2466 |
| 738 | nmdc:mga06r32_207080_c1 | 3300050510 | Unclassified | 1949 |
| 739 | nmdc:mga0n895_115642_c1 | 3300050512 | Archaea | 2701 |
| 740 | nmdc:mga0n895_116981_c1 | 3300050512 | Plasmid | 2685 |
| 741 | nmdc:mga0rr50_154138_c1 | 3300050513 | Archaea | 1860 |
| 742 | nmdc:mga0rr50_8020_c1 | 3300050513 | Bacteria | 6549 |
| 743 | nmdc:mga08x19_37966_c1 | 3300050514 | Archaea | 3059 |
| 744 | nmdc:mga08x19_38830_c1 | 3300050514 | Bacteria | 3025 |
| 745 | nmdc:mga0a205_57684_c1 | 3300050515 | Archaea | 3749 |
| 746 | Ga0495601_0011876 | 3300053077 | Bacteria | 5221 |
| 747 | Ga0495601_0048809 | 3300053077 | Bacteria | 2666 |
| 748 | Ga0495601_0052311 | 3300053077 | Bacteria | 2578 |
| 749 | Ga0495601_0121499 | 3300053077 | Bacteria | 1696 |
| 750 | Ga0495612_0009552 | 3300053078 | Bacteria | 3929 |
| 751 | Ga0495612_0041103 | 3300053078 | Unclassified | 1885 |
| 752 | Ga0495655_0008855 | 3300053083 | Bacteria | 1929 |
| 753 | Ga0495595_0009112 | 3300053084 | Bacteria | 4098 |
| 754 | Ga0495595_0028262 | 3300053084 | Bacteria | 2504 |
| 755 | Ga0495595_0029716 | 3300053084 | Bacteria | 2447 |
| 756 | Ga0495619_0008840 | 3300053085 | Bacteria | 6368 |
| 757 | Ga0495619_0049706 | 3300053085 | Bacteria | 2765 |
| 758 | Ga0495619_0058040 | 3300053085 | Bacteria | 2568 |
| 759 | Ga0495619_0087483 | 3300053085 | Bacteria | 2106 |
| 760 | Ga0495619_0174165 | 3300053085 | Unclassified | 1488 |
| 761 | Ga0500555_012971 | 3300053103 | Unclassified | 2401 |
| 762 | Ga0501084_0172537 | 3300054114 | Bacteria | 1825 |
| 763 | Ga0501082_0069938 | 3300060353 | Bacteria | 3022 |
| 764 | Ga0501082_0363342 | 3300060353 | Bacteria | 1263 |
| 765 | Ga0530510_0054069 | 3300061734 | Bacteria | 2901 |
| 766 | Ga0530510_0058368 | 3300061734 | Bacteria | 2790 |
| 767 | Ga0530510_0072381 | 3300061734 | Bacteria | 2501 |
| 768 | Ga0495659_0051382 | |||
| 769 | CNAas_1001119 | |||
| 770 | LJNas_1002875 | |||
| 771 | JGI24738J21930_10008914 | |||
| 772 | JGI24744J21845_10006485 | |||
| 773 | Ga0070658_10079347 | |||
| 774 | Ga0070658_10119847 | |||
| 775 | Ga0070676_10041364 | |||
| 776 | Ga0070676_10051409 | |||
| 777 | Ga0070690_100058593 | |||
| 778 | Ga0070670_100045004 | |||
| 779 | Ga0070670_100101394 | |||
| 780 | Ga0068869_100052168 | |||
| 781 | Ga0068869_100107430 | |||
| 782 | Ga0070666_10057003 | |||
| 783 | Ga0070666_10066780 | |||
| 784 | Ga0070666_10083154 | |||
| 785 | Ga0070680_100243139 | |||
| 786 | Ga0070682_100056016 | |||
| 787 | Ga0068868_100026004 | |||
| 788 | Ga0068868_100139302 | |||
| 789 | Ga0070660_100079734 | |||
| 790 | Ga0070689_100075524 | |||
| 791 | Ga0070687_100019718 | |||
| 792 | Ga0070687_100095023 | |||
| 793 | Ga0070692_10110197 | |||
| 794 | Ga0070669_100050012 | |||
| 795 | Ga0070669_100064557 | |||
| 796 | Ga0070675_100087752 | |||
| 797 | Ga0070671_100067269 | |||
| 798 | Ga0070671_100087784 | |||
| 799 | Ga0070673_100012684 | |||
| 800 | Ga0070673_100074575 | |||
| 801 | Ga0070673_100079767 | |||
| 802 | Ga0070688_100088177 | |||
| 803 | Ga0070659_100088529 | |||
| 804 | Ga0070667_100017724 | |||
| 805 | Ga0070667_100062090 | |||
| 806 | Ga0070709_10047024 | |||
| 807 | Ga0070709_10054629 | |||
| 808 | Ga0070709_10065994 | |||
| 809 | Ga0070709_10106303 | |||
| 810 | Ga0070714_100073738 | |||
| 811 | Ga0070714_100077890 | |||
| 812 | Ga0070713_100069216 | |||
| 813 | Ga0070713_100091406 | |||
| 814 | Ga0070713_100103023 | |||
| 815 | Ga0070713_100152445 | |||
| 816 | Ga0070713_100269292 | |||
| 817 | Ga0070710_10016423 | |||
| 818 | Ga0070710_10044129 | |||
| 819 | Ga0070710_10086224 | |||
| 820 | Ga0070701_10051034 | |||
| 821 | Ga0070711_100060390 | |||
| 822 | Ga0070711_100060763 | |||
| 823 | Ga0070711_100063214 | |||
| 824 | Ga0070711_100107429 | |||
| 825 | Ga0070700_100034122 | |||
| 826 | Ga0070708_100133601 | |||
| 827 | Ga0070663_100063498 | |||
| 828 | Ga0070663_100147205 | |||
| 829 | Ga0070662_100065607 | |||
| 830 | Ga0070681_10087703 | |||
| 831 | Ga0070685_10033118 | |||
| 832 | Ga0070685_10048548 | |||
| 833 | Ga0070685_10049149 | |||
| 834 | Ga0070707_100170165 | |||
| 835 | Ga0070679_100226155 | |||
| 836 | Ga0070684_100075114 | |||
| 837 | Ga0068853_100087382 | |||
| 838 | Ga0070672_100048002 | |||
| 839 | Ga0070672_100067554 | |||
| 840 | Ga0070672_100084688 | |||
| 841 | Ga0070693_100045404 | |||
| 842 | Ga0070665_100094957 | |||
| 843 | Ga0070665_100119095 | |||
| 844 | Ga0070665_100147110 | |||
| 845 | Ga0070665_100281635 | |||
| 846 | Ga0068855_100360016 | |||
| 847 | Ga0070664_100094839 | |||
| 848 | Ga0068857_100040160 | |||
| 849 | Ga0068854_100073340 | |||
| 850 | Ga0068854_100228991 | |||
| 851 | Ga0068856_100039596 | |||
| 852 | Ga0068856_100117221 | |||
| 853 | Ga0068856_100206708 | |||
| 854 | Ga0070702_100140476 | |||
| 855 | Ga0068859_100094114 | |||
| 856 | Ga0068859_100116666 | |||
| 857 | Ga0068864_100067198 | |||
| 858 | Ga0068864_100157479 | |||
| 859 | Ga0068864_100458735 | |||
| 860 | Ga0068866_10028223 | |||
| 861 | Ga0068861_100029462 | |||
| 862 | Ga0068861_100077966 | |||
| 863 | Ga0068851_10057785 | |||
| 864 | Ga0068870_10035468 | |||
| 865 | Ga0068863_100093280 | |||
| 866 | Ga0068863_100180102 | |||
| 867 | Ga0068858_100079222 | |||
| 868 | Ga0068858_100120636 | |||
| 869 | Ga0068860_100107318 | |||
| 870 | Ga0068860_100124946 | |||
| 871 | Ga0068862_100065978 | |||
| 872 | Ga0068862_100103158 | |||
| 873 | Ga0081455_10000879 | |||
| 874 | Ga0081455_10041123 | |||
| 875 | Ga0081455_10056590 | |||
| 876 | Ga0081540_1006008 | |||
| 877 | Ga0081540_1038963 | |||
| 878 | Ga0070717_10034411 | |||
| 879 | Ga0070717_10071929 | |||
| 880 | Ga0070717_10096586 | |||
| 881 | Ga0070717_10098948 | |||
| 882 | Ga0070715_10005934 | |||
| 883 | Ga0070716_100021878 | |||
| 884 | Ga0070712_100062317 | |||
| 885 | Ga0070712_100068171 | |||
| 886 | Ga0070712_100105104 | |||
| 887 | Ga0070712_100113359 | |||
| 888 | Ga0070712_100128268 | |||
| 889 | Ga0070712_100151798 | |||
| 890 | Ga0070712_100320911 | |||
| 891 | Ga0097621_100085350 | |||
| 892 | Ga0068871_100160685 | |||
| 893 | Ga0075428_100106211 | |||
| 894 | Ga0075431_100200724 | |||
| 895 | Ga0075433_10063393 | |||
| 896 | Ga0075434_100094887 | |||
| 897 | Ga0068865_100052827 | |||
| 898 | Ga0068865_100073457 | |||
| 899 | Ga0068865_100076192 | |||
| 900 | Ga0068865_100162515 | |||
| 901 | Ga0075436_100029193 | |||
| 902 | Ga0075436_100066870 | |||
| 903 | Ga0097620_100094109 | |||
| 904 | Ga0097620_100116663 | |||
| 905 | Ga0075435_100060110 | |||
| 906 | Ga0075435_100093157 | |||
| 907 | Ga0099795_10011103 | |||
| 908 | Ga0111539_10039356 | |||
| 909 | Ga0111539_10255809 | |||
| 910 | Ga0105245_10044493 | |||
| 911 | Ga0105245_10052564 | |||
| 912 | Ga0105245_10106775 | |||
| 913 | Ga0105247_10022639 | |||
| 914 | Ga0114129_10213224 | |||
| 915 | Ga0105243_10052824 | |||
| 916 | Ga0105241_10048325 | |||
| 917 | Ga0105241_10224305 | |||
| 918 | Ga0105242_10091640 | |||
| 919 | Ga0105242_10092518 | |||
| 920 | Ga0105242_10101000 | |||
| 921 | Ga0105248_10094610 | |||
| 922 | Ga0105248_10129569 | |||
| 923 | Ga0105248_10164384 | |||
| 924 | Ga0105248_10253810 | |||
| 925 | Ga0105237_10112461 | |||
| 926 | Ga0105237_10195366 | |||
| 927 | Ga0105238_10048435 | |||
| 928 | Ga0105249_10045967 | |||
| 929 | Ga0105249_10064391 | |||
| 930 | Ga0105249_10081301 | |||
| 931 | Ga0105249_10101156 | |||
| 932 | Ga0099796_10008293 | |||
| 933 | Ga0105239_10102519 | |||
| 934 | Ga0105239_10106262 | |||
| 935 | Ga0105239_10294166 | |||
| 936 | Ga0105246_10050420 | |||
| 937 | Ga0105246_10071063 | |||
| 938 | Ga0105246_10110722 | |||
| 939 | Ga0157374_10104469 | |||
| 940 | Ga0157374_10265296 | |||
| 941 | Ga0157378_10061529 | |||
| 942 | Ga0157378_10140019 | |||
| 943 | Ga0163162_10107208 | |||
| 944 | Ga0157372_10482416 | |||
| 945 | Ga0157375_10067486 | |||
| 946 | Ga0157375_10146705 | |||
| 947 | Ga0157375_10182739 | |||
| 948 | Ga0163163_10121480 | |||
| 949 | Ga0163163_10316214 | |||
| 950 | Ga0157380_10082972 | |||
| 951 | Ga0157380_10125867 | |||
| 952 | Ga0157377_10124523 | |||
| 953 | Ga0157376_10056433 | |||
| 954 | Ga0163161_10055415 | |||
| 955 | Ga0163161_10055550 | |||
| 956 | Ga0163161_10172212 | |||
| 957 | Ga0213873_10004325 | |||
| 958 | Ga0213873_10036746 | |||
| 959 | Ga0213874_10008603 | |||
| 960 | Ga0213874_10009071 | |||
| 961 | Ga0213876_10030729 | |||
| 962 | Ga0213876_10042021 | |||
| 963 | Ga0213871_10006837 | |||
| 964 | Ga0224572_1000068 | |||
| 965 | Ga0224572_1004346 | |||
| 966 | Ga0224572_1004640 | |||
| 967 | Ga0224572_1004725 | |||
| 968 | Ga0228598_1005455 | |||
| 969 | Ga0207697_10020892 | |||
| 970 | Ga0207656_10032488 | |||
| 971 | Ga0207682_10013269 | |||
| 972 | Ga0207692_10031416 | |||
| 973 | Ga0207692_10034465 | |||
| 974 | Ga0207710_10047984 | |||
| 975 | Ga0207688_10039481 | |||
| 976 | Ga0207680_10072142 | |||
| 977 | Ga0207647_10052045 | |||
| 978 | Ga0207685_10014491 | |||
| 979 | Ga0207699_10042525 | |||
| 980 | Ga0207699_10050641 | |||
| 981 | Ga0207699_10114725 | |||
| 982 | Ga0207645_10062013 | |||
| 983 | Ga0207643_10020776 | |||
| 984 | Ga0207643_10041727 | |||
| 985 | Ga0207705_10036735 | |||
| 986 | Ga0207705_10095024 | |||
| 987 | Ga0207654_10137364 | |||
| 988 | Ga0207707_10102335 | |||
| 989 | Ga0207671_10073555 | |||
| 990 | Ga0207693_10029263 | |||
| 991 | Ga0207693_10071667 | |||
| 992 | Ga0207693_10088953 | |||
| 993 | Ga0207693_10124215 | |||
| 994 | Ga0207693_10130164 | |||
| 995 | Ga0207663_10045001 | |||
| 996 | Ga0207663_10056923 | |||
| 997 | Ga0207663_10110009 | |||
| 998 | Ga0207663_10142773 | |||
| 999 | Ga0207662_10016399 | |||
| 1000 | Ga0207662_10032372 | |||
| 1001 | Ga0207657_10083133 | |||
| 1002 | Ga0207649_10064632 | |||
| 1003 | Ga0207652_10186231 | |||
| 1004 | Ga0207681_10003810 | |||
| 1005 | Ga0207681_10042646 | |||
| 1006 | Ga0207681_10212935 | |||
| 1007 | Ga0207694_10151809 | |||
| 1008 | Ga0207650_10073191 | |||
| 1009 | Ga0207659_10059273 | |||
| 1010 | Ga0207659_10078268 | |||
| 1011 | Ga0207687_10050358 | |||
| 1012 | Ga0207687_10059670 | |||
| 1013 | Ga0207700_10081239 | |||
| 1014 | Ga0207700_10087050 | |||
| 1015 | Ga0207700_10087144 | |||
| 1016 | Ga0207700_10087302 | |||
| 1017 | Ga0207700_10091714 | |||
| 1018 | Ga0207700_10209356 | |||
| 1019 | Ga0207700_10244652 | |||
| 1020 | Ga0207664_10063466 | |||
| 1021 | Ga0207664_10095274 | |||
| 1022 | Ga0207664_10129327 | |||
| 1023 | Ga0207644_10066848 | |||
| 1024 | Ga0207644_10075522 | |||
| 1025 | Ga0207706_10047047 | |||
| 1026 | Ga0207706_10199535 | |||
| 1027 | Ga0207686_10055511 | |||
| 1028 | Ga0207686_10058554 | |||
| 1029 | Ga0207709_10055779 | |||
| 1030 | Ga0207670_10063668 | |||
| 1031 | Ga0207669_10046765 | |||
| 1032 | Ga0207669_10053437 | |||
| 1033 | Ga0207669_10135152 | |||
| 1034 | Ga0207704_10049954 | |||
| 1035 | Ga0207704_10164874 | |||
| 1036 | Ga0207665_10026357 | |||
| 1037 | Ga0207691_10050138 | |||
| 1038 | Ga0207691_10073645 | |||
| 1039 | Ga0207691_10094272 | |||
| 1040 | Ga0207711_10057108 | |||
| 1041 | Ga0207711_10104454 | |||
| 1042 | Ga0207711_10134898 | |||
| 1043 | Ga0207689_10023026 | |||
| 1044 | Ga0207689_10101238 | |||
| 1045 | Ga0207661_10093600 | |||
| 1046 | Ga0207679_10062034 | |||
| 1047 | Ga0207651_10071748 | |||
| 1048 | Ga0207651_10073052 | |||
| 1049 | Ga0207651_10073148 | |||
| 1050 | Ga0207651_10140201 | |||
| 1051 | Ga0207712_10025050 | |||
| 1052 | Ga0207668_10034635 | |||
| 1053 | Ga0207668_10061642 | |||
| 1054 | Ga0207668_10065498 | |||
| 1055 | Ga0207640_10164730 | |||
| 1056 | Ga0207658_10115749 | |||
| 1057 | Ga0207677_10049269 | |||
| 1058 | Ga0207677_10069674 | |||
| 1059 | Ga0207677_10115941 | |||
| 1060 | Ga0207703_10081311 | |||
| 1061 | Ga0207639_10074841 | |||
| 1062 | Ga0207678_10026635 | |||
| 1063 | Ga0207678_10077719 | |||
| 1064 | Ga0207708_10046530 | |||
| 1065 | Ga0207708_10066138 | |||
| 1066 | Ga0207708_10232939 | |||
| 1067 | Ga0207702_10033722 | |||
| 1068 | Ga0207702_10130598 | |||
| 1069 | Ga0207641_10109358 | |||
| 1070 | Ga0207641_10109612 | |||
| 1071 | Ga0207641_10115331 | |||
| 1072 | Ga0207648_10055121 | |||
| 1073 | Ga0207648_10090361 | |||
| 1074 | Ga0207648_10118056 | |||
| 1075 | Ga0207676_10021831 | |||
| 1076 | Ga0207676_10095686 | |||
| 1077 | Ga0207676_10417651 | |||
| 1078 | Ga0207674_10008547 | |||
| 1079 | Ga0207674_10171211 | |||
| 1080 | Ga0207675_100100768 | |||
| 1081 | Ga0207675_100127408 | |||
| 1082 | Ga0207683_10053914 | |||
| 1083 | Ga0207683_10082655 | |||
| 1084 | Ga0207683_10369441 | |||
| 1085 | Ga0268266_10097428 | |||
| 1086 | Ga0268266_10200565 | |||
| 1087 | Ga0268266_10230022 | |||
| 1088 | Ga0268265_10091697 | |||
| 1089 | Ga0268264_10114663 | |||
| 1090 | Ga0268264_10180687 | |||
| 1091 | Ga0265337_1043048 | |||
| 1092 | Ga0265338_10070076 | |||
| 1093 | Ga0265770_1003786 | |||
| 1094 | Ga0265760_10010376 | |||
| 1095 | Ga0265330_10029221 | |||
| 1096 | Ga0265331_10026155 | |||
| 1097 | Ga0265316_10066088 | |||
| 1098 | Ga0265316_10067947 | |||
| 1099 | Ga0316575_10030058 | |||
| 1100 | Ga0265342_10067444 | |||
| 1101 | Ga0316576_10062210 | |||
| 1102 | Ga0316578_10055858 | |||
| 1103 | Ga0307410_10064000 | |||
| 1104 | Ga0307406_10052340 | |||
| 1105 | Ga0307407_10020469 | |||
| 1106 | Ga0307409_100129065 | |||
| 1107 | Ga0307416_100112631 | |||
| 1108 | Ga0307414_10068846 | |||
| 1109 | Ga0307411_10186681 | |||
| 1110 | Ga0307415_100053765 | |||
| 1111 | Ga0316583_10006576 | |||
| 1112 | Ga0373926_0008846 | |||
| 1113 | Ga0373926_0018570 | |||
| 1114 | Ga0373928_0012056 | |||
| 1115 | Ga0373929_0005160 | |||
| 1116 | Ga0373934_0003928 | |||
| 1117 | Ga0373934_0012101 | |||
| 1118 | Ga0373934_0020169 | |||
| 1119 | Ga0373934_0020626 | |||
| 1120 | Ga0373944_0008029 | |||
| 1121 | Ga0373944_0018915 | |||
| 1122 | Ga0373923_0008764 | |||
| 1123 | Ga0373923_0017114 | |||
| 1124 | Ga0373923_0022689 | |||
| 1125 | Ga0373923_0028346 | |||
| 1126 | Ga0373923_0061086 | |||
| 1127 | Ga0373932_0004147 | |||
| 1128 | Ga0373936_0019437 | |||
| 1129 | Ga0373936_0023293 | |||
| 1130 | Ga0373936_0025728 | |||
| 1131 | Ga0373936_0053143 | |||
| 1132 | Ga0373939_0009373 | |||
| 1133 | Ga0373945_0009848 | |||
| 1134 | Ga0373945_0015417 | |||
| 1135 | Ga0373945_0031724 | |||
| 1136 | Ga0373953_0002714 | |||
| 1137 | Ga0373953_0012925 | |||
| 1138 | Ga0373954_0017852 | |||
| 1139 | Ga0373954_0027230 | |||
| 1140 | Ga0373954_0028453 | |||
| 1141 | Ga0373954_0033323 | |||
| 1142 | Ga0373954_0033524 | |||
| 1143 | Ga0373956_0007623 | |||
| 1144 | Ga0373956_0025202 | |||
| 1145 | Ga0373956_0026354 | |||
| 1146 | Ga0373957_0001705 | |||
| 1147 | Ga0373957_0005579 | |||
| 1148 | Ga0373957_0017222 | |||
| 1149 | Ga0373960_0012821 | |||
| 1150 | Ga0373943_0015640 | |||
| 1151 | Ga0373943_0029718 | |||
| 1152 | Ga0373943_0032538 | |||
| 1153 | Ga0373946_0005661 | |||
| 1154 | Ga0373946_0015401 | |||
| 1155 | Ga0373946_0030349 | |||
| 1156 | Ga0373955_0007099 | |||
| 1157 | Ga0373955_0018026 | |||
| 1158 | Ga0373955_0023869 | |||
| 1159 | Ga0373955_0037821 | |||
| 1160 | Ga0373955_0039860 | |||
| 1161 | Ga0373942_0018086 | |||
| 1162 | Ga0316574_0021836 | |||
| 1163 | Ga0373924_0016088 | |||
| 1164 | Ga0373924_0020702 | |||
| 1165 | Ga0373924_0021625 | |||
| 1166 | Ga0373931_0044801 | |||
| 1167 | Ga0373931_0052074 | |||
| 1168 | Ga0373935_0046498 | |||
| 1169 | Ga0373935_0058004 | |||
| 1170 | Ga0373935_0058776 | |||
| 1171 | Ga0373927_0019437 | |||
| 1172 | Ga0373927_0031455 | |||
| 1173 | Ga0373927_0044493 | |||
| 1174 | Ga0373933_0006647 | |||
| 1175 | Ga0373933_0026954 | |||
| 1176 | Ga0373933_0040596 | |||
| 1177 | Ga0373933_0066427 | |||
| 1178 | Ga0373947_0030933 | |||
| 1179 | Ga0373947_0039197 | |||
| 1180 | Ga0373947_0045958 | |||
| 1181 | Ga0373947_0046982 | |||
| 1182 | Ga0373947_0048331 | |||
| 1183 | Ga0373947_0148298 | |||
| 1184 | Ga0373937_0013810 | |||
| 1185 | Ga0373937_0031636 | |||
| 1186 | Ga0373937_0091660 | |||
| 1187 | Ga0373937_0129903 | |||
| 1188 | Ga0373937_0142295 | |||
| 1189 | Ga0373937_0272683 | |||
| 1190 | Ga0316584_0064626 | |||
| 1191 | Ga0316584_0102834 | |||
| 1192 | Ga0373925_0093480 | |||
| 1193 | Ga0373925_0114204 | |||
| 1194 | Ga0373925_0145579 | |||
| 1195 | Ga0400490_52328 | |||
| 1196 | Ga0400485_16878 | |||
| 1197 | Ga0400486_26978 | |||
| 1198 | Ga0400483_098340 | |||
| 1199 | Ga0400483_099422 | |||
| 1200 | Ga0400483_102513 | |||
| 1201 | Ga0436365_0562279 | |||
| 1202 | Ga0436365_0775127 | |||
| 1203 | Ga0436360_0217073 | |||
| 1204 | Ga0436360_1125868 | |||
| 1205 | Ga0436363_0394151 | |||
| 1206 | Ga0436363_0414266 | |||
| 1207 | Ga0436363_0848767 | |||
| 1208 | Ga0436362_0857593 | |||
| 1209 | Ga0439432_039374 | |||
| 1210 | Ga0439450_024356 | |||
| 1211 | Ga0439457_018057 | |||
| 1212 | Ga0450900_004997 | |||
| 1213 | Ga0466965_0058208 | |||
| 1214 | Ga0466963_0097424 | |||
| 1215 | Ga0466964_0066172 | |||
| 1216 | Ga0466971_0080045 | |||
| 1217 | Ga0466967_0107871 | |||
| 1218 | Ga0495617_016590 | |||
| 1219 | Ga0495627_016262 | |||
| 1220 | Ga0495627_024309 | |||
| 1221 | Ga0495592_0059869 | |||
| 1222 | Ga0495592_0067034 | |||
| 1223 | Ga0495592_0073615 | |||
| 1224 | Ga0495592_0090889 | |||
| 1225 | Ga0495603_0047039 | |||
| 1226 | Ga0495591_025067 | |||
| 1227 | Ga0495629_0026488 | |||
| 1228 | Ga0495629_0038101 | |||
| 1229 | Ga0495629_0050633 | |||
| 1230 | Ga0495629_0060186 | |||
| 1231 | Ga0495629_0065003 | |||
| 1232 | Ga0495629_0071881 | |||
| 1233 | Ga0495638_0076911 | |||
| 1234 | Ga0495641_0028756 | |||
| 1235 | Ga0495651_0040151 | |||
| 1236 | Ga0495651_0048942 | |||
| 1237 | Ga0495651_0089386 | |||
| 1238 | Ga0495651_0089834 | |||
| 1239 | Ga0495653_0018002 | |||
| 1240 | Ga0495653_0022589 | |||
| 1241 | Ga0495653_0073657 | |||
| 1242 | Ga0495653_0082398 | |||
| 1243 | Ga0495582_0044663 | |||
| 1244 | Ga0495582_0149127 | |||
| 1245 | Ga0495605_0050449 | |||
| 1246 | Ga0495605_0102197 | |||
| 1247 | Ga0495639_0027380 | |||
| 1248 | Ga0495639_0027771 | |||
| 1249 | Ga0495639_0033068 | |||
| 1250 | Ga0495639_0100205 | |||
| 1251 | Ga0495662_0028007 | |||
| 1252 | Ga0495662_0030633 | |||
| 1253 | Ga0495662_0030637 | |||
| 1254 | Ga0495662_0052430 | |||
| 1255 | Ga0495664_0036911 | |||
| 1256 | Ga0495664_0038331 | |||
| 1257 | Ga0495664_0039625 | |||
| 1258 | Ga0495664_0053671 | |||
| 1259 | Ga0495584_0024115 | |||
| 1260 | Ga0495584_0032445 | |||
| 1261 | Ga0495584_0036034 | |||
| 1262 | Ga0495584_0078360 | |||
| 1263 | Ga0495585_0034330 | |||
| 1264 | Ga0495585_0060673 | |||
| 1265 | Ga0495585_0078004 | |||
| 1266 | Ga0495585_0123512 | |||
| 1267 | Ga0495596_0029355 | |||
| 1268 | Ga0495607_0049863 | |||
| 1269 | Ga0495607_0050788 | |||
| 1270 | Ga0495608_0011748 | |||
| 1271 | Ga0495608_0053896 | |||
| 1272 | Ga0495608_0055791 | |||
| 1273 | Ga0495608_0059997 | |||
| 1274 | Ga0495608_0060427 | |||
| 1275 | Ga0495616_0046106 | |||
| 1276 | Ga0495616_0047392 | |||
| 1277 | Ga0495618_0013907 | |||
| 1278 | Ga0495618_0036588 | |||
| 1279 | Ga0495618_0051692 | |||
| 1280 | Ga0495618_0055478 | |||
| 1281 | Ga0495628_0061026 | |||
| 1282 | Ga0495628_0076002 | |||
| 1283 | Ga0495628_0080399 | |||
| 1284 | Ga0495630_0033825 | |||
| 1285 | Ga0495630_0066741 | |||
| 1286 | Ga0495630_0068199 | |||
| 1287 | Ga0495630_0074110 | |||
| 1288 | Ga0495630_0076221 | |||
| 1289 | Ga0495631_0047352 | |||
| 1290 | Ga0495637_0028636 | |||
| 1291 | Ga0495637_0095490 | |||
| 1292 | Ga0495644_0019206 | |||
| 1293 | Ga0495644_0032550 | |||
| 1294 | Ga0495644_0036637 | |||
| 1295 | Ga0495644_0081175 | |||
| 1296 | Ga0495663_0010814 | |||
| 1297 | Ga0495663_0012740 | |||
| 1298 | Ga0495666_0058143 | |||
| 1299 | Ga0495642_0027185 | |||
| 1300 | Ga0495652_0011404 | |||
| 1301 | Ga0495652_0078424 | |||
| 1302 | Ga0495652_0088124 | |||
| 1303 | Ga0495665_0029415 | |||
| 1304 | Ga0495665_0043505 | |||
| 1305 | Ga0495665_0059441 | |||
| 1306 | Ga0495640_0020732 | |||
| 1307 | Ga0495640_0043757 | |||
| 1308 | Ga0495640_0050937 | |||
| 1309 | Ga0495640_0056794 | |||
| 1310 | Ga0495640_0064697 | |||
| 1311 | Ga0495640_0068199 | |||
| 1312 | Ga0495586_0006627 | |||
| 1313 | Ga0495587_0016279 | |||
| 1314 | Ga0495587_0033068 | |||
| 1315 | Ga0495587_0045282 | |||
| 1316 | Ga0495587_0047717 | |||
| 1317 | Ga0495598_0007147 | |||
| 1318 | Ga0495598_0020384 | |||
| 1319 | Ga0495609_0028461 | |||
| 1320 | Ga0495609_0029491 | |||
| 1321 | Ga0495621_0007799 | |||
| 1322 | Ga0495645_0057621 | |||
| 1323 | Ga0495645_0088257 | |||
| 1324 | Ga0495622_0062961 | |||
| 1325 | Ga0495633_0027867 | |||
| 1326 | Ga0495633_0066478 | |||
| 1327 | Ga0495667_0011340 | |||
| 1328 | Ga0495667_0027955 | |||
| 1329 | Ga0495667_0052779 | |||
| 1330 | Ga0495667_0057707 | |||
| 1331 | Ga0495667_0060677 | |||
| 1332 | Ga0495667_0061606 | |||
| 1333 | Ga0495667_0064995 | |||
| 1334 | Ga0495656_0016585 | |||
| 1335 | Ga0495656_0027760 | |||
| 1336 | Ga0495656_0046738 | |||
| 1337 | Ga0495656_0074977 | |||
| 1338 | Ga0495668_0052516 | |||
| 1339 | Ga0495634_0020223 | |||
| 1340 | Ga0495634_0031252 | |||
| 1341 | Ga0495634_0038192 | |||
| 1342 | Ga0495634_0053765 | |||
| 1343 | Ga0495634_0058668 | |||
| 1344 | Ga0495634_0064258 | |||
| 1345 | Ga0495634_0094369 | |||
| 1346 | Ga0495611_0032982 | |||
| 1347 | Ga0495611_0038563 | |||
| 1348 | Ga0495611_0045782 | |||
| 1349 | Ga0495611_0107051 | |||
| 1350 | Ga0495635_0035565 | |||
| 1351 | Ga0495635_0048630 | |||
| 1352 | Ga0495635_0057547 | |||
| 1353 | Ga0495635_0074505 | |||
| 1354 | Ga0495659_0014913 | |||
| 1355 | Ga0495659_0015646 | |||
| 1356 | Ga0495659_0018722 | |||
| 1357 | Ga0495659_0027284 | |||
| 1358 | Ga0495661_0025067 | |||
| 1359 | Ga0495661_0052573 | |||
| 1360 | Ga0495661_0107815 | |||
| 1361 | Ga0495657_0042708 | |||
| 1362 | Ga0495657_0054197 | |||
| 1363 | Ga0495657_0056664 | |||
| 1364 | Ga0495657_0062028 | |||
| 1365 | Ga0495599_0017707 | |||
| 1366 | Ga0495599_0041054 | |||
| 1367 | Ga0495599_0054957 | |||
| 1368 | Ga0495623_0047441 | |||
| 1369 | Ga0495623_0054129 | |||
| 1370 | Ga0495623_0055765 | |||
| 1371 | Ga0495646_0031092 | |||
| 1372 | Ga0495646_0043658 | |||
| 1373 | Ga0495646_0051760 | |||
| 1374 | Ga0495646_0082301 | |||
| 1375 | Ga0495647_0015140 | |||
| 1376 | Ga0495647_0015664 | |||
| 1377 | Ga0495647_0018650 | |||
| 1378 | Ga0495658_0037572 | |||
| 1379 | Ga0495658_0038110 | |||
| 1380 | Ga0495658_0041674 | |||
| 1381 | Ga0495658_0042515 | |||
| 1382 | Ga0495658_0045956 | |||
| 1383 | Ga0495658_0050961 | |||
| 1384 | Ga0495658_0062581 | |||
| 1385 | Ga0495669_0026968 | |||
| 1386 | Ga0495669_0031426 | |||
| 1387 | Ga0495669_0070863 | |||
| 1388 | Ga0495669_0082774 | |||
| 1389 | Ga0495613_0035916 | |||
| 1390 | Ga0495613_0036694 | |||
| 1391 | Ga0495613_0057316 | |||
| 1392 | Ga0495613_0122308 | |||
| 1393 | Ga0495624_0046894 | |||
| 1394 | Ga0495624_0052072 | |||
| 1395 | Ga0495624_0052076 | |||
| 1396 | Ga0495624_0054045 | |||
| 1397 | Ga0495670_0025605 | |||
| 1398 | Ga0495670_0068644 | |||
| 1399 | Ga0495671_0054109 | |||
| 1400 | Ga0495589_0102728 | |||
| 1401 | Ga0495600_0008445 | |||
| 1402 | Ga0495600_0020651 | |||
| 1403 | Ga0495600_0059423 | |||
| 1404 | Ga0495600_0067191 | |||
| 1405 | Ga0495581_0043302 | |||
| 1406 | Ga0495581_0045057 | |||
| 1407 | Ga0495581_0124818 | |||
| 1408 | Ga0495604_0027274 | |||
| 1409 | Ga0495604_0062895 | |||
| 1410 | Ga0495636_0021852 | |||
| 1411 | Ga0495636_0025233 | |||
| 1412 | Ga0495636_0062709 | |||
| 1413 | Ga0495674_0031964 | |||
| 1414 | Ga0495674_0050305 | |||
| 1415 | Ga0495674_0051668 | |||
| 1416 | Ga0495674_0077781 | |||
| 1417 | Ga0495674_0242319 | |||
| 1418 | Ga0495676_0068866 | |||
| 1419 | Ga0495676_0107731 | |||
| 1420 | Ga0495676_0135158 | |||
| 1421 | Ga0495676_0159364 | |||
| 1422 | Ga0495680_0057003 | |||
| 1423 | Ga0495680_0059647 | |||
| 1424 | Ga0495680_0069761 | |||
| 1425 | Ga0495680_0071432 | |||
| 1426 | Ga0495680_0079836 | |||
| 1427 | Ga0495680_0092039 | |||
| 1428 | Ga0495680_0116471 | |||
| 1429 | Ga0495680_0140898 | |||
| 1430 | Ga0495680_0162726 | |||
| 1431 | Ga0495683_0039517 | |||
| 1432 | Ga0495683_0071754 | |||
| 1433 | Ga0495675_0019392 | |||
| 1434 | Ga0495675_0051165 | |||
| 1435 | Ga0495675_0054083 | |||
| 1436 | Ga0495675_0066390 | |||
| 1437 | Ga0495677_0018993 | |||
| 1438 | Ga0495677_0019256 | |||
| 1439 | Ga0495677_0019921 | |||
| 1440 | Ga0495679_023861 | |||
| 1441 | Ga0495673_0064484 | |||
| 1442 | Ga0495673_0096153 | |||
| 1443 | Ga0495681_0057650 | |||
| 1444 | Ga0495684_0065336 | |||
| 1445 | Ga0495684_0074235 | |||
| 1446 | Ga0495684_0076709 | |||
| 1447 | Ga0495684_0079062 | |||
| 1448 | Ga0495684_0098268 | |||
| 1449 | Ga0495684_0128265 | |||
| 1450 | Ga0495684_0187139 | |||
| 1451 | Ga0495593_0007737 | |||
| 1452 | Ga0495593_0033834 | |||
| 1453 | Ga0495593_0041705 | |||
| 1454 | Ga0495602_0018821 | |||
| 1455 | Ga0495602_0087861 | |||
| 1456 | Ga0495614_0025293 | |||
| 1457 | Ga0495614_0046306 | |||
| 1458 | Ga0495614_0091822 | |||
| 1459 | Ga0495615_0003984 | |||
| 1460 | Ga0496100_0014611 | |||
| 1461 | Ga0496100_0140353 | |||
| 1462 | Ga0496101_0022469 | |||
| 1463 | Ga0496101_0232791 | |||
| 1464 | Ga0496102_0083871 | |||
| 1465 | Ga0496102_0090768 | |||
| 1466 | Ga0496103_0047059 | |||
| 1467 | Ga0496104_0051107 | |||
| 1468 | Ga0496104_0102706 | |||
| 1469 | Ga0496104_0108244 | |||
| 1470 | Ga0496105_0028112 | |||
| 1471 | Ga0496105_0174620 | |||
| 1472 | Ga0496105_0176417 | |||
| 1473 | Ga0496106_0114201 | |||
| 1474 | Ga0496106_0124614 | |||
| 1475 | Ga0496107_0037303 | |||
| 1476 | Ga0496107_0177384 | |||
| 1477 | Ga0496110_0189767 | |||
| 1478 | Ga0496111_0096144 | |||
| 1479 | Ga0496112_0050821 | |||
| 1480 | Ga0496114_0071988 | |||
| 1481 | Ga0496114_0098617 | |||
| 1482 | Ga0496114_0228334 | |||
| 1483 | Ga0496115_0088776 | |||
| 1484 | Ga0496115_0136144 | |||
| 1485 | Ga0501033_0075207 | |||
| 1486 | Ga0501036_0102457 | |||
| 1487 | Ga0501039_0038898 | |||
| 1488 | Ga0501039_0094815 | |||
| 1489 | Ga0501040_0081507 | |||
| 1490 | Ga0501040_0119809 | |||
| 1491 | Ga0501040_0221631 | |||
| 1492 | Ga0501046_0148229 | |||
| 1493 | Ga0501047_0302142 | |||
| 1494 | Ga0501048_0089272 | |||
| 1495 | Ga0501070_0238332 | |||
| 1496 | Ga0501071_0015100 | |||
| 1497 | Ga0501072_0084273 | |||
| 1498 | Ga0501073_0093634 | |||
| 1499 | Ga0501075_0091252 | |||
| 1500 | Ga0501079_0089225 | |||
| 1501 | Ga0501081_0046685 | |||
| 1502 | Ga0501081_0150210 | |||
| 1503 | Ga0501044_0147310 | |||
| 1504 | nmdc:mga05p37_193715_c1 | |||
| 1505 | nmdc:mga06r32_207080_c1 | |||
| 1506 | nmdc:mga0n895_115642_c1 | |||
| 1507 | nmdc:mga0n895_116981_c1 | |||
| 1508 | nmdc:mga0rr50_154138_c1 | |||
| 1509 | nmdc:mga0rr50_8020_c1 | |||
| 1510 | nmdc:mga08x19_37966_c1 | |||
| 1511 | nmdc:mga08x19_38830_c1 | |||
| 1512 | nmdc:mga0a205_57684_c1 | |||
| 1513 | Ga0495601_0011876 | |||
| 1514 | Ga0495601_0048809 | |||
| 1515 | Ga0495601_0052311 | |||
| 1516 | Ga0495601_0121499 | |||
| 1517 | Ga0495612_0009552 | |||
| 1518 | Ga0495612_0041103 | |||
| 1519 | Ga0495655_0008855 | |||
| 1520 | Ga0495595_0009112 | |||
| 1521 | Ga0495595_0028262 | |||
| 1522 | Ga0495595_0029716 | |||
| 1523 | Ga0495619_0008840 | |||
| 1524 | Ga0495619_0049706 | |||
| 1525 | Ga0495619_0058040 | |||
| 1526 | Ga0495619_0087483 | |||
| 1527 | Ga0495619_0174165 | |||
| 1528 | Ga0500555_012971 | |||
| 1529 | Ga0501084_0172537 | |||
| 1530 | Ga0501082_0069938 | |||
| 1531 | Ga0501082_0363342 | |||
| 1532 | Ga0530510_0054069 | |||
| 1533 | Ga0530510_0058368 | |||
| 1534 | Ga0530510_0072381 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l57-assembly2.cif.gz_B | crystal structure of the plasmid pcu1 trai relaxase domain | 0.6616 | 93 | 204 |
| 3l6t-assembly1.cif.gz_A | crystal structure of an n-terminal mutant of the plasmid pcu1 trai relaxase domain | 0.6546 | 95 | 204 |
| 3l6t-assembly2.cif.gz_B | crystal structure of an n-terminal mutant of the plasmid pcu1 trai relaxase domain | 0.6387 | 95 | 204 |
| 3l57-assembly1.cif.gz_A | crystal structure of the plasmid pcu1 trai relaxase domain | 0.6072 | 95 | 221 |
| 2q7t-assembly1.cif.gz_A | crystal structure of the f plasmid trai relaxase domain with the scissile thymidine base | 0.5936 | 95 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LXZ3_68_367_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.752 | 250 | 276 | 2.120.10.30 |
| af_Q54RJ4_349_604_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.705 | 249 | 276 | 1.10.510.10 |
| af_P0A6N8_1_64_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.6823 | 257 | 278 | 2.30.30.30 |
| af_Q9SVJ9_86_341_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.658 | 250 | 276 | 2.120.10.80 |
| af_H2KZU7_87_374_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6369 | 256 | 284 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848A1T3-F1-model_v4 | deleted | 0.9616 | 86 | 206 |
|
| AF-A0A7W0GNF9-F1-model_v4 | Transposase | 0.9431 | 123 | 304 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-X1QGP8-F1-model_v4 | Transposase zinc-binding domain-containing protein | 0.9355 | 81 | 307 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A3D3UUG5-F1-model_v4 | IS91 family transposase | 0.9283 | 88 | 273 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A7W0GNF9-F1-model_v4 | Transposase | 0.9282 | 123 | 304 |
GO:0003677
GO:0004803 GO:0006313 |