F479905

General Info

Members Datasets Scaffolds Average Seq Length
767 310 1534 165

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0310335|Ga0436365_0310335_384_989
Length 201
Sequence MTELNKILTANEEFSKDFKHGKLPIPPSRKLAILACMDARLTVEDFLGLDTGDAHIIRNAGGIATDDAIRSLIISHELLGTQEFLVVNHTDCGMLTFTDENLRKRLLEKYDADAAGLNFYSFPDLEANVKNQVDNIKSTPFLPKDIPVYGFVYDVRTGKIKEVARATATTAPEGIQEQEEVNQDEEEGQKIRKRISVSTNA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.65
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0310335 3300039437 Archaea 2582
2 JGI24033J26618_1032948 3300002155 Archaea 702
3 Ga0070658_10013444 3300005327 Bacteria 6568
4 Ga0070658_10897185 3300005327 Bacteria 771
5 Ga0070676_10051832 3300005328 Bacteria 2411
6 Ga0070683_100016775 3300005329 Archaea 6461
7 Ga0070683_100051686 3300005329 Unclassified 3805
8 Ga0070683_100133775 3300005329 Bacteria 2347
9 Ga0070683_100225728 3300005329 Bacteria 1780
10 Ga0070683_100434268 3300005329 Bacteria 1253
11 Ga0070683_100659101 3300005329 Bacteria 1002
12 Ga0070690_100537076 3300005330 Bacteria 880
13 Ga0068869_100038772 3300005334 Bacteria 3399
14 Ga0070666_10051710 3300005335 Bacteria 2767
15 Ga0070680_100078407 3300005336 Bacteria 2721
16 Ga0070680_100092271 3300005336 Bacteria 2507
17 Ga0070680_100262362 3300005336 Bacteria 1461
18 Ga0070682_100019856 3300005337 Archaea 3946
19 Ga0070682_100049964 3300005337 Unclassified 2609
20 Ga0070682_100111393 3300005337 Bacteria 1824
21 Ga0070682_100124898 3300005337 Bacteria 1733
22 Ga0070682_100295432 3300005337 Archaea 1186
23 Ga0068868_100006294 3300005338 Archaea 8390
24 Ga0068868_100017727 3300005338 Bacteria 5309
25 Ga0068868_100399438 3300005338 Bacteria 1186
26 Ga0070660_100009784 3300005339 Bacteria 6755
27 Ga0070660_100245640 3300005339 Bacteria 1458
28 Ga0070689_100098104 3300005340 Bacteria 2317
29 Ga0070691_10057326 3300005341 Bacteria 1869
30 Ga0070687_100202760 3300005343 Archaea 1203
31 Ga0070661_100050686 3300005344 Bacteria 3037
32 Ga0070661_100428369 3300005344 Bacteria 1049
33 Ga0070692_10083349 3300005345 Bacteria 1726
34 Ga0070668_100231506 3300005347 Bacteria 1528
35 Ga0070668_101385213 3300005347 Archaea 641
36 Ga0070669_100007218 3300005353 Bacteria 7982
37 Ga0070671_100184565 3300005355 Bacteria 1767
38 Ga0070674_100058120 3300005356 Archaea 2687
39 Ga0070674_100186230 3300005356 Bacteria 1593
40 Ga0070673_100070518 3300005364 Archaea 2805
41 Ga0070659_100300542 3300005366 Bacteria 1338
42 Ga0070667_100034629 3300005367 Bacteria 4226
43 Ga0070667_101459169 3300005367 Unclassified 642
44 Ga0070703_10205730 3300005406 Bacteria 775
45 Ga0070709_10004401 3300005434 Archaea 7595
46 Ga0070709_10017111 3300005434 Bacteria 4151
47 Ga0070709_10145762 3300005434 Bacteria 1631
48 Ga0070709_10179188 3300005434 Unclassified 1487
49 Ga0070709_10188247 3300005434 Bacteria 1454
50 Ga0070709_10473735 3300005434 Bacteria 947
51 Ga0070714_100009938 3300005435 Bacteria 7505
52 Ga0070714_100039672 3300005435 Bacteria 3965
53 Ga0070714_100148523 3300005435 Bacteria 2110
54 Ga0070713_100007160 3300005436 Bacteria 7805
55 Ga0070713_100077452 3300005436 Unclassified 2827
56 Ga0070713_100082949 3300005436 Bacteria 2739
57 Ga0070713_100257797 3300005436 Unclassified 1593
58 Ga0070713_100390382 3300005436 Bacteria 1298
59 Ga0070713_100561360 3300005436 Unclassified 1082
60 Ga0070713_101353441 3300005436 Bacteria 690
61 Ga0070710_10001797 3300005437 Bacteria 10144
62 Ga0070710_10012639 3300005437 Archaea 4199
63 Ga0070710_10039964 3300005437 Bacteria 2583
64 Ga0070710_10248683 3300005437 Unclassified 1142
65 Ga0070711_100016245 3300005439 Archaea 4724
66 Ga0070711_100109703 3300005439 Bacteria 2023
67 Ga0070711_100129657 3300005439 Bacteria 1876
68 Ga0070711_100137536 3300005439 Bacteria 1828
69 Ga0070711_100673167 3300005439 Unclassified 869
70 Ga0070711_100726359 3300005439 Bacteria 838
71 Ga0070705_100098265 3300005440 Archaea 1842
72 Ga0070705_100227615 3300005440 Bacteria 1295
73 Ga0070700_100124236 3300005441 Archaea 1733
74 Ga0070694_100460987 3300005444 Bacteria 1005
75 Ga0070708_100510204 3300005445 Archaea 1134
76 Ga0070708_100791626 3300005445 Bacteria 891
77 Ga0070708_100893309 3300005445 Unclassified 834
78 Ga0070663_100060124 3300005455 Bacteria 2732
79 Ga0070663_100677215 3300005455 Unclassified 875
80 Ga0070678_101257214 3300005456 Bacteria 688
81 Ga0070662_100019825 3300005457 Bacteria 4573
82 Ga0070681_10027598 3300005458 Bacteria 5708
83 Ga0070681_10091723 3300005458 Bacteria 2988
84 Ga0070681_10120931 3300005458 Bacteria 2553
85 Ga0070681_10177307 3300005458 Bacteria 2053
86 Ga0070681_11775861 3300005458 Bacteria 543
87 Ga0070685_10149012 3300005466 Bacteria 1481
88 Ga0070685_10353633 3300005466 Archaea 1005
89 Ga0070706_100312785 3300005467 Bacteria 1465
90 Ga0070706_100619271 3300005467 Bacteria 1005
91 Ga0070707_100133222 3300005468 Bacteria 2417
92 Ga0070707_100300160 3300005468 Unclassified 1561
93 Ga0070707_100380643 3300005468 Bacteria 1371
94 Ga0070707_100522388 3300005468 Bacteria 1149
95 Ga0070707_100581713 3300005468 Unclassified 1082
96 Ga0070698_100406406 3300005471 Bacteria 1295
97 Ga0070699_100065636 3300005518 Bacteria 3150
98 Ga0070699_100277788 3300005518 Unclassified 1500
99 Ga0070699_100309138 3300005518 Bacteria 1419
100 Ga0070699_100542561 3300005518 Unclassified 1058
101 Ga0070699_100561606 3300005518 Unclassified 1039
102 Ga0070699_100682211 3300005518 Unclassified 938
103 Ga0070699_100739883 3300005518 Bacteria 899
104 Ga0070679_100029793 3300005530 Bacteria 5384
105 Ga0070679_101288323 3300005530 Unclassified 676
106 Ga0070684_100046061 3300005535 Bacteria 3778
107 Ga0070684_100059096 3300005535 Bacteria 3351
108 Ga0070684_100217167 3300005535 Archaea 1744
109 Ga0070684_100561422 3300005535 Bacteria 1060
110 Ga0070684_101464473 3300005535 Unclassified 643
111 Ga0070697_100015470 3300005536 Bacteria 5990
112 Ga0070697_100017017 3300005536 Bacteria 5717
113 Ga0070697_100101865 3300005536 Bacteria 2386
114 Ga0070697_100155039 3300005536 Unclassified 1933
115 Ga0070697_100468204 3300005536 Bacteria 1099
116 Ga0070697_100583057 3300005536 Bacteria 982
117 Ga0070697_100787073 3300005536 Bacteria 841
118 Ga0068853_100054583 3300005539 Bacteria 3443
119 Ga0070686_100027902 3300005544 Archaea 3419
120 Ga0070686_100284373 3300005544 Bacteria 1221
121 Ga0070686_100407745 3300005544 Bacteria 1035
122 Ga0070695_100000042 3300005545 Bacteria 48840
123 Ga0070695_100052699 3300005545 Bacteria 2615
124 Ga0070695_100055585 3300005545 Bacteria 2552
125 Ga0070695_100309343 3300005545 Bacteria 1171
126 Ga0070695_100373555 3300005545 Archaea 1074
127 Ga0070696_100012150 3300005546 Bacteria 5770
128 Ga0070696_100122538 3300005546 Bacteria 1883
129 Ga0070696_100252376 3300005546 Bacteria 1334
130 Ga0070696_100363848 3300005546 Unclassified 1123
131 Ga0070693_100005365 3300005547 Archaea 6149
132 Ga0070693_100207534 3300005547 Unclassified 1276
133 Ga0070693_100212588 3300005547 Bacteria 1262
134 Ga0070693_100220365 3300005547 Unclassified 1243
135 Ga0070665_100104981 3300005548 Bacteria 2827
136 Ga0070704_100034939 3300005549 Bacteria 3413
137 Ga0070704_100160360 3300005549 Bacteria 1778
138 Ga0068855_100055958 3300005563 Bacteria 4630
139 Ga0068855_100217837 3300005563 Bacteria 2142
140 Ga0068855_101548325 3300005563 Bacteria 680
141 Ga0068855_101947378 3300005563 Bacteria 594
142 Ga0070664_100029524 3300005564 Archaea 4571
143 Ga0068857_100025147 3300005577 Bacteria 5243
144 Ga0068857_100088478 3300005577 Bacteria 2770
145 Ga0068854_100019487 3300005578 Bacteria 4573
146 Ga0068854_101149503 3300005578 Unclassified 694
147 Ga0068856_100018701 3300005614 Bacteria 6715
148 Ga0068856_100059428 3300005614 Archaea 3776
149 Ga0070702_100024100 3300005615 Bacteria 3242
150 Ga0070702_100064385 3300005615 Bacteria 2144
151 Ga0068852_100209925 3300005616 Bacteria 1847
152 Ga0068852_100333691 3300005616 Unclassified 1476
153 Ga0068859_100304355 3300005617 Bacteria 1687
154 Ga0068859_101125403 3300005617 Unclassified 864
155 Ga0068866_10037982 3300005718 Unclassified 2368
156 Ga0068861_100368030 3300005719 Bacteria 1266
157 Ga0068863_100083643 3300005841 Bacteria 3024
158 Ga0068863_100122571 3300005841 Bacteria 2479
159 Ga0068863_100231718 3300005841 Bacteria 1781
160 Ga0068858_100179676 3300005842 Bacteria 1997
161 Ga0068860_100972496 3300005843 Bacteria 866
162 Ga0081538_10020293 3300005981 Bacteria 4899
163 Ga0070717_10023544 3300006028 Archaea 4882
164 Ga0070717_10177241 3300006028 Bacteria 1856
165 Ga0070717_10411328 3300006028 Bacteria 1216
166 Ga0070717_10474258 3300006028 Unclassified 1129
167 Ga0070717_10561452 3300006028 Bacteria 1034
168 Ga0070717_10650556 3300006028 Bacteria 957
169 Ga0070715_10000189 3300006163 Archaea 14340
170 Ga0070715_10001967 3300006163 Bacteria 6192
171 Ga0070715_10073544 3300006163 Bacteria 1533
172 Ga0070715_10095281 3300006163 Bacteria 1378
173 Ga0070715_10097002 3300006163 Bacteria 1368
174 Ga0070716_100000458 3300006173 Bacteria 16870
175 Ga0070716_100000478 3300006173 Bacteria 16555
176 Ga0070716_100000549 3300006173 Archaea 15744
177 Ga0070716_100035177 3300006173 Bacteria 2753
178 Ga0070716_100065197 3300006173 Bacteria 2120
179 Ga0070716_100148800 3300006173 Bacteria 1503
180 Ga0070716_100295821 3300006173 Bacteria 1124
181 Ga0070716_100365073 3300006173 Unclassified 1027
182 Ga0070716_100676070 3300006173 Bacteria 786
183 Ga0070712_100000159 3300006175 Archaea 36376
184 Ga0070712_100101492 3300006175 Unclassified 2128
185 Ga0070712_100138100 3300006175 Bacteria 1856
186 Ga0070712_100329094 3300006175 Archaea 1244
187 Ga0070712_100369052 3300006175 Bacteria 1179
188 Ga0070712_100651743 3300006175 Bacteria 895
189 Ga0070712_100781958 3300006175 Bacteria 818
190 Ga0070712_101000962 3300006175 Unclassified 723
191 Ga0070712_101471285 3300006175 Unclassified 595
192 Ga0097621_100014139 3300006237 Bacteria 5968
193 Ga0097621_100180535 3300006237 Bacteria 1824
194 Ga0097621_100257428 3300006237 Unclassified 1530
195 Ga0097621_100921836 3300006237 Bacteria 814
196 Ga0068871_100020502 3300006358 Unclassified 5065
197 Ga0068871_100030520 3300006358 Bacteria 4245
198 Ga0068871_100144659 3300006358 Archaea 2023
199 Ga0068871_100549739 3300006358 Bacteria 1046
200 Ga0075430_101339151 3300006846 Unclassified 589
201 Ga0075431_100353120 3300006847 Unclassified 1478
202 Ga0075433_10080975 3300006852 Archaea 2862
203 Ga0075434_100006798 3300006871 Archaea 10519
204 Ga0068865_100239069 3300006881 Archaea 1428
205 Ga0075436_100000175 3300006914 Bacteria 40019
206 Ga0075436_100001018 3300006914 Bacteria 18888
207 Ga0075436_100015369 3300006914 Bacteria 5244
208 Ga0075436_100041747 3300006914 Bacteria 3165
209 Ga0075436_100063022 3300006914 Archaea 2562
210 Ga0075436_100085000 3300006914 Bacteria 2196
211 Ga0075436_100232856 3300006914 Unclassified 1309
212 Ga0097620_100304356 3300006931 Bacteria 1687
213 Ga0097620_101125131 3300006931 Unclassified 864
214 Ga0075435_100340300 3300007076 Archaea 1285
215 Ga0075435_100496887 3300007076 Bacteria 1055
216 Ga0099794_10011702 3300007265 Bacteria 3764
217 Ga0099794_10051278 3300007265 Bacteria 1987
218 Ga0099794_10052969 3300007265 Bacteria 1957
219 Ga0099794_10054389 3300007265 Bacteria 1932
220 Ga0099794_10068016 3300007265 Bacteria 1741
221 Ga0099794_10077494 3300007265 Bacteria 1635
222 Ga0099794_10091036 3300007265 Bacteria 1513
223 Ga0099794_10342964 3300007265 Unclassified 776
224 Ga0099795_10046656 3300007788 Bacteria 1562
225 Ga0099795_10127250 3300007788 Bacteria 1024
226 Ga0099795_10147245 3300007788 Unclassified 962
227 Ga0105240_10037326 3300009093 Bacteria 6245
228 Ga0105240_10227161 3300009093 Bacteria 2171
229 Ga0105240_10272536 3300009093 Bacteria 1948
230 Ga0105240_10418514 3300009093 Bacteria 1506
231 Ga0111539_10555113 3300009094 Archaea 1338
232 Ga0105245_10016576 3300009098 Bacteria 6429
233 Ga0105245_10070011 3300009098 Bacteria 3182
234 Ga0105245_10162856 3300009098 Bacteria 2118
235 Ga0105245_11162654 3300009098 Bacteria 819
236 Ga0105245_11200372 3300009098 Bacteria 806
237 Ga0105247_10153809 3300009101 Bacteria 1518
238 Ga0114129_10369139 3300009147 Bacteria 1897
239 Ga0105243_10156717 3300009148 Bacteria 1959
240 Ga0105243_11181823 3300009148 Bacteria 777
241 Ga0105241_10029279 3300009174 Bacteria 4108
242 Ga0105241_10035342 3300009174 Archaea 3758
243 Ga0105241_10039553 3300009174 Bacteria 3558
244 Ga0105241_10076094 3300009174 Bacteria 2617
245 Ga0105241_10196079 3300009174 Unclassified 1684
246 Ga0105241_10663085 3300009174 Unclassified 949
247 Ga0105242_10027897 3300009176 Unclassified 4488
248 Ga0105248_10032016 3300009177 Bacteria 5875
249 Ga0105248_10211766 3300009177 Bacteria 2184
250 Ga0105248_10458662 3300009177 Bacteria 1437
251 Ga0105248_11016351 3300009177 Bacteria 937
252 Ga0105237_10057434 3300009545 Archaea 3895
253 Ga0105237_10160139 3300009545 Bacteria 2249
254 Ga0105237_10612804 3300009545 Bacteria 1095
255 Ga0105237_10630788 3300009545 Bacteria 1079
256 Ga0105237_10885256 3300009545 Unclassified 900
257 Ga0105238_10018583 3300009551 Bacteria 7077
258 Ga0105238_10359194 3300009551 Bacteria 1446
259 Ga0105238_11846708 3300009551 Bacteria 637
260 Ga0105249_10739566 3300009553 Bacteria 1045
261 Ga0105249_11274596 3300009553 Archaea 806
262 Ga0099796_10067884 3300010159 Bacteria 1280
263 Ga0099796_10119247 3300010159 Unclassified 1012
264 Ga0099796_10183356 3300010159 Unclassified 841
265 Ga0105239_10040210 3300010375 Unclassified 5124
266 Ga0105239_10092433 3300010375 Archaea 3340
267 Ga0105239_10306154 3300010375 Bacteria 1790
268 Ga0105239_11504457 3300010375 Bacteria 778
269 Ga0105246_10060091 3300011119 Archaea 2639
270 Ga0105246_10167261 3300011119 Bacteria 1681
271 Ga0105246_10274266 3300011119 Archaea 1350
272 Ga0157373_10078281 3300013100 Bacteria 2331
273 Ga0157373_10221629 3300013100 Bacteria 1334
274 Ga0157373_10944312 3300013100 Archaea 641
275 Ga0157371_10037056 3300013102 Bacteria 3492
276 Ga0157371_10046956 3300013102 Bacteria 3069
277 Ga0157369_10085753 3300013105 Bacteria 3365
278 Ga0157369_10188164 3300013105 Bacteria 2170
279 Ga0157374_10007231 3300013296 Bacteria 9459
280 Ga0157374_10028723 3300013296 Unclassified 5027
281 Ga0157374_10039944 3300013296 Bacteria 4320
282 Ga0157374_10050799 3300013296 Bacteria 3855
283 Ga0157374_10085170 3300013296 Archaea 3005
284 Ga0157374_10088846 3300013296 Bacteria 2943
285 Ga0157374_10093305 3300013296 Bacteria 2874
286 Ga0157374_10346029 3300013296 Bacteria 1476
287 Ga0157378_10011348 3300013297 Bacteria 7797
288 Ga0157378_10052697 3300013297 Unclassified 3620
289 Ga0157378_10134316 3300013297 Archaea 2293
290 Ga0157378_10199741 3300013297 Bacteria 1891
291 Ga0157378_10683734 3300013297 Unclassified 1044
292 Ga0163162_10001635 3300013306 Bacteria 20984
293 Ga0163162_10124527 3300013306 Bacteria 2683
294 Ga0163162_10271830 3300013306 Bacteria 1826
295 Ga0163162_11979129 3300013306 Archaea 668
296 Ga0157372_10109108 3300013307 Bacteria 3169
297 Ga0157372_10112680 3300013307 Bacteria 3117
298 Ga0157372_10135585 3300013307 Archaea 2835
299 Ga0157372_10210398 3300013307 Bacteria 2254
300 Ga0157372_10345801 3300013307 Bacteria 1733
301 Ga0157372_10502394 3300013307 Bacteria 1414
302 Ga0157372_10880430 3300013307 Archaea 1039
303 Ga0157372_10971262 3300013307 Bacteria 984
304 Ga0157372_11309291 3300013307 Bacteria 836
305 Ga0163163_10079119 3300014325 Bacteria 3285
306 Ga0163163_10146575 3300014325 Bacteria 2405
307 Ga0163163_10155181 3300014325 Bacteria 2334
308 Ga0163163_10810650 3300014325 Archaea 1000
309 Ga0157377_10002122 3300014745 Archaea 8719
310 Ga0157379_10004637 3300014968 Bacteria 11793
311 Ga0157379_10093978 3300014968 Bacteria 2690
312 Ga0157379_10908124 3300014968 Bacteria 836
313 Ga0157376_10024469 3300014969 Unclassified 4742
314 Ga0157376_10025905 3300014969 Unclassified 4626
315 Ga0157376_10053378 3300014969 Bacteria 3365
316 Ga0157376_10112962 3300014969 Archaea 2394
317 Ga0197907_10832762 3300020069 Unclassified 610
318 Ga0206356_11194441 3300020070 Bacteria 933
319 Ga0206351_10705491 3300020077 Unclassified 853
320 Ga0206350_11657814 3300020080 Bacteria 531
321 Ga0206353_10440949 3300020082 Bacteria 1075
322 Ga0206353_10937821 3300020082 Unclassified 550
323 Ga0206353_11706557 3300020082 Bacteria 1076
324 Ga0154015_1053231 3300020610 Unclassified 692
325 Ga0224712_10129166 3300022467 Archaea 1102
326 Ga0224712_10207342 3300022467 Bacteria 893
327 Ga0207656_10091024 3300025321 Bacteria 1384
328 Ga0207692_10005665 3300025898 Bacteria 5014
329 Ga0207692_10006364 3300025898 Bacteria 4785
330 Ga0207692_10055241 3300025898 Archaea 2032
331 Ga0207692_10084045 3300025898 Bacteria 1709
332 Ga0207642_10024444 3300025899 Bacteria 2428
333 Ga0207688_10050656 3300025901 Archaea 2325
334 Ga0207647_10181781 3300025904 Bacteria 1221
335 Ga0207647_10311862 3300025904 Bacteria 894
336 Ga0207685_10000800 3300025905 Archaea 5824
337 Ga0207685_10000925 3300025905 Bacteria 5603
338 Ga0207685_10049133 3300025905 Bacteria 1619
339 Ga0207685_10097341 3300025905 Unclassified 1251
340 Ga0207699_10032595 3300025906 Bacteria 2936
341 Ga0207699_10042188 3300025906 Bacteria 2641
342 Ga0207699_10075907 3300025906 Archaea 2069
343 Ga0207699_10088434 3300025906 Unclassified 1939
344 Ga0207699_10133489 3300025906 Bacteria 1623
345 Ga0207699_10149465 3300025906 Bacteria 1544
346 Ga0207699_10219769 3300025906 Bacteria 1296
347 Ga0207699_10493593 3300025906 Bacteria 883
348 Ga0207643_10341944 3300025908 Bacteria 938
349 Ga0207705_10022018 3300025909 Bacteria 4548
350 Ga0207705_10223396 3300025909 Bacteria 1431
351 Ga0207684_10084019 3300025910 Bacteria 2711
352 Ga0207654_10003747 3300025911 Bacteria 7669
353 Ga0207654_10094964 3300025911 Unclassified 1826
354 Ga0207654_10794170 3300025911 Unclassified 683
355 Ga0207707_10084310 3300025912 Bacteria 2775
356 Ga0207707_10137612 3300025912 Bacteria 2135
357 Ga0207707_10458667 3300025912 Bacteria 1090
358 Ga0207695_10017452 3300025913 Bacteria 8353
359 Ga0207695_10031574 3300025913 Bacteria 5806
360 Ga0207695_10113933 3300025913 Bacteria 2680
361 Ga0207695_10238491 3300025913 Bacteria 1720
362 Ga0207695_10646052 3300025913 Bacteria 939
363 Ga0207671_10551161 3300025914 Archaea 919
364 Ga0207693_10000641 3300025915 Bacteria 31336
365 Ga0207693_10000840 3300025915 Archaea 27321
366 Ga0207693_10004312 3300025915 Bacteria 12042
367 Ga0207693_10064565 3300025915 Bacteria 2868
368 Ga0207693_10134770 3300025915 Bacteria 1942
369 Ga0207693_10201627 3300025915 Bacteria 1565
370 Ga0207693_10957805 3300025915 Unclassified 655
371 Ga0207663_10001396 3300025916 Archaea 11208
372 Ga0207663_10006640 3300025916 Bacteria 5944
373 Ga0207663_10016265 3300025916 Bacteria 4120
374 Ga0207663_10305417 3300025916 Bacteria 1190
375 Ga0207663_11318696 3300025916 Bacteria 581
376 Ga0207660_11120630 3300025917 Bacteria 641
377 Ga0207662_10323648 3300025918 Bacteria 1030
378 Ga0207657_10003949 3300025919 Bacteria 15741
379 Ga0207657_10009121 3300025919 Bacteria 10008
380 Ga0207649_10122174 3300025920 Bacteria 1757
381 Ga0207649_10339271 3300025920 Bacteria 1109
382 Ga0207652_10010856 3300025921 Bacteria 7341
383 Ga0207652_10156009 3300025921 Bacteria 2045
384 Ga0207652_10495562 3300025921 Bacteria 1100
385 Ga0207652_11151110 3300025921 Unclassified 677
386 Ga0207646_10103466 3300025922 Bacteria 2553
387 Ga0207646_10257176 3300025922 Bacteria 1578
388 Ga0207646_10440958 3300025922 Bacteria 1175
389 Ga0207646_10467163 3300025922 Unclassified 1138
390 Ga0207681_10172407 3300025923 Bacteria 1641
391 Ga0207694_10011431 3300025924 Bacteria 6699
392 Ga0207694_10061886 3300025924 Bacteria 2913
393 Ga0207694_10130767 3300025924 Bacteria 2012
394 Ga0207650_11306538 3300025925 Bacteria 617
395 Ga0207687_10001057 3300025927 Bacteria 18672
396 Ga0207687_10038769 3300025927 Bacteria 3258
397 Ga0207687_10479473 3300025927 Bacteria 1036
398 Ga0207700_10036653 3300025928 Bacteria 3545
399 Ga0207700_10096328 3300025928 Bacteria 2349
400 Ga0207700_10532868 3300025928 Unclassified 1041
401 Ga0207700_10563392 3300025928 Archaea 1012
402 Ga0207700_10663022 3300025928 Bacteria 930
403 Ga0207700_10806324 3300025928 Bacteria 840
404 Ga0207700_10913845 3300025928 Bacteria 785
405 Ga0207664_10015153 3300025929 Bacteria 5587
406 Ga0207664_10137375 3300025929 Bacteria 2064
407 Ga0207664_10277504 3300025929 Unclassified 1470
408 Ga0207664_10387273 3300025929 Bacteria 1242
409 Ga0207664_10412646 3300025929 Unclassified 1202
410 Ga0207664_11257599 3300025929 Unclassified 659
411 Ga0207644_10210878 3300025931 Bacteria 1536
412 Ga0207644_10225296 3300025931 Bacteria 1488
413 Ga0207690_10044683 3300025932 Bacteria 2922
414 Ga0207706_10000453 3300025933 Bacteria 43644
415 Ga0207686_10003905 3300025934 Bacteria 7994
416 Ga0207686_11795087 3300025934 Bacteria 508
417 Ga0207704_11017069 3300025938 Unclassified 701
418 Ga0207665_10000023 3300025939 Bacteria 104745
419 Ga0207665_10000070 3300025939 Bacteria 66142
420 Ga0207665_10000165 3300025939 Archaea 44731
421 Ga0207665_10086172 3300025939 Bacteria 2169
422 Ga0207665_10088453 3300025939 Bacteria 2143
423 Ga0207665_10099243 3300025939 Bacteria 2030
424 Ga0207665_10381617 3300025939 Unclassified 1070
425 Ga0207665_10527790 3300025939 Bacteria 915
426 Ga0207665_10569268 3300025939 Unclassified 882
427 Ga0207665_10726094 3300025939 Archaea 782
428 Ga0207665_11251465 3300025939 Bacteria 592
429 Ga0207711_10001089 3300025941 Bacteria 25934
430 Ga0207711_10668643 3300025941 Bacteria 969
431 Ga0207711_11485722 3300025941 Unclassified 621
432 Ga0207689_10055820 3300025942 Bacteria 3250
433 Ga0207661_10220956 3300025944 Bacteria 1674
434 Ga0207661_11096679 3300025944 Bacteria 733
435 Ga0207679_10182706 3300025945 Archaea 1736
436 Ga0207667_10003730 3300025949 Bacteria 18793
437 Ga0207667_10003812 3300025949 Bacteria 18542
438 Ga0207667_10019070 3300025949 Bacteria 7668
439 Ga0207667_10175029 3300025949 Bacteria 2205
440 Ga0207667_10789029 3300025949 Bacteria 947
441 Ga0207651_10198772 3300025960 Archaea 1605
442 Ga0207712_10436409 3300025961 Bacteria 1108
443 Ga0207668_10253179 3300025972 Bacteria 1431
444 Ga0207640_10047733 3300025981 Bacteria 2764
445 Ga0207658_10432027 3300025986 Bacteria 1163
446 Ga0207677_10133912 3300026023 Bacteria 1886
447 Ga0207677_10183708 3300026023 Bacteria 1647
448 Ga0207677_10231400 3300026023 Bacteria 1489
449 Ga0207703_10072323 3300026035 Unclassified 2850
450 Ga0207639_10598754 3300026041 Bacteria 1016
451 Ga0207678_10004185 3300026067 Bacteria 12948
452 Ga0207678_10547856 3300026067 Unclassified 1011
453 Ga0207708_10399526 3300026075 Archaea 1136
454 Ga0207708_10475866 3300026075 Bacteria 1044
455 Ga0207708_10789084 3300026075 Archaea 817
456 Ga0207702_10022916 3300026078 Bacteria 5181
457 Ga0207702_10081538 3300026078 Bacteria 2810
458 Ga0207702_10110618 3300026078 Unclassified 2442
459 Ga0207702_10298196 3300026078 Archaea 1529
460 Ga0207702_10961798 3300026078 Unclassified 847
461 Ga0207641_10207834 3300026088 Bacteria 1809
462 Ga0207641_10228433 3300026088 Bacteria 1729
463 Ga0207641_10305540 3300026088 Unclassified 1504
464 Ga0207648_10380476 3300026089 Bacteria 1276
465 Ga0207676_10223139 3300026095 Bacteria 1680
466 Ga0207674_10019835 3300026116 Bacteria 7275
467 Ga0207674_10050891 3300026116 Bacteria 4230
468 Ga0207674_10065527 3300026116 Bacteria 3661
469 Ga0207675_100071418 3300026118 Bacteria 3246
470 Ga0207683_10250783 3300026121 Bacteria 1615
471 Ga0207683_10270541 3300026121 Bacteria 1552
472 Ga0207683_11115429 3300026121 Archaea 732
473 Ga0207698_10028478 3300026142 Bacteria 3983
474 Ga0207698_10581492 3300026142 Bacteria 1102
475 Ga0209179_1044044 3300027512 Bacteria 944
476 Ga0209588_1006414 3300027671 Bacteria 3418
477 Ga0209588_1009590 3300027671 Bacteria 2897
478 Ga0209588_1019515 3300027671 Bacteria 2116
479 Ga0209588_1023246 3300027671 Bacteria 1953
480 Ga0209588_1034351 3300027671 Bacteria 1628
481 Ga0209588_1062092 3300027671 Bacteria 1208
482 Ga0265354_1001313 3300028016 Bacteria 3653
483 Ga0268266_10022744 3300028379 Bacteria 5336
484 Ga0268266_10420944 3300028379 Bacteria 1266
485 Ga0268265_10069931 3300028380 Bacteria 2728
486 Ga0268265_12046101 3300028380 Archaea 580
487 Ga0268264_10090198 3300028381 Bacteria 2641
488 Ga0265319_1000381 3300028563 Bacteria 32150
489 Ga0265334_10102292 3300028573 Bacteria 1036
490 Ga0265318_10000122 3300028577 Bacteria 71971
491 Ga0265338_10008201 3300028800 Bacteria 12730
492 Ga0265338_10081813 3300028800 Unclassified 2706
493 Ga0265338_10292649 3300028800 Bacteria 1186
494 Ga0265338_10578229 3300028800 Bacteria 784
495 Ga0265338_10634956 3300028800 Bacteria 741
496 Ga0265324_10008096 3300029957 Bacteria 4209
497 Ga0265765_1011845 3300030879 Unclassified 983
498 Ga0265760_10000587 3300031090 Bacteria 10352
499 Ga0265760_10004556 3300031090 Bacteria 3971
500 Ga0265330_10324287 3300031235 Archaea 650
501 Ga0265332_10017955 3300031238 Bacteria 3118
502 Ga0265328_10046882 3300031239 Bacteria 1588
503 Ga0265328_10123125 3300031239 Unclassified 968
504 Ga0265320_10000019 3300031240 Bacteria 183346
505 Ga0265320_10005189 3300031240 Bacteria 8403
506 Ga0265325_10010131 3300031241 Bacteria 5472
507 Ga0265325_10032682 3300031241 Bacteria 2776
508 Ga0265329_10016668 3300031242 Bacteria 2542
509 Ga0265340_10001198 3300031247 Bacteria 14820
510 Ga0265340_10017650 3300031247 Bacteria 3691
511 Ga0265339_10005425 3300031249 Bacteria 8498
512 Ga0265339_10177150 3300031249 Bacteria 1064
513 Ga0265331_10000028 3300031250 Bacteria 216539
514 Ga0265331_10034309 3300031250 Bacteria 2503
515 Ga0265316_10000092 3300031344 Bacteria 96395
516 Ga0265316_10015189 3300031344 Bacteria 6744
517 Ga0265316_10279695 3300031344 Archaea 1219
518 Ga0265313_10000704 3300031595 Bacteria 34513
519 Ga0265314_10001078 3300031711 Bacteria 31616
520 Ga0265314_10103444 3300031711 Bacteria 1825
521 Ga0265342_10000074 3300031712 Bacteria 106584
522 Ga0265342_10026968 3300031712 Bacteria 3597
523 Ga0316212_1005673 3300033547 Bacteria 1813
524 Ga0373926_0003238 3300035083 Bacteria 5229
525 Ga0373934_0001267 3300035086 Bacteria 9199
526 Ga0373940_0078332 3300035088 Bacteria 973
527 Ga0373949_0019963 3300035090 Bacteria 1531
528 Ga0373923_0034212 3300035111 Unclassified 2061
529 Ga0373923_0097633 3300035111 Bacteria 1292
530 Ga0373932_0007205 3300035112 Bacteria 2644
531 Ga0373945_0439726 3300035116 Bacteria 576
532 Ga0373953_0011074 3300035117 Bacteria 3153
533 Ga0373953_0100531 3300035117 Bacteria 1217
534 Ga0373954_0021320 3300035118 Bacteria 2933
535 Ga0373954_0067503 3300035118 Bacteria 1695
536 Ga0373956_0002782 3300035119 Bacteria 7078
537 Ga0373956_0080077 3300035119 Bacteria 1498
538 Ga0373957_0000896 3300035120 Bacteria 7798
539 Ga0373957_0006227 3300035120 Bacteria 3750
540 Ga0373946_0246327 3300035171 Bacteria 870
541 Ga0373955_0003110 3300035172 Bacteria 7264
542 Ga0373955_0023616 3300035172 Bacteria 3134
543 Ga0373955_0169132 3300035172 Bacteria 1293
544 Ga0373955_0478521 3300035172 Bacteria 760
545 Ga0373942_0064472 3300035207 Bacteria 1057
546 Ga0373962_0065782 3300035242 Bacteria 1074
547 Ga0373924_0005123 3300035410 Bacteria 4624
548 Ga0373924_0059012 3300035410 Bacteria 1602
549 Ga0373931_0010418 3300035691 Bacteria 4467
550 Ga0373931_0017906 3300035691 Bacteria 3513
551 Ga0373931_0163703 3300035691 Bacteria 1306
552 Ga0373935_0149887 3300035692 Bacteria 1582
553 Ga0373935_0158750 3300035692 Bacteria 1540
554 Ga0373935_0429528 3300035692 Unclassified 952
555 Ga0373927_0004163 3300035695 Bacteria 10166
556 Ga0373927_0264965 3300035695 Bacteria 1130
557 Ga0373927_0505577 3300035695 Bacteria 798
558 Ga0373933_0000455 3300035724 Bacteria 25629
559 Ga0373933_0031828 3300035724 Bacteria 3062
560 Ga0373933_0038036 3300035724 Bacteria 2826
561 Ga0373947_0054938 3300035725 Bacteria 2404
562 Ga0373937_0000295 3300036401 Bacteria 47485
563 Ga0373937_0004388 3300036401 Bacteria 11985
564 Ga0373937_0032363 3300036401 Bacteria 4743
565 Ga0373937_0072886 3300036401 Bacteria 3168
566 Ga0373937_0090692 3300036401 Bacteria 2831
567 Ga0373937_0123148 3300036401 Bacteria 2417
568 Ga0373937_1093611 3300036401 Unclassified 746
569 Ga0373925_0006382 3300037068 Bacteria 8680
570 Ga0373925_0009371 3300037068 Bacteria 7129
571 Ga0373925_0419905 3300037068 Unclassified 1093
572 Ga0373925_0978822 3300037068 Bacteria 697
573 Ga0395900_0153711 3300037418 Unclassified 2351
574 Ga0395900_1189509 3300037418 Unclassified 678
575 Ga0395898_0537456 3300037466 Bacteria 1111
576 Ga0395905_0003190 3300037471 Bacteria 17657
577 Ga0395905_0024237 3300037471 Bacteria 5727
578 Ga0395905_0053413 3300037471 Bacteria 3782
579 Ga0395905_0144396 3300037471 Bacteria 2239
580 Ga0395905_0201444 3300037471 Unclassified 1866
581 Ga0436365_0750763 3300039437 Archaea 2235
582 Ga0436362_0237415 3300039453 Archaea 1292
583 Ga0436362_1001194 3300039453 Archaea 1059
584 Ga0451807_1347082 3300041486 Archaea 715
585 Ga0451853_0014154 3300041512 Bacteria 624
586 Ga0451853_3248563 3300041512 Archaea 730
587 Ga0439440_0048652 3300042993 Archaea 1054
588 Ga0466965_0011543 3300044683 Bacteria 4144
589 Ga0466966_0065885 3300044684 Bacteria 2277
590 Ga0466966_0325026 3300044684 Bacteria 924
591 Ga0466961_0185034 3300044693 Bacteria 1292
592 Ga0466963_0001316 3300044694 Bacteria 13211
593 Ga0466963_0001335 3300044694 Bacteria 13143
594 Ga0466963_0002214 3300044694 Bacteria 10755
595 Ga0466964_0018933 3300044706 Bacteria 2644
596 Ga0453684_0055223 3300044712 Bacteria 5165
597 Ga0453684_0478561 3300044712 Bacteria 1382
598 Ga0466971_0008187 3300044719 Bacteria 4558
599 Ga0466968_0022528 3300044735 Bacteria 2560
600 Ga0466970_0106017 3300044765 Bacteria 1533
601 Ga0466957_0010749 3300044842 Bacteria 5262
602 Ga0466959_0015015 3300045049 Bacteria 5643
603 Ga0466959_0399516 3300045049 Bacteria 934
604 Ga0451576_0793167 3300045051 Unclassified 995
605 Ga0451576_0867947 3300045051 Bacteria 947
606 Ga0466958_0017348 3300045836 Bacteria 4158
607 Ga0466958_0019864 3300045836 Bacteria 3913
608 Ga0466958_0031451 3300045836 Bacteria 3154
609 Ga0466967_0007111 3300045976 Bacteria 8031
610 Ga0466967_0014447 3300045976 Bacteria 6151
611 Ga0466967_0050968 3300045976 Archaea 3626
612 Ga0466967_0072421 3300045976 Bacteria 3088
613 Ga0466967_0144512 3300045976 Bacteria 2218
614 Ga0466967_0969113 3300045976 Bacteria 846
615 Ga0466967_1493808 3300045976 Archaea 673
616 Ga0495592_0000660 3300046454 Bacteria 23996
617 Ga0495592_0094927 3300046454 Bacteria 2134
618 Ga0495603_0014192 3300046455 Bacteria 4820
619 Ga0495629_0555727 3300046459 Bacteria 770
620 Ga0495651_0000034 3300046462 Bacteria 99213
621 Ga0495651_0073282 3300046462 Bacteria 2600
622 Ga0495653_0004267 3300046463 Bacteria 11577
623 Ga0495580_0022382 3300046472 Bacteria 4651
624 Ga0495580_0110380 3300046472 Bacteria 1910
625 Ga0495580_0345113 3300046472 Bacteria 1009
626 Ga0495582_0150599 3300046473 Bacteria 1321
627 Ga0495664_0344273 3300046477 Unclassified 898
628 Ga0495608_0003358 3300046511 Bacteria 11447
629 Ga0495608_0079786 3300046511 Bacteria 2128
630 Ga0495618_0002980 3300046514 Bacteria 10705
631 Ga0495628_0000184 3300046516 Bacteria 54832
632 Ga0495628_0601697 3300046516 Bacteria 785
633 Ga0495630_0015742 3300046517 Bacteria 5526
634 Ga0495666_0201883 3300046526 Unclassified 914
635 Ga0495652_0000319 3300046529 Bacteria 56845
636 Ga0495652_0201026 3300046529 Bacteria 1512
637 Ga0495652_0233966 3300046529 Bacteria 1372
638 Ga0495587_0001086 3300046536 Bacteria 17851
639 Ga0495645_0000646 3300046543 Bacteria 24016
640 Ga0495667_0120713 3300046559 Bacteria 1692
641 Ga0495667_0603079 3300046559 Unclassified 684
642 Ga0495635_0817037 3300046663 Bacteria 600
643 Ga0495659_0365428 3300046664 Bacteria 618
644 Ga0495657_0081837 3300046675 Bacteria 2087
645 Ga0495657_0485909 3300046675 Unclassified 721
646 Ga0495599_0000227 3300046678 Bacteria 35652
647 Ga0495623_0000601 3300046679 Bacteria 23980
648 Ga0495623_0005574 3300046679 Bacteria 8219
649 Ga0495646_0005450 3300046680 Bacteria 8044
650 Ga0495669_0007936 3300046684 Bacteria 4455
651 Ga0495613_0278019 3300046689 Unclassified 1163
652 Ga0495600_0090026 3300046809 Bacteria 2001
653 Ga0495600_0571130 3300046809 Bacteria 689
654 Ga0495581_0778207 3300047315 Bacteria 550
655 Ga0495604_0000194 3300047317 Bacteria 54877
656 Ga0495604_0001995 3300047317 Bacteria 16484
657 Ga0495676_0380968 3300047321 Bacteria 938
658 Ga0495680_0075073 3300047322 Bacteria 2565
659 Ga0495680_0224598 3300047322 Unclassified 1339
660 Ga0495675_0000224 3300047444 Bacteria 40977
661 Ga0495675_0295202 3300047444 Bacteria 964
662 Ga0495675_0328183 3300047444 Unclassified 904
663 Ga0495684_0016417 3300047471 Bacteria 5702
664 Ga0495602_0012995 3300048088 Bacteria 8522
665 Ga0496100_0004406 3300048903 Bacteria 7460
666 Ga0496100_0036671 3300048903 Bacteria 3095
667 Ga0496100_0147462 3300048903 Bacteria 1675
668 Ga0496100_0286169 3300048903 Bacteria 1230
669 Ga0496100_0480195 3300048903 Bacteria 956
670 Ga0496101_0013017 3300048904 Bacteria 5567
671 Ga0496101_0022295 3300048904 Bacteria 4358
672 Ga0496101_0115956 3300048904 Bacteria 2021
673 Ga0496101_0132215 3300048904 Bacteria 1895
674 Ga0496101_0196216 3300048904 Bacteria 1559
675 Ga0496101_0600043 3300048904 Archaea 870
676 Ga0496101_1222961 3300048904 Unclassified 588
677 Ga0496102_0004103 3300048905 Bacteria 12350
678 Ga0496102_0014233 3300048905 Bacteria 6912
679 Ga0496102_0143449 3300048905 Bacteria 2240
680 Ga0496102_0222213 3300048905 Bacteria 1781
681 Ga0496102_0595682 3300048905 Archaea 1028
682 Ga0496102_0928993 3300048905 Unclassified 791
683 Ga0496102_1325429 3300048905 Unclassified 639
684 Ga0496103_0006986 3300048906 Bacteria 6736
685 Ga0496103_0011172 3300048906 Bacteria 5316
686 Ga0496103_0242804 3300048906 Bacteria 1159
687 Ga0496104_0019777 3300048907 Bacteria 6165
688 Ga0496104_0061403 3300048907 Bacteria 3563
689 Ga0496104_0085853 3300048907 Bacteria 3004
690 Ga0496104_0108917 3300048907 Bacteria 2655
691 Ga0496104_0311936 3300048907 Archaea 1486
692 Ga0496105_0067458 3300048908 Bacteria 2954
693 Ga0496105_0128936 3300048908 Bacteria 2086
694 Ga0496105_0199675 3300048908 Bacteria 1632
695 Ga0496105_0211814 3300048908 Bacteria 1579
696 Ga0496105_0224977 3300048908 Bacteria 1526
697 Ga0496106_0046673 3300048909 Bacteria 3257
698 Ga0496106_0084845 3300048909 Archaea 2437
699 Ga0496106_0147127 3300048909 Bacteria 1856
700 Ga0496106_0523516 3300048909 Bacteria 952
701 Ga0496106_0774339 3300048909 Bacteria 762
702 Ga0496106_0778398 3300048909 Bacteria 760
703 Ga0496107_0020569 3300048910 Bacteria 4663
704 Ga0496107_0078783 3300048910 Bacteria 2401
705 Ga0496107_0140290 3300048910 Archaea 1786
706 Ga0496107_0144185 3300048910 Bacteria 1760
707 Ga0496108_0022133 3300048911 Bacteria 5226
708 Ga0496108_0035225 3300048911 Bacteria 4160
709 Ga0496108_0052345 3300048911 Bacteria 3421
710 Ga0496108_0207838 3300048911 Unclassified 1699
711 Ga0496108_0370388 3300048911 Archaea 1250
712 Ga0496108_0376802 3300048911 Unclassified 1239
713 Ga0496109_0037958 3300048912 Bacteria 4353
714 Ga0496109_0272586 3300048912 Bacteria 1594
715 Ga0496109_0452597 3300048912 Archaea 1212
716 Ga0496110_0003719 3300048913 Bacteria 11747
717 Ga0496110_0037510 3300048913 Archaea 4213
718 Ga0496110_0179438 3300048913 Bacteria 1923
719 Ga0496110_0551303 3300048913 Bacteria 1048
720 Ga0496111_0167635 3300048914 Bacteria 1631
721 Ga0496111_0295693 3300048914 Archaea 1200
722 Ga0496111_0491754 3300048914 Bacteria 903
723 Ga0496112_0124975 3300048915 Bacteria 2543
724 Ga0496112_0143342 3300048915 Bacteria 2358
725 Ga0496112_0144268 3300048915 Bacteria 2349
726 Ga0496112_0255007 3300048915 Archaea 1704
727 Ga0496112_0255792 3300048915 Bacteria 1701
728 Ga0496112_0758390 3300048915 Bacteria 896
729 Ga0496113_0115857 3300048916 Bacteria 2091
730 Ga0496113_0195875 3300048916 Bacteria 1605
731 Ga0496113_0206506 3300048916 Archaea 1562
732 Ga0496113_0334961 3300048916 Bacteria 1213
733 Ga0496114_0042955 3300048917 Bacteria 3748
734 Ga0496115_0017927 3300048918 Bacteria 5424
735 Ga0496115_0038437 3300048918 Bacteria 3797
736 Ga0496115_0045147 3300048918 Bacteria 3517
737 Ga0496115_0409993 3300048918 Archaea 1099
738 Ga0501036_0865132 3300049572 Bacteria 743
739 Ga0501046_0790438 3300049580 Bacteria 665
740 Ga0501072_0138317 3300049588 Bacteria 1942
741 Ga0501075_0286559 3300049591 Bacteria 1255
742 Ga0501075_0926342 3300049591 Bacteria 662
743 Ga0501076_0428344 3300049592 Bacteria 1089
744 nmdc:mga05p37_139435_c1 3300050507 Bacteria 2971
745 nmdc:mga06r32_975193_c1 3300050510 Unclassified 801
746 nmdc:mga0n895_34538_c1 3300050512 Archaea 4869
747 nmdc:mga0n895_66757_c1 3300050512 Bacteria 3561
748 nmdc:mga0rr50_97362_c1 3300050513 Archaea 2304
749 nmdc:mga08x19_139743_c1 3300050514 Bacteria 1635
750 nmdc:mga08x19_15441_c1 3300050514 Bacteria 4648
751 nmdc:mga08x19_38240_c1 3300050514 Bacteria 3048
752 nmdc:mga08x19_44619_c1 3300050514 Bacteria 2831
753 nmdc:mga08x19_53274_c1 3300050514 Bacteria 2603
754 nmdc:mga08x19_589378_c1 3300050514 Archaea 788
755 nmdc:mga08x19_822207_c1 3300050514 Unclassified 660
756 nmdc:mga0a205_154661_c1 3300050515 Archaea 2192
757 Ga0495601_0017330 3300053077 Bacteria 4370
758 Ga0495601_0227072 3300053077 Bacteria 1220
759 Ga0495619_0000370 3300053085 Bacteria 30945
760 Ga0495619_0192485 3300053085 Archaea 1412
761 Ga0495619_0303655 3300053085 Bacteria 1105
762 Ga0495619_0359728 3300053085 Bacteria 1006
763 Ga0495619_0506868 3300053085 Archaea 830
764 Ga0501084_1186743 3300054114 Bacteria 640
765 Ga0587066_161527 3300059490 Archaea 563
766 Ga0501082_0888618 3300060353 Bacteria 779
767 Ga0466962_0001870 3300061719 Bacteria 9903
768 Ga0436365_0310335
769 JGI24033J26618_1032948
770 Ga0070658_10013444
771 Ga0070658_10897185
772 Ga0070676_10051832
773 Ga0070683_100016775
774 Ga0070683_100051686
775 Ga0070683_100133775
776 Ga0070683_100225728
777 Ga0070683_100434268
778 Ga0070683_100659101
779 Ga0070690_100537076
780 Ga0068869_100038772
781 Ga0070666_10051710
782 Ga0070680_100078407
783 Ga0070680_100092271
784 Ga0070680_100262362
785 Ga0070682_100019856
786 Ga0070682_100049964
787 Ga0070682_100111393
788 Ga0070682_100124898
789 Ga0070682_100295432
790 Ga0068868_100006294
791 Ga0068868_100017727
792 Ga0068868_100399438
793 Ga0070660_100009784
794 Ga0070660_100245640
795 Ga0070689_100098104
796 Ga0070691_10057326
797 Ga0070687_100202760
798 Ga0070661_100050686
799 Ga0070661_100428369
800 Ga0070692_10083349
801 Ga0070668_100231506
802 Ga0070668_101385213
803 Ga0070669_100007218
804 Ga0070671_100184565
805 Ga0070674_100058120
806 Ga0070674_100186230
807 Ga0070673_100070518
808 Ga0070659_100300542
809 Ga0070667_100034629
810 Ga0070667_101459169
811 Ga0070703_10205730
812 Ga0070709_10004401
813 Ga0070709_10017111
814 Ga0070709_10145762
815 Ga0070709_10179188
816 Ga0070709_10188247
817 Ga0070709_10473735
818 Ga0070714_100009938
819 Ga0070714_100039672
820 Ga0070714_100148523
821 Ga0070713_100007160
822 Ga0070713_100077452
823 Ga0070713_100082949
824 Ga0070713_100257797
825 Ga0070713_100390382
826 Ga0070713_100561360
827 Ga0070713_101353441
828 Ga0070710_10001797
829 Ga0070710_10012639
830 Ga0070710_10039964
831 Ga0070710_10248683
832 Ga0070711_100016245
833 Ga0070711_100109703
834 Ga0070711_100129657
835 Ga0070711_100137536
836 Ga0070711_100673167
837 Ga0070711_100726359
838 Ga0070705_100098265
839 Ga0070705_100227615
840 Ga0070700_100124236
841 Ga0070694_100460987
842 Ga0070708_100510204
843 Ga0070708_100791626
844 Ga0070708_100893309
845 Ga0070663_100060124
846 Ga0070663_100677215
847 Ga0070678_101257214
848 Ga0070662_100019825
849 Ga0070681_10027598
850 Ga0070681_10091723
851 Ga0070681_10120931
852 Ga0070681_10177307
853 Ga0070681_11775861
854 Ga0070685_10149012
855 Ga0070685_10353633
856 Ga0070706_100312785
857 Ga0070706_100619271
858 Ga0070707_100133222
859 Ga0070707_100300160
860 Ga0070707_100380643
861 Ga0070707_100522388
862 Ga0070707_100581713
863 Ga0070698_100406406
864 Ga0070699_100065636
865 Ga0070699_100277788
866 Ga0070699_100309138
867 Ga0070699_100542561
868 Ga0070699_100561606
869 Ga0070699_100682211
870 Ga0070699_100739883
871 Ga0070679_100029793
872 Ga0070679_101288323
873 Ga0070684_100046061
874 Ga0070684_100059096
875 Ga0070684_100217167
876 Ga0070684_100561422
877 Ga0070684_101464473
878 Ga0070697_100015470
879 Ga0070697_100017017
880 Ga0070697_100101865
881 Ga0070697_100155039
882 Ga0070697_100468204
883 Ga0070697_100583057
884 Ga0070697_100787073
885 Ga0068853_100054583
886 Ga0070686_100027902
887 Ga0070686_100284373
888 Ga0070686_100407745
889 Ga0070695_100000042
890 Ga0070695_100052699
891 Ga0070695_100055585
892 Ga0070695_100309343
893 Ga0070695_100373555
894 Ga0070696_100012150
895 Ga0070696_100122538
896 Ga0070696_100252376
897 Ga0070696_100363848
898 Ga0070693_100005365
899 Ga0070693_100207534
900 Ga0070693_100212588
901 Ga0070693_100220365
902 Ga0070665_100104981
903 Ga0070704_100034939
904 Ga0070704_100160360
905 Ga0068855_100055958
906 Ga0068855_100217837
907 Ga0068855_101548325
908 Ga0068855_101947378
909 Ga0070664_100029524
910 Ga0068857_100025147
911 Ga0068857_100088478
912 Ga0068854_100019487
913 Ga0068854_101149503
914 Ga0068856_100018701
915 Ga0068856_100059428
916 Ga0070702_100024100
917 Ga0070702_100064385
918 Ga0068852_100209925
919 Ga0068852_100333691
920 Ga0068859_100304355
921 Ga0068859_101125403
922 Ga0068866_10037982
923 Ga0068861_100368030
924 Ga0068863_100083643
925 Ga0068863_100122571
926 Ga0068863_100231718
927 Ga0068858_100179676
928 Ga0068860_100972496
929 Ga0081538_10020293
930 Ga0070717_10023544
931 Ga0070717_10177241
932 Ga0070717_10411328
933 Ga0070717_10474258
934 Ga0070717_10561452
935 Ga0070717_10650556
936 Ga0070715_10000189
937 Ga0070715_10001967
938 Ga0070715_10073544
939 Ga0070715_10095281
940 Ga0070715_10097002
941 Ga0070716_100000458
942 Ga0070716_100000478
943 Ga0070716_100000549
944 Ga0070716_100035177
945 Ga0070716_100065197
946 Ga0070716_100148800
947 Ga0070716_100295821
948 Ga0070716_100365073
949 Ga0070716_100676070
950 Ga0070712_100000159
951 Ga0070712_100101492
952 Ga0070712_100138100
953 Ga0070712_100329094
954 Ga0070712_100369052
955 Ga0070712_100651743
956 Ga0070712_100781958
957 Ga0070712_101000962
958 Ga0070712_101471285
959 Ga0097621_100014139
960 Ga0097621_100180535
961 Ga0097621_100257428
962 Ga0097621_100921836
963 Ga0068871_100020502
964 Ga0068871_100030520
965 Ga0068871_100144659
966 Ga0068871_100549739
967 Ga0075430_101339151
968 Ga0075431_100353120
969 Ga0075433_10080975
970 Ga0075434_100006798
971 Ga0068865_100239069
972 Ga0075436_100000175
973 Ga0075436_100001018
974 Ga0075436_100015369
975 Ga0075436_100041747
976 Ga0075436_100063022
977 Ga0075436_100085000
978 Ga0075436_100232856
979 Ga0097620_100304356
980 Ga0097620_101125131
981 Ga0075435_100340300
982 Ga0075435_100496887
983 Ga0099794_10011702
984 Ga0099794_10051278
985 Ga0099794_10052969
986 Ga0099794_10054389
987 Ga0099794_10068016
988 Ga0099794_10077494
989 Ga0099794_10091036
990 Ga0099794_10342964
991 Ga0099795_10046656
992 Ga0099795_10127250
993 Ga0099795_10147245
994 Ga0105240_10037326
995 Ga0105240_10227161
996 Ga0105240_10272536
997 Ga0105240_10418514
998 Ga0111539_10555113
999 Ga0105245_10016576
1000 Ga0105245_10070011
1001 Ga0105245_10162856
1002 Ga0105245_11162654
1003 Ga0105245_11200372
1004 Ga0105247_10153809
1005 Ga0114129_10369139
1006 Ga0105243_10156717
1007 Ga0105243_11181823
1008 Ga0105241_10029279
1009 Ga0105241_10035342
1010 Ga0105241_10039553
1011 Ga0105241_10076094
1012 Ga0105241_10196079
1013 Ga0105241_10663085
1014 Ga0105242_10027897
1015 Ga0105248_10032016
1016 Ga0105248_10211766
1017 Ga0105248_10458662
1018 Ga0105248_11016351
1019 Ga0105237_10057434
1020 Ga0105237_10160139
1021 Ga0105237_10612804
1022 Ga0105237_10630788
1023 Ga0105237_10885256
1024 Ga0105238_10018583
1025 Ga0105238_10359194
1026 Ga0105238_11846708
1027 Ga0105249_10739566
1028 Ga0105249_11274596
1029 Ga0099796_10067884
1030 Ga0099796_10119247
1031 Ga0099796_10183356
1032 Ga0105239_10040210
1033 Ga0105239_10092433
1034 Ga0105239_10306154
1035 Ga0105239_11504457
1036 Ga0105246_10060091
1037 Ga0105246_10167261
1038 Ga0105246_10274266
1039 Ga0157373_10078281
1040 Ga0157373_10221629
1041 Ga0157373_10944312
1042 Ga0157371_10037056
1043 Ga0157371_10046956
1044 Ga0157369_10085753
1045 Ga0157369_10188164
1046 Ga0157374_10007231
1047 Ga0157374_10028723
1048 Ga0157374_10039944
1049 Ga0157374_10050799
1050 Ga0157374_10085170
1051 Ga0157374_10088846
1052 Ga0157374_10093305
1053 Ga0157374_10346029
1054 Ga0157378_10011348
1055 Ga0157378_10052697
1056 Ga0157378_10134316
1057 Ga0157378_10199741
1058 Ga0157378_10683734
1059 Ga0163162_10001635
1060 Ga0163162_10124527
1061 Ga0163162_10271830
1062 Ga0163162_11979129
1063 Ga0157372_10109108
1064 Ga0157372_10112680
1065 Ga0157372_10135585
1066 Ga0157372_10210398
1067 Ga0157372_10345801
1068 Ga0157372_10502394
1069 Ga0157372_10880430
1070 Ga0157372_10971262
1071 Ga0157372_11309291
1072 Ga0163163_10079119
1073 Ga0163163_10146575
1074 Ga0163163_10155181
1075 Ga0163163_10810650
1076 Ga0157377_10002122
1077 Ga0157379_10004637
1078 Ga0157379_10093978
1079 Ga0157379_10908124
1080 Ga0157376_10024469
1081 Ga0157376_10025905
1082 Ga0157376_10053378
1083 Ga0157376_10112962
1084 Ga0197907_10832762
1085 Ga0206356_11194441
1086 Ga0206351_10705491
1087 Ga0206350_11657814
1088 Ga0206353_10440949
1089 Ga0206353_10937821
1090 Ga0206353_11706557
1091 Ga0154015_1053231
1092 Ga0224712_10129166
1093 Ga0224712_10207342
1094 Ga0207656_10091024
1095 Ga0207692_10005665
1096 Ga0207692_10006364
1097 Ga0207692_10055241
1098 Ga0207692_10084045
1099 Ga0207642_10024444
1100 Ga0207688_10050656
1101 Ga0207647_10181781
1102 Ga0207647_10311862
1103 Ga0207685_10000800
1104 Ga0207685_10000925
1105 Ga0207685_10049133
1106 Ga0207685_10097341
1107 Ga0207699_10032595
1108 Ga0207699_10042188
1109 Ga0207699_10075907
1110 Ga0207699_10088434
1111 Ga0207699_10133489
1112 Ga0207699_10149465
1113 Ga0207699_10219769
1114 Ga0207699_10493593
1115 Ga0207643_10341944
1116 Ga0207705_10022018
1117 Ga0207705_10223396
1118 Ga0207684_10084019
1119 Ga0207654_10003747
1120 Ga0207654_10094964
1121 Ga0207654_10794170
1122 Ga0207707_10084310
1123 Ga0207707_10137612
1124 Ga0207707_10458667
1125 Ga0207695_10017452
1126 Ga0207695_10031574
1127 Ga0207695_10113933
1128 Ga0207695_10238491
1129 Ga0207695_10646052
1130 Ga0207671_10551161
1131 Ga0207693_10000641
1132 Ga0207693_10000840
1133 Ga0207693_10004312
1134 Ga0207693_10064565
1135 Ga0207693_10134770
1136 Ga0207693_10201627
1137 Ga0207693_10957805
1138 Ga0207663_10001396
1139 Ga0207663_10006640
1140 Ga0207663_10016265
1141 Ga0207663_10305417
1142 Ga0207663_11318696
1143 Ga0207660_11120630
1144 Ga0207662_10323648
1145 Ga0207657_10003949
1146 Ga0207657_10009121
1147 Ga0207649_10122174
1148 Ga0207649_10339271
1149 Ga0207652_10010856
1150 Ga0207652_10156009
1151 Ga0207652_10495562
1152 Ga0207652_11151110
1153 Ga0207646_10103466
1154 Ga0207646_10257176
1155 Ga0207646_10440958
1156 Ga0207646_10467163
1157 Ga0207681_10172407
1158 Ga0207694_10011431
1159 Ga0207694_10061886
1160 Ga0207694_10130767
1161 Ga0207650_11306538
1162 Ga0207687_10001057
1163 Ga0207687_10038769
1164 Ga0207687_10479473
1165 Ga0207700_10036653
1166 Ga0207700_10096328
1167 Ga0207700_10532868
1168 Ga0207700_10563392
1169 Ga0207700_10663022
1170 Ga0207700_10806324
1171 Ga0207700_10913845
1172 Ga0207664_10015153
1173 Ga0207664_10137375
1174 Ga0207664_10277504
1175 Ga0207664_10387273
1176 Ga0207664_10412646
1177 Ga0207664_11257599
1178 Ga0207644_10210878
1179 Ga0207644_10225296
1180 Ga0207690_10044683
1181 Ga0207706_10000453
1182 Ga0207686_10003905
1183 Ga0207686_11795087
1184 Ga0207704_11017069
1185 Ga0207665_10000023
1186 Ga0207665_10000070
1187 Ga0207665_10000165
1188 Ga0207665_10086172
1189 Ga0207665_10088453
1190 Ga0207665_10099243
1191 Ga0207665_10381617
1192 Ga0207665_10527790
1193 Ga0207665_10569268
1194 Ga0207665_10726094
1195 Ga0207665_11251465
1196 Ga0207711_10001089
1197 Ga0207711_10668643
1198 Ga0207711_11485722
1199 Ga0207689_10055820
1200 Ga0207661_10220956
1201 Ga0207661_11096679
1202 Ga0207679_10182706
1203 Ga0207667_10003730
1204 Ga0207667_10003812
1205 Ga0207667_10019070
1206 Ga0207667_10175029
1207 Ga0207667_10789029
1208 Ga0207651_10198772
1209 Ga0207712_10436409
1210 Ga0207668_10253179
1211 Ga0207640_10047733
1212 Ga0207658_10432027
1213 Ga0207677_10133912
1214 Ga0207677_10183708
1215 Ga0207677_10231400
1216 Ga0207703_10072323
1217 Ga0207639_10598754
1218 Ga0207678_10004185
1219 Ga0207678_10547856
1220 Ga0207708_10399526
1221 Ga0207708_10475866
1222 Ga0207708_10789084
1223 Ga0207702_10022916
1224 Ga0207702_10081538
1225 Ga0207702_10110618
1226 Ga0207702_10298196
1227 Ga0207702_10961798
1228 Ga0207641_10207834
1229 Ga0207641_10228433
1230 Ga0207641_10305540
1231 Ga0207648_10380476
1232 Ga0207676_10223139
1233 Ga0207674_10019835
1234 Ga0207674_10050891
1235 Ga0207674_10065527
1236 Ga0207675_100071418
1237 Ga0207683_10250783
1238 Ga0207683_10270541
1239 Ga0207683_11115429
1240 Ga0207698_10028478
1241 Ga0207698_10581492
1242 Ga0209179_1044044
1243 Ga0209588_1006414
1244 Ga0209588_1009590
1245 Ga0209588_1019515
1246 Ga0209588_1023246
1247 Ga0209588_1034351
1248 Ga0209588_1062092
1249 Ga0265354_1001313
1250 Ga0268266_10022744
1251 Ga0268266_10420944
1252 Ga0268265_10069931
1253 Ga0268265_12046101
1254 Ga0268264_10090198
1255 Ga0265319_1000381
1256 Ga0265334_10102292
1257 Ga0265318_10000122
1258 Ga0265338_10008201
1259 Ga0265338_10081813
1260 Ga0265338_10292649
1261 Ga0265338_10578229
1262 Ga0265338_10634956
1263 Ga0265324_10008096
1264 Ga0265765_1011845
1265 Ga0265760_10000587
1266 Ga0265760_10004556
1267 Ga0265330_10324287
1268 Ga0265332_10017955
1269 Ga0265328_10046882
1270 Ga0265328_10123125
1271 Ga0265320_10000019
1272 Ga0265320_10005189
1273 Ga0265325_10010131
1274 Ga0265325_10032682
1275 Ga0265329_10016668
1276 Ga0265340_10001198
1277 Ga0265340_10017650
1278 Ga0265339_10005425
1279 Ga0265339_10177150
1280 Ga0265331_10000028
1281 Ga0265331_10034309
1282 Ga0265316_10000092
1283 Ga0265316_10015189
1284 Ga0265316_10279695
1285 Ga0265313_10000704
1286 Ga0265314_10001078
1287 Ga0265314_10103444
1288 Ga0265342_10000074
1289 Ga0265342_10026968
1290 Ga0316212_1005673
1291 Ga0373926_0003238
1292 Ga0373934_0001267
1293 Ga0373940_0078332
1294 Ga0373949_0019963
1295 Ga0373923_0034212
1296 Ga0373923_0097633
1297 Ga0373932_0007205
1298 Ga0373945_0439726
1299 Ga0373953_0011074
1300 Ga0373953_0100531
1301 Ga0373954_0021320
1302 Ga0373954_0067503
1303 Ga0373956_0002782
1304 Ga0373956_0080077
1305 Ga0373957_0000896
1306 Ga0373957_0006227
1307 Ga0373946_0246327
1308 Ga0373955_0003110
1309 Ga0373955_0023616
1310 Ga0373955_0169132
1311 Ga0373955_0478521
1312 Ga0373942_0064472
1313 Ga0373962_0065782
1314 Ga0373924_0005123
1315 Ga0373924_0059012
1316 Ga0373931_0010418
1317 Ga0373931_0017906
1318 Ga0373931_0163703
1319 Ga0373935_0149887
1320 Ga0373935_0158750
1321 Ga0373935_0429528
1322 Ga0373927_0004163
1323 Ga0373927_0264965
1324 Ga0373927_0505577
1325 Ga0373933_0000455
1326 Ga0373933_0031828
1327 Ga0373933_0038036
1328 Ga0373947_0054938
1329 Ga0373937_0000295
1330 Ga0373937_0004388
1331 Ga0373937_0032363
1332 Ga0373937_0072886
1333 Ga0373937_0090692
1334 Ga0373937_0123148
1335 Ga0373937_1093611
1336 Ga0373925_0006382
1337 Ga0373925_0009371
1338 Ga0373925_0419905
1339 Ga0373925_0978822
1340 Ga0395900_0153711
1341 Ga0395900_1189509
1342 Ga0395898_0537456
1343 Ga0395905_0003190
1344 Ga0395905_0024237
1345 Ga0395905_0053413
1346 Ga0395905_0144396
1347 Ga0395905_0201444
1348 Ga0436365_0750763
1349 Ga0436362_0237415
1350 Ga0436362_1001194
1351 Ga0451807_1347082
1352 Ga0451853_0014154
1353 Ga0451853_3248563
1354 Ga0439440_0048652
1355 Ga0466965_0011543
1356 Ga0466966_0065885
1357 Ga0466966_0325026
1358 Ga0466961_0185034
1359 Ga0466963_0001316
1360 Ga0466963_0001335
1361 Ga0466963_0002214
1362 Ga0466964_0018933
1363 Ga0453684_0055223
1364 Ga0453684_0478561
1365 Ga0466971_0008187
1366 Ga0466968_0022528
1367 Ga0466970_0106017
1368 Ga0466957_0010749
1369 Ga0466959_0015015
1370 Ga0466959_0399516
1371 Ga0451576_0793167
1372 Ga0451576_0867947
1373 Ga0466958_0017348
1374 Ga0466958_0019864
1375 Ga0466958_0031451
1376 Ga0466967_0007111
1377 Ga0466967_0014447
1378 Ga0466967_0050968
1379 Ga0466967_0072421
1380 Ga0466967_0144512
1381 Ga0466967_0969113
1382 Ga0466967_1493808
1383 Ga0495592_0000660
1384 Ga0495592_0094927
1385 Ga0495603_0014192
1386 Ga0495629_0555727
1387 Ga0495651_0000034
1388 Ga0495651_0073282
1389 Ga0495653_0004267
1390 Ga0495580_0022382
1391 Ga0495580_0110380
1392 Ga0495580_0345113
1393 Ga0495582_0150599
1394 Ga0495664_0344273
1395 Ga0495608_0003358
1396 Ga0495608_0079786
1397 Ga0495618_0002980
1398 Ga0495628_0000184
1399 Ga0495628_0601697
1400 Ga0495630_0015742
1401 Ga0495666_0201883
1402 Ga0495652_0000319
1403 Ga0495652_0201026
1404 Ga0495652_0233966
1405 Ga0495587_0001086
1406 Ga0495645_0000646
1407 Ga0495667_0120713
1408 Ga0495667_0603079
1409 Ga0495635_0817037
1410 Ga0495659_0365428
1411 Ga0495657_0081837
1412 Ga0495657_0485909
1413 Ga0495599_0000227
1414 Ga0495623_0000601
1415 Ga0495623_0005574
1416 Ga0495646_0005450
1417 Ga0495669_0007936
1418 Ga0495613_0278019
1419 Ga0495600_0090026
1420 Ga0495600_0571130
1421 Ga0495581_0778207
1422 Ga0495604_0000194
1423 Ga0495604_0001995
1424 Ga0495676_0380968
1425 Ga0495680_0075073
1426 Ga0495680_0224598
1427 Ga0495675_0000224
1428 Ga0495675_0295202
1429 Ga0495675_0328183
1430 Ga0495684_0016417
1431 Ga0495602_0012995
1432 Ga0496100_0004406
1433 Ga0496100_0036671
1434 Ga0496100_0147462
1435 Ga0496100_0286169
1436 Ga0496100_0480195
1437 Ga0496101_0013017
1438 Ga0496101_0022295
1439 Ga0496101_0115956
1440 Ga0496101_0132215
1441 Ga0496101_0196216
1442 Ga0496101_0600043
1443 Ga0496101_1222961
1444 Ga0496102_0004103
1445 Ga0496102_0014233
1446 Ga0496102_0143449
1447 Ga0496102_0222213
1448 Ga0496102_0595682
1449 Ga0496102_0928993
1450 Ga0496102_1325429
1451 Ga0496103_0006986
1452 Ga0496103_0011172
1453 Ga0496103_0242804
1454 Ga0496104_0019777
1455 Ga0496104_0061403
1456 Ga0496104_0085853
1457 Ga0496104_0108917
1458 Ga0496104_0311936
1459 Ga0496105_0067458
1460 Ga0496105_0128936
1461 Ga0496105_0199675
1462 Ga0496105_0211814
1463 Ga0496105_0224977
1464 Ga0496106_0046673
1465 Ga0496106_0084845
1466 Ga0496106_0147127
1467 Ga0496106_0523516
1468 Ga0496106_0774339
1469 Ga0496106_0778398
1470 Ga0496107_0020569
1471 Ga0496107_0078783
1472 Ga0496107_0140290
1473 Ga0496107_0144185
1474 Ga0496108_0022133
1475 Ga0496108_0035225
1476 Ga0496108_0052345
1477 Ga0496108_0207838
1478 Ga0496108_0370388
1479 Ga0496108_0376802
1480 Ga0496109_0037958
1481 Ga0496109_0272586
1482 Ga0496109_0452597
1483 Ga0496110_0003719
1484 Ga0496110_0037510
1485 Ga0496110_0179438
1486 Ga0496110_0551303
1487 Ga0496111_0167635
1488 Ga0496111_0295693
1489 Ga0496111_0491754
1490 Ga0496112_0124975
1491 Ga0496112_0143342
1492 Ga0496112_0144268
1493 Ga0496112_0255007
1494 Ga0496112_0255792
1495 Ga0496112_0758390
1496 Ga0496113_0115857
1497 Ga0496113_0195875
1498 Ga0496113_0206506
1499 Ga0496113_0334961
1500 Ga0496114_0042955
1501 Ga0496115_0017927
1502 Ga0496115_0038437
1503 Ga0496115_0045147
1504 Ga0496115_0409993
1505 Ga0501036_0865132
1506 Ga0501046_0790438
1507 Ga0501072_0138317
1508 Ga0501075_0286559
1509 Ga0501075_0926342
1510 Ga0501076_0428344
1511 nmdc:mga05p37_139435_c1
1512 nmdc:mga06r32_975193_c1
1513 nmdc:mga0n895_34538_c1
1514 nmdc:mga0n895_66757_c1
1515 nmdc:mga0rr50_97362_c1
1516 nmdc:mga08x19_139743_c1
1517 nmdc:mga08x19_15441_c1
1518 nmdc:mga08x19_38240_c1
1519 nmdc:mga08x19_44619_c1
1520 nmdc:mga08x19_53274_c1
1521 nmdc:mga08x19_589378_c1
1522 nmdc:mga08x19_822207_c1
1523 nmdc:mga0a205_154661_c1
1524 Ga0495601_0017330
1525 Ga0495601_0227072
1526 Ga0495619_0000370
1527 Ga0495619_0192485
1528 Ga0495619_0303655
1529 Ga0495619_0359728
1530 Ga0495619_0506868
1531 Ga0501084_1186743
1532 Ga0587066_161527
1533 Ga0501082_0888618
1534 Ga0466962_0001870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

31

160

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.9533 1 163
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.9407 1 163
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.9383 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9304 1 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9249 1 163
ID Description Score Start End Superfamily
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9582 1 163 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9533 1 163 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9525 1 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9304 1 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9249 1 163 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A838D8S2-F1-model_v4 Carbonic anhydrase 0.9867 1 163 GO:0004089
GO:0008270
AF-A0A141RNY7-F1-model_v4 Carbonic anhydrase 0.9821 5 101 GO:0004089
GO:0008270
AF-A0A654M255-F1-model_v4 Beta-carbonic anhydrase 1 (EC 4.2.1.1) 0.9817 1 130 GO:0004089
GO:0008270
AF-A0A838D8S2-F1-model_v4 Carbonic anhydrase 0.9807 1 163 GO:0004089
GO:0008270
AF-W1VG34-F1-model_v4 deleted 0.9766 33 163

Map