F479799

General Info

Members Datasets Scaffolds Average Seq Length
765 237 1530 114

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0005487|Ga0495584_0005487_233_652
Length 139
Sequence MPVRLRFYKETEYDSYKQQGWQRSVNGMVHEDRRSEGRIGPLKDVRIDSLVSEFDMGLAQPLSRSVRLNGFATCLRLEQVYWDILGDMAKVNCCSVSALLSHVDREVHLRHGGVKNFTGLVRVVCVVHSLKEGSCLVMA

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
38 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
49 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
80 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
81 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
82 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
83 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
84 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
106 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
107 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
108 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
109 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
110 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
111 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
112 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
115 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
118 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
124 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
216 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
217 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
218 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
224 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
225 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
228 2511231012 Pseudomonas sp. GM33 Isolate Nodule
229 2511231015 Pseudomonas sp. GM49 Isolate Nodule
230 2511231020 Pseudomonas sp. GM74 Isolate Nodule
231 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
232 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
233 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
234 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
235 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
236 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
237 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.45
Nodule 1.44
Rhizoplane 0.52
Rhizosphere 86.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0005487 3300046491 Bacteria 6717
2 MRS2a_Contig_520 2124908027 Bacteria 5088
3 SwRhRL2b_contig_1650147 2162886007 Bacteria 1048
4 JGI25163J39215_1001572 3300002771 Bacteria 3483
5 JGI25164J39214_1000446 3300002772 Bacteria 21870
6 JGI25165J46597_1000861 3300003214 Bacteria 21870
7 Ga0055538_1000137 3300003751 Bacteria 51731
8 Ga0055539_1000186 3300003752 Bacteria 51731
9 Ga0055533_1000187 3300003756 Bacteria 51731
10 Ga0055532_1000189 3300003758 Bacteria 51731
11 Ga0055525_1000257 3300003759 Bacteria 50764
12 Ga0055530_10012001 3300003791 Bacteria 3054
13 Ga0055540_1038564 3300003792 Bacteria 1046
14 Ga0055541_1000121 3300003841 Bacteria 51731
15 Ga0065714_10068720 3300005288 Bacteria 4575
16 Ga0065714_10071243 3300005288 Bacteria 3606
17 Ga0065714_10079886 3300005288 Bacteria 2468
18 Ga0065714_10099421 3300005288 Bacteria 1687
19 Ga0065714_10111307 3300005288 Bacteria 1462
20 Ga0065714_10511364 3300005288 Bacteria 517
21 Ga0065714_10521255 3300005288 Bacteria 512
22 Ga0065704_10001148 3300005289 Bacteria 10912
23 Ga0065704_10117817 3300005289 Bacteria 1827
24 Ga0065704_10145183 3300005289 Bacteria 1477
25 Ga0065704_10267489 3300005289 Bacteria 951
26 Ga0065704_10330527 3300005289 Bacteria 838
27 Ga0065704_10405749 3300005289 Bacteria 747
28 Ga0065712_10138017 3300005290 Bacteria 1475
29 Ga0070669_100002259 3300005353 Bacteria 13980
30 Ga0070675_101429338 3300005354 Bacteria 638
31 Ga0070662_100001777 3300005457 Bacteria 13276
32 Ga0068853_100001638 3300005539 Bacteria 16367
33 Ga0070665_100054387 3300005548 Bacteria 4015
34 Ga0070665_100342264 3300005548 Bacteria 1500
35 Ga0068854_100055661 3300005578 Bacteria 2848
36 Ga0068851_10000031 3300005834 Bacteria 111072
37 Ga0075365_10590981 3300006038 Bacteria 785
38 Ga0075364_10195345 3300006051 Bacteria 1371
39 Ga0075364_10220953 3300006051 Bacteria 1286
40 Ga0075364_10280151 3300006051 Bacteria 1134
41 Ga0075364_10309123 3300006051 Bacteria 1076
42 Ga0075364_10310427 3300006051 Bacteria 1074
43 Ga0075364_10369203 3300006051 Bacteria 978
44 Ga0075364_10453679 3300006051 Bacteria 876
45 Ga0075364_10823882 3300006051 Bacteria 632
46 Ga0075364_10865472 3300006051 Bacteria 615
47 Ga0075364_10950995 3300006051 Bacteria 584
48 Ga0075432_10001282 3300006058 Bacteria 8111
49 Ga0075432_10002018 3300006058 Bacteria 6747
50 Ga0075432_10012314 3300006058 Bacteria 2905
51 Ga0075432_10033852 3300006058 Bacteria 1773
52 Ga0075432_10060514 3300006058 Bacteria 1347
53 Ga0075432_10084058 3300006058 Bacteria 1157
54 Ga0075432_10123204 3300006058 Bacteria 975
55 Ga0075432_10143889 3300006058 Bacteria 912
56 Ga0075432_10343665 3300006058 Bacteria 630
57 Ga0075362_10073177 3300006177 Bacteria 1568
58 Ga0075362_10080314 3300006177 Bacteria 1502
59 Ga0075362_10172851 3300006177 Bacteria 1044
60 Ga0075362_10691601 3300006177 Bacteria 531
61 Ga0075369_10086056 3300006186 Bacteria 1399
62 Ga0075369_10244406 3300006186 Bacteria 833
63 Ga0075369_10600020 3300006186 Bacteria 527
64 Ga0075436_100190650 3300006914 Bacteria 1450
65 Ga0075436_100378373 3300006914 Bacteria 1023
66 Ga0075436_100528707 3300006914 Bacteria 864
67 Ga0075436_100994017 3300006914 Bacteria 629
68 Ga0075436_101025379 3300006914 Bacteria 620
69 Ga0075436_101046234 3300006914 Bacteria 613
70 Ga0079104_1001807 3300006946 Bacteria 13212
71 Ga0079104_1032587 3300006946 Bacteria 1283
72 Ga0099826_10003825 3300006948 Bacteria 10363
73 Ga0105251_10003131 3300009011 Bacteria 12275
74 Ga0105251_10014005 3300009011 Bacteria 4454
75 Ga0105251_10018427 3300009011 Bacteria 3713
76 Ga0105244_10016271 3300009036 Bacteria 4241
77 Ga0105244_10066914 3300009036 Bacteria 1798
78 Ga0105244_10144899 3300009036 Bacteria 1140
79 Ga0105244_10192584 3300009036 Bacteria 964
80 Ga0105244_10314461 3300009036 Bacteria 724
81 Ga0105244_10594813 3300009036 Bacteria 507
82 Ga0105250_10011553 3300009092 Bacteria 3662
83 Ga0105250_10040787 3300009092 Bacteria 1862
84 Ga0105250_10175167 3300009092 Bacteria 899
85 Ga0105246_10106414 3300011119 Bacteria 2052
86 Ga0157345_1000120 3300012498 Bacteria 15343
87 Ga0157345_1011404 3300012498 Bacteria 788
88 Ga0157347_1008076 3300012502 Bacteria 1064
89 Ga0157373_10028192 3300013100 Bacteria 4051
90 Ga0157373_10160940 3300013100 Bacteria 1579
91 Ga0157371_10171156 3300013102 Bacteria 1552
92 Ga0157370_10072014 3300013104 Bacteria 3261
93 Ga0157370_10621064 3300013104 Bacteria 989
94 Ga0157370_10636572 3300013104 Bacteria 975
95 Ga0157370_11114760 3300013104 Bacteria 713
96 Ga0157370_11376947 3300013104 Bacteria 635
97 Ga0163162_10083362 3300013306 Bacteria 3271
98 Ga0163162_11849928 3300013306 Bacteria 691
99 Ga0182008_10018397 3300014497 Bacteria 3618
100 Ga0182008_10045078 3300014497 Bacteria 2192
101 Ga0182008_10153134 3300014497 Bacteria 1157
102 Ga0182006_1013223 3300015261 Bacteria 3587
103 Ga0182007_10037984 3300015262 Bacteria 1616
104 Ga0182007_10248576 3300015262 Bacteria 637
105 Ga0182005_1006536 3300015265 Bacteria 3548
106 Ga0182005_1063394 3300015265 Bacteria 1010
107 Ga0163161_10002686 3300017792 Bacteria 12647
108 Ga0163161_10041163 3300017792 Bacteria 3320
109 Ga0163161_10130974 3300017792 Bacteria 1892
110 Ga0163161_10160654 3300017792 Bacteria 1713
111 Ga0163161_10195851 3300017792 Bacteria 1555
112 Ga0163161_10306350 3300017792 Bacteria 1252
113 Ga0163161_10369626 3300017792 Bacteria 1144
114 Ga0163161_10600390 3300017792 Bacteria 907
115 Ga0209435_101032 3300025206 Bacteria 3960
116 Ga0209760_100106 3300025207 Bacteria 63287
117 Ga0209784_100032 3300025224 Bacteria 314079
118 Ga0209566_100036 3300025225 Bacteria 314079
119 Ga0209674_100054 3300025226 Bacteria 314079
120 Ga0209147_100248 3300025229 Bacteria 51781
121 Ga0209563_100055 3300025230 Bacteria 314079
122 Ga0207427_100004 3300025231 Bacteria 939600
123 Ga0209437_100028 3300025233 Bacteria 540136
124 Ga0209258_100755 3300025242 Bacteria 20425
125 Ga0209646_1000429 3300025246 Bacteria 23295
126 Ga0209677_100033 3300025253 Bacteria 314079
127 Ga0209759_1033223 3300025256 Bacteria 980
128 Ga0209233_1000008 3300025261 Bacteria 1356712
129 Ga0209676_1000365 3300025292 Bacteria 84690
130 Ga0209050_1001519 3300025298 Bacteria 24484
131 Ga0209051_1013522 3300025303 Bacteria 3880
132 Ga0207656_10000044 3300025321 Bacteria 52125
133 Ga0207696_1000377 3300025711 Bacteria 43457
134 Ga0207696_1008926 3300025711 Bacteria 3778
135 Ga0207655_1013087 3300025728 Bacteria 4788
136 Ga0207655_1014263 3300025728 Bacteria 4503
137 Ga0207655_1022968 3300025728 Bacteria 3107
138 Ga0207655_1032827 3300025728 Bacteria 2365
139 Ga0207655_1063513 3300025728 Bacteria 1414
140 Ga0207655_1078412 3300025728 Bacteria 1201
141 Ga0207655_1152271 3300025728 Bacteria 730
142 Ga0207655_1171753 3300025728 Bacteria 669
143 Ga0207713_1000859 3300025735 Bacteria 27906
144 Ga0207713_1002514 3300025735 Bacteria 13275
145 Ga0207713_1003964 3300025735 Bacteria 9818
146 Ga0207713_1004063 3300025735 Bacteria 9657
147 Ga0207713_1021004 3300025735 Bacteria 3141
148 Ga0207650_10000987 3300025925 Bacteria 21388
149 Ga0207706_10000117 3300025933 Bacteria 85249
150 Ga0207706_11375760 3300025933 Bacteria 580
151 Ga0207709_10240515 3300025935 Bacteria 1316
152 Ga0207711_10021198 3300025941 Bacteria 5427
153 Ga0207639_10000977 3300026041 Bacteria 19443
154 Ga0209281_1000010 3300027111 Bacteria 726106
155 Ga0209281_1000049 3300027111 Bacteria 322274
156 Ga0209281_1003555 3300027111 Bacteria 5083
157 Ga0209281_1029879 3300027111 Bacteria 981
158 Ga0209981_1010858 3300027378 Bacteria 1252
159 Ga0209282_1007500 3300027666 Bacteria 6834
160 Ga0207428_10013162 3300027907 Bacteria 7242
161 Ga0207428_10042647 3300027907 Bacteria 3669
162 Ga0207428_10042836 3300027907 Bacteria 3660
163 Ga0207428_10046687 3300027907 Bacteria 3483
164 Ga0207428_10065074 3300027907 Bacteria 2878
165 Ga0207428_10109911 3300027907 Bacteria 2123
166 Ga0207428_10128560 3300027907 Bacteria 1940
167 Ga0207428_10202901 3300027907 Bacteria 1492
168 Ga0207428_10286535 3300027907 Bacteria 1222
169 Ga0207428_10884506 3300027907 Bacteria 632
170 Ga0268266_10057074 3300028379 Bacteria 3359
171 Ga0268266_10228915 3300028379 Bacteria 1711
172 Ga0314311_1066460 3300030733 Bacteria 2097
173 Ga0316179_1053443 3300030734 Bacteria 2562
174 Ga0316178_1123752 3300030735 Bacteria 3992
175 Ga0316183_1114373 3300030742 Bacteria 2072
176 Ga0316181_1271327 3300030744 Bacteria 2149
177 Ga0316182_1313319 3300030745 Bacteria 538
178 Ga0307513_10822858 3300031456 Bacteria 635
179 Ga0307408_100076241 3300031548 Bacteria 2493
180 Ga0307408_100080237 3300031548 Bacteria 2436
181 Ga0307408_101621590 3300031548 Bacteria 615
182 Ga0307516_10351205 3300031730 Bacteria 1140
183 Ga0307405_10030881 3300031731 Bacteria 3146
184 Ga0307405_10102735 3300031731 Bacteria 1920
185 Ga0307405_10104555 3300031731 Bacteria 1905
186 Ga0307405_10774186 3300031731 Bacteria 801
187 Ga0307413_10259474 3300031824 Bacteria 1294
188 Ga0307413_11285939 3300031824 Bacteria 639
189 Ga0307413_11582500 3300031824 Bacteria 581
190 Ga0307406_10100564 3300031901 Bacteria 1968
191 Ga0307406_10122395 3300031901 Bacteria 1811
192 Ga0307406_10683811 3300031901 Bacteria 855
193 Ga0307407_10139628 3300031903 Bacteria 1561
194 Ga0307407_10615791 3300031903 Bacteria 810
195 Ga0307412_10005681 3300031911 Bacteria 7010
196 Ga0307412_10024361 3300031911 Bacteria 3735
197 Ga0307412_10269981 3300031911 Bacteria 1330
198 Ga0307412_11047070 3300031911 Bacteria 723
199 Ga0307412_11049508 3300031911 Bacteria 722
200 Ga0307412_12284523 3300031911 Bacteria 504
201 Ga0307409_100047188 3300031995 Bacteria 3267
202 Ga0307409_100254530 3300031995 Bacteria 1607
203 Ga0307416_100356710 3300032002 Bacteria 1482
204 Ga0307416_100417647 3300032002 Bacteria 1384
205 Ga0307416_100715554 3300032002 Bacteria 1091
206 Ga0307416_101150704 3300032002 Bacteria 881
207 Ga0307414_10054909 3300032004 Bacteria 2786
208 Ga0307414_10166655 3300032004 Bacteria 1756
209 Ga0307414_10414948 3300032004 Bacteria 1172
210 Ga0307414_10464955 3300032004 Bacteria 1112
211 Ga0307414_10810007 3300032004 Bacteria 854
212 Ga0307411_10031044 3300032005 Bacteria 3282
213 Ga0307411_12163011 3300032005 Bacteria 521
214 Ga0307510_10005747 3300033180 Bacteria 14785
215 Ga0307510_10602894 3300033180 Bacteria 550
216 Ga0439438_002414 3300041405 Bacteria 7964
217 Ga0439438_003562 3300041405 Bacteria 6249
218 Ga0439438_008927 3300041405 Bacteria 3279
219 Ga0439438_032684 3300041405 Bacteria 1378
220 Ga0439438_055500 3300041405 Bacteria 999
221 Ga0439447_007775 3300041407 Bacteria 3370
222 Ga0439447_009183 3300041407 Bacteria 3013
223 Ga0439447_017895 3300041407 Bacteria 1922
224 Ga0439447_024064 3300041407 Bacteria 1580
225 Ga0439447_059753 3300041407 Bacteria 898
226 Ga0439466_0012036 3300041411 Bacteria 3194
227 Ga0439466_0041124 3300041411 Bacteria 1543
228 Ga0439466_0074881 3300041411 Bacteria 1073
229 Ga0439465_0003644 3300041413 Bacteria 5023
230 Ga0439465_0024430 3300041413 Bacteria 1904
231 Ga0439431_0013316 3300041997 Bacteria 1897
232 Ga0439445_0002766 3300042004 Bacteria 3912
233 Ga0439432_002509 3300042006 Bacteria 6915
234 Ga0439432_066946 3300042006 Bacteria 1099
235 Ga0439432_077413 3300042006 Bacteria 1009
236 Ga0439451_000388 3300042009 Bacteria 8552
237 Ga0439452_000523 3300042010 Bacteria 20572
238 Ga0439452_002230 3300042010 Bacteria 7274
239 Ga0439452_024258 3300042010 Bacteria 1552
240 Ga0439452_076561 3300042010 Bacteria 732
241 Ga0439456_012157 3300042013 Bacteria 1784
242 Ga0439456_016543 3300042013 Bacteria 1542
243 Ga0439456_054797 3300042013 Bacteria 873
244 Ga0450911_005912 3300042115 Bacteria 1857
245 Ga0450911_057630 3300042115 Bacteria 504
246 Ga0450919_003760 3300042121 Bacteria 1882
247 Ga0450922_002230 3300042124 Bacteria 1830
248 Ga0450923_025933 3300042125 Bacteria 1171
249 Ga0450890_001220 3300042127 Bacteria 3723
250 Ga0450902_002795 3300042137 Bacteria 2497
251 Ga0450902_043952 3300042137 Bacteria 762
252 Ga0450903_008217 3300042138 Bacteria 1710
253 Ga0450903_009318 3300042138 Bacteria 1601
254 Ga0450903_015175 3300042138 Bacteria 1214
255 Ga0450903_020276 3300042138 Bacteria 1028
256 Ga0450905_001881 3300042142 Bacteria 2687
257 Ga0450905_015273 3300042142 Bacteria 1100
258 Ga0450906_004888 3300042145 Bacteria 2787
259 Ga0450907_003792 3300042146 Bacteria 2648
260 Ga0450907_029504 3300042146 Bacteria 931
261 Ga0450910_006367 3300042147 Bacteria 1627
262 Ga0439446_0051035 3300042156 Bacteria 1235
263 Ga0439446_0138995 3300042156 Bacteria 792
264 Ga0450908_006497 3300042184 Bacteria 2218
265 Ga0439434_0137646 3300042435 Bacteria 803
266 Ga0439460_0004886 3300042461 Bacteria 3275
267 Ga0450918_062589 3300042531 Bacteria 689
268 Ga0450901_002160 3300042533 Bacteria 2162
269 Ga0495617_002328 3300046452 Bacteria 7634
270 Ga0495617_007074 3300046452 Bacteria 3913
271 Ga0495617_008250 3300046452 Bacteria 3595
272 Ga0495617_037374 3300046452 Bacteria 1626
273 Ga0495617_046581 3300046452 Bacteria 1444
274 Ga0495617_086087 3300046452 Bacteria 1027
275 Ga0495617_092750 3300046452 Bacteria 984
276 Ga0495627_000496 3300046453 Bacteria 33018
277 Ga0495627_003932 3300046453 Bacteria 6355
278 Ga0495627_010221 3300046453 Bacteria 3419
279 Ga0495627_027087 3300046453 Bacteria 1842
280 Ga0495627_036546 3300046453 Bacteria 1525
281 Ga0495627_049449 3300046453 Bacteria 1269
282 Ga0495627_096657 3300046453 Bacteria 846
283 Ga0495627_100949 3300046453 Bacteria 823
284 Ga0495603_0043565 3300046455 Bacteria 2679
285 Ga0495603_0782325 3300046455 Bacteria 544
286 Ga0495590_0001399 3300046457 Bacteria 10474
287 Ga0495590_0008908 3300046457 Bacteria 3812
288 Ga0495590_0022445 3300046457 Bacteria 2231
289 Ga0495590_0079357 3300046457 Bacteria 1155
290 Ga0495590_0089159 3300046457 Bacteria 1090
291 Ga0495591_000926 3300046458 Bacteria 20198
292 Ga0495591_006595 3300046458 Bacteria 5097
293 Ga0495591_015292 3300046458 Bacteria 2717
294 Ga0495591_027098 3300046458 Bacteria 1771
295 Ga0495591_040217 3300046458 Bacteria 1334
296 Ga0495591_042398 3300046458 Bacteria 1286
297 Ga0495591_044306 3300046458 Bacteria 1247
298 Ga0495629_0021666 3300046459 Bacteria 4586
299 Ga0495638_0005113 3300046460 Bacteria 9823
300 Ga0495638_0012946 3300046460 Bacteria 5695
301 Ga0495638_0017539 3300046460 Bacteria 4769
302 Ga0495638_0027451 3300046460 Bacteria 3684
303 Ga0495638_0029678 3300046460 Bacteria 3526
304 Ga0495638_0045556 3300046460 Bacteria 2758
305 Ga0495638_0129516 3300046460 Bacteria 1483
306 Ga0495638_0144590 3300046460 Bacteria 1384
307 Ga0495638_0150055 3300046460 Bacteria 1352
308 Ga0495638_0160663 3300046460 Bacteria 1296
309 Ga0495638_0306736 3300046460 Bacteria 853
310 Ga0495638_0570781 3300046460 Bacteria 559
311 Ga0495653_0004647 3300046463 Bacteria 11107
312 Ga0495653_0004686 3300046463 Bacteria 11066
313 Ga0495653_0062904 3300046463 Bacteria 2802
314 Ga0495650_0011262 3300046471 Bacteria 4914
315 Ga0495650_0015141 3300046471 Bacteria 3970
316 Ga0495650_0018377 3300046471 Bacteria 3475
317 Ga0495650_0053071 3300046471 Bacteria 1661
318 Ga0495650_0063915 3300046471 Bacteria 1465
319 Ga0495582_0030058 3300046473 Bacteria 2981
320 Ga0495605_0003048 3300046474 Bacteria 10112
321 Ga0495605_0003479 3300046474 Bacteria 9366
322 Ga0495605_0042432 3300046474 Bacteria 2261
323 Ga0495605_0053517 3300046474 Bacteria 1958
324 Ga0495605_0056765 3300046474 Bacteria 1887
325 Ga0495605_0064939 3300046474 Bacteria 1737
326 Ga0495605_0080082 3300046474 Bacteria 1529
327 Ga0495605_0119658 3300046474 Bacteria 1194
328 Ga0495605_0167264 3300046474 Bacteria 973
329 Ga0495605_0279133 3300046474 Bacteria 710
330 Ga0495639_0000543 3300046475 Bacteria 17590
331 Ga0495639_0011193 3300046475 Bacteria 3864
332 Ga0495639_0121056 3300046475 Bacteria 1248
333 Ga0495584_0003173 3300046491 Bacteria 9136
334 Ga0495584_0003361 3300046491 Bacteria 8838
335 Ga0495584_0003474 3300046491 Bacteria 8662
336 Ga0495584_0012727 3300046491 Bacteria 4294
337 Ga0495584_0015589 3300046491 Bacteria 3874
338 Ga0495584_0016351 3300046491 Bacteria 3783
339 Ga0495584_0108408 3300046491 Bacteria 1404
340 Ga0495584_0125916 3300046491 Bacteria 1298
341 Ga0495584_0135729 3300046491 Bacteria 1249
342 Ga0495584_0307546 3300046491 Bacteria 805
343 Ga0495585_0002538 3300046492 Bacteria 12958
344 Ga0495585_0006873 3300046492 Bacteria 7013
345 Ga0495585_0008634 3300046492 Bacteria 6165
346 Ga0495585_0082983 3300046492 Bacteria 1734
347 Ga0495585_0093837 3300046492 Bacteria 1613
348 Ga0495585_0096228 3300046492 Bacteria 1589
349 Ga0495585_0112506 3300046492 Bacteria 1446
350 Ga0495585_0152246 3300046492 Bacteria 1205
351 Ga0495594_0146440 3300046499 Bacteria 1340
352 Ga0495594_0471589 3300046499 Bacteria 713
353 Ga0495596_0000653 3300046500 Bacteria 21710
354 Ga0495596_0003447 3300046500 Bacteria 8002
355 Ga0495607_0004794 3300046501 Bacteria 9877
356 Ga0495607_0012338 3300046501 Bacteria 5647
357 Ga0495607_0023456 3300046501 Bacteria 3862
358 Ga0495607_0037265 3300046501 Bacteria 2922
359 Ga0495607_0053663 3300046501 Bacteria 2327
360 Ga0495607_0076483 3300046501 Bacteria 1851
361 Ga0495607_0103106 3300046501 Bacteria 1524
362 Ga0495607_0155281 3300046501 Bacteria 1167
363 Ga0495607_0209301 3300046501 Bacteria 960
364 Ga0495583_0016786 3300046506 Bacteria 3915
365 Ga0495583_0027307 3300046506 Bacteria 2818
366 Ga0495583_0067857 3300046506 Bacteria 1574
367 Ga0495583_0107859 3300046506 Bacteria 1182
368 Ga0495583_0128362 3300046506 Bacteria 1062
369 Ga0495606_0008889 3300046507 Bacteria 8605
370 Ga0495606_0015365 3300046507 Bacteria 5902
371 Ga0495606_0021192 3300046507 Bacteria 4763
372 Ga0495606_0050983 3300046507 Bacteria 2702
373 Ga0495606_0091066 3300046507 Bacteria 1875
374 Ga0495606_0104806 3300046507 Bacteria 1715
375 Ga0495606_0119807 3300046507 Bacteria 1576
376 Ga0495606_0169922 3300046507 Bacteria 1265
377 Ga0495610_0007785 3300046512 Bacteria 7064
378 Ga0495610_0008059 3300046512 Bacteria 6891
379 Ga0495610_0009573 3300046512 Bacteria 6110
380 Ga0495610_0011606 3300046512 Bacteria 5371
381 Ga0495610_0028453 3300046512 Bacteria 2955
382 Ga0495610_0044729 3300046512 Bacteria 2195
383 Ga0495610_0118254 3300046512 Bacteria 1165
384 Ga0495610_0343197 3300046512 Bacteria 564
385 Ga0495616_0012135 3300046513 Bacteria 4903
386 Ga0495616_0012435 3300046513 Bacteria 4833
387 Ga0495616_0039527 3300046513 Bacteria 2415
388 Ga0495616_0061437 3300046513 Bacteria 1842
389 Ga0495616_0147336 3300046513 Bacteria 1067
390 Ga0495616_0331787 3300046513 Bacteria 636
391 Ga0495620_0006238 3300046515 Bacteria 6566
392 Ga0495620_0012554 3300046515 Bacteria 4367
393 Ga0495620_0054925 3300046515 Bacteria 1680
394 Ga0495620_0063798 3300046515 Bacteria 1525
395 Ga0495620_0080268 3300046515 Bacteria 1320
396 Ga0495630_0010241 3300046517 Bacteria 6764
397 Ga0495631_0001105 3300046518 Bacteria 16745
398 Ga0495631_0002107 3300046518 Bacteria 11549
399 Ga0495631_0007735 3300046518 Bacteria 5453
400 Ga0495631_0027198 3300046518 Bacteria 2620
401 Ga0495631_0068278 3300046518 Bacteria 1537
402 Ga0495631_0131451 3300046518 Bacteria 1075
403 Ga0495631_0291184 3300046518 Bacteria 695
404 Ga0495632_0002291 3300046519 Bacteria 14741
405 Ga0495632_0005105 3300046519 Bacteria 8774
406 Ga0495632_0008024 3300046519 Bacteria 6550
407 Ga0495632_0025562 3300046519 Bacteria 3121
408 Ga0495632_0056109 3300046519 Bacteria 1926
409 Ga0495632_0060841 3300046519 Bacteria 1833
410 Ga0495632_0061527 3300046519 Bacteria 1822
411 Ga0495632_0106125 3300046519 Bacteria 1321
412 Ga0495632_0147640 3300046519 Bacteria 1088
413 Ga0495632_0160270 3300046519 Bacteria 1036
414 Ga0495632_0262069 3300046519 Bacteria 773
415 Ga0495637_0001279 3300046520 Bacteria 15179
416 Ga0495637_0003102 3300046520 Bacteria 8873
417 Ga0495637_0013511 3300046520 Bacteria 3872
418 Ga0495637_0014237 3300046520 Bacteria 3754
419 Ga0495637_0015893 3300046520 Bacteria 3524
420 Ga0495637_0018857 3300046520 Bacteria 3195
421 Ga0495637_0020246 3300046520 Bacteria 3063
422 Ga0495637_0036415 3300046520 Bacteria 2143
423 Ga0495637_0078417 3300046520 Bacteria 1320
424 Ga0495637_0103638 3300046520 Bacteria 1109
425 Ga0495637_0110230 3300046520 Bacteria 1067
426 Ga0495643_0014005 3300046522 Bacteria 4781
427 Ga0495643_0018386 3300046522 Bacteria 4063
428 Ga0495643_0019963 3300046522 Bacteria 3871
429 Ga0495643_0021023 3300046522 Bacteria 3751
430 Ga0495643_0048721 3300046522 Bacteria 2288
431 Ga0495643_0082869 3300046522 Bacteria 1666
432 Ga0495643_0089508 3300046522 Bacteria 1589
433 Ga0495643_0132089 3300046522 Bacteria 1252
434 Ga0495643_0205064 3300046522 Bacteria 944
435 Ga0495644_0000852 3300046523 Bacteria 12577
436 Ga0495644_0005971 3300046523 Bacteria 4747
437 Ga0495644_0013512 3300046523 Bacteria 3130
438 Ga0495644_0028364 3300046523 Bacteria 2118
439 Ga0495644_0071300 3300046523 Bacteria 1305
440 Ga0495644_0083143 3300046523 Bacteria 1207
441 Ga0495644_0105968 3300046523 Bacteria 1065
442 Ga0495648_0011394 3300046524 Bacteria 6699
443 Ga0495648_0020749 3300046524 Bacteria 4570
444 Ga0495648_0026601 3300046524 Bacteria 3891
445 Ga0495648_0028911 3300046524 Bacteria 3685
446 Ga0495648_0031032 3300046524 Bacteria 3524
447 Ga0495648_0036027 3300046524 Bacteria 3199
448 Ga0495648_0063639 3300046524 Bacteria 2177
449 Ga0495648_0078278 3300046524 Bacteria 1891
450 Ga0495648_0115022 3300046524 Bacteria 1456
451 Ga0495648_0199011 3300046524 Bacteria 1004
452 Ga0495648_0374782 3300046524 Bacteria 643
453 Ga0495666_0013826 3300046526 Bacteria 4024
454 Ga0495666_0094092 3300046526 Bacteria 1413
455 Ga0495666_0214549 3300046526 Bacteria 882
456 Ga0495642_0001561 3300046528 Bacteria 10063
457 Ga0495642_0006529 3300046528 Bacteria 4473
458 Ga0495654_0003247 3300046530 Bacteria 10032
459 Ga0495654_0003478 3300046530 Bacteria 9620
460 Ga0495654_0006687 3300046530 Bacteria 6525
461 Ga0495654_0009053 3300046530 Bacteria 5463
462 Ga0495654_0019189 3300046530 Bacteria 3577
463 Ga0495654_0022942 3300046530 Bacteria 3235
464 Ga0495654_0028984 3300046530 Bacteria 2826
465 Ga0495654_0034869 3300046530 Bacteria 2536
466 Ga0495654_0036225 3300046530 Bacteria 2481
467 Ga0495654_0070543 3300046530 Bacteria 1656
468 Ga0495654_0071820 3300046530 Bacteria 1639
469 Ga0495654_0080394 3300046530 Bacteria 1529
470 Ga0495654_0109942 3300046530 Bacteria 1258
471 Ga0495654_0135783 3300046530 Bacteria 1100
472 Ga0495654_0159930 3300046530 Bacteria 989
473 Ga0495654_0195211 3300046530 Bacteria 869
474 Ga0495586_0166510 3300046535 Bacteria 1244
475 Ga0495586_0443090 3300046535 Bacteria 748
476 Ga0495587_0030834 3300046536 Bacteria 3250
477 Ga0495609_0002981 3300046538 Bacteria 10004
478 Ga0495609_0084763 3300046538 Bacteria 1382
479 Ga0495609_0090944 3300046538 Bacteria 1327
480 Ga0495609_0177883 3300046538 Bacteria 896
481 Ga0495597_0009221 3300046542 Bacteria 4891
482 Ga0495597_0011626 3300046542 Bacteria 4263
483 Ga0495597_0011951 3300046542 Bacteria 4199
484 Ga0495597_0036187 3300046542 Bacteria 2224
485 Ga0495597_0051726 3300046542 Bacteria 1810
486 Ga0495597_0067519 3300046542 Bacteria 1546
487 Ga0495597_0120378 3300046542 Bacteria 1094
488 Ga0495597_0239828 3300046542 Bacteria 715
489 Ga0495645_0208219 3300046543 Bacteria 1322
490 Ga0495622_0003422 3300046557 Bacteria 7479
491 Ga0495622_0005124 3300046557 Bacteria 6071
492 Ga0495622_0006482 3300046557 Bacteria 5429
493 Ga0495622_0035534 3300046557 Bacteria 2323
494 Ga0495622_0101796 3300046557 Bacteria 1316
495 Ga0495622_0141019 3300046557 Bacteria 1094
496 Ga0495633_0014110 3300046558 Bacteria 4188
497 Ga0495633_0015141 3300046558 Bacteria 4006
498 Ga0495633_0103717 3300046558 Bacteria 1319
499 Ga0495633_0132101 3300046558 Bacteria 1155
500 Ga0495633_0218859 3300046558 Bacteria 872
501 Ga0495656_0170228 3300046615 Bacteria 1064
502 Ga0495656_0581572 3300046615 Bacteria 598
503 Ga0495668_0002257 3300046616 Bacteria 16214
504 Ga0495668_0009836 3300046616 Bacteria 5837
505 Ga0495668_0020099 3300046616 Bacteria 3841
506 Ga0495668_0047270 3300046616 Bacteria 2389
507 Ga0495668_0734012 3300046616 Bacteria 546
508 Ga0495634_0238114 3300046642 Bacteria 1117
509 Ga0495611_0055401 3300046648 Bacteria 1794
510 Ga0495611_0073803 3300046648 Bacteria 1561
511 Ga0495611_0080457 3300046648 Bacteria 1497
512 Ga0495611_0113417 3300046648 Bacteria 1262
513 Ga0495611_0117572 3300046648 Bacteria 1239
514 Ga0495611_0374250 3300046648 Bacteria 652
515 Ga0495625_0008545 3300046660 Bacteria 8717
516 Ga0495625_0008967 3300046660 Bacteria 8447
517 Ga0495625_0013349 3300046660 Bacteria 6602
518 Ga0495625_0034530 3300046660 Bacteria 3731
519 Ga0495625_0037274 3300046660 Bacteria 3568
520 Ga0495625_0125439 3300046660 Bacteria 1743
521 Ga0495625_0222371 3300046660 Bacteria 1237
522 Ga0495635_0010877 3300046663 Bacteria 6377
523 Ga0495659_0002189 3300046664 Bacteria 6372
524 Ga0495659_0125730 3300046664 Bacteria 1013
525 Ga0495659_0228280 3300046664 Bacteria 770
526 Ga0495661_0005123 3300046665 Bacteria 9344
527 Ga0495661_0007973 3300046665 Bacteria 7353
528 Ga0495661_0027312 3300046665 Bacteria 3665
529 Ga0495661_0081476 3300046665 Bacteria 1865
530 Ga0495661_0106983 3300046665 Bacteria 1564
531 Ga0495661_0111263 3300046665 Bacteria 1526
532 Ga0495661_0114494 3300046665 Bacteria 1498
533 Ga0495661_0125281 3300046665 Bacteria 1414
534 Ga0495661_0141508 3300046665 Bacteria 1308
535 Ga0495588_0011580 3300046674 Bacteria 4142
536 Ga0495588_0025100 3300046674 Bacteria 2967
537 Ga0495588_0200433 3300046674 Bacteria 1054
538 Ga0495588_0204479 3300046674 Bacteria 1043
539 Ga0495588_0730010 3300046674 Bacteria 518
540 Ga0495657_0163570 3300046675 Bacteria 1375
541 Ga0495623_0043056 3300046679 Bacteria 2873
542 Ga0495646_0105141 3300046680 Bacteria 1613
543 Ga0495669_0001327 3300046684 Bacteria 10226
544 Ga0495669_0204988 3300046684 Bacteria 943
545 Ga0495613_0160178 3300046689 Bacteria 1601
546 Ga0495670_0004375 3300046691 Bacteria 6926
547 Ga0495670_0006080 3300046691 Bacteria 5919
548 Ga0495670_0012361 3300046691 Bacteria 4196
549 Ga0495670_0030013 3300046691 Bacteria 2700
550 Ga0495670_0055268 3300046691 Bacteria 1990
551 Ga0495670_0291519 3300046691 Bacteria 874
552 Ga0495670_0350648 3300046691 Bacteria 794
553 Ga0495670_0396378 3300046691 Bacteria 745
554 Ga0495670_0840650 3300046691 Bacteria 501
555 Ga0495671_0001455 3300046692 Bacteria 15900
556 Ga0495671_0012671 3300046692 Bacteria 4596
557 Ga0495671_0022602 3300046692 Bacteria 3293
558 Ga0495671_0022982 3300046692 Bacteria 3261
559 Ga0495671_0023045 3300046692 Bacteria 3255
560 Ga0495671_0057030 3300046692 Bacteria 1933
561 Ga0495671_0064730 3300046692 Bacteria 1799
562 Ga0495671_0095238 3300046692 Bacteria 1456
563 Ga0495671_0101983 3300046692 Bacteria 1402
564 Ga0495671_0226038 3300046692 Bacteria 905
565 Ga0495671_0234069 3300046692 Bacteria 888
566 Ga0495649_0005116 3300046694 Bacteria 8416
567 Ga0495649_0008842 3300046694 Bacteria 6032
568 Ga0495649_0013089 3300046694 Bacteria 4795
569 Ga0495649_0018010 3300046694 Bacteria 3979
570 Ga0495649_0019428 3300046694 Bacteria 3817
571 Ga0495649_0024397 3300046694 Bacteria 3372
572 Ga0495649_0027145 3300046694 Bacteria 3177
573 Ga0495649_0032185 3300046694 Bacteria 2890
574 Ga0495649_0052512 3300046694 Bacteria 2208
575 Ga0495649_0064291 3300046694 Bacteria 1970
576 Ga0495649_0111394 3300046694 Bacteria 1451
577 Ga0495589_0001150 3300046794 Bacteria 15732
578 Ga0495589_0013109 3300046794 Bacteria 4280
579 Ga0495589_0015041 3300046794 Bacteria 3982
580 Ga0495589_0015659 3300046794 Bacteria 3898
581 Ga0495589_0024103 3300046794 Bacteria 3093
582 Ga0495589_0059771 3300046794 Bacteria 1872
583 Ga0495589_0105656 3300046794 Bacteria 1360
584 Ga0495589_0411385 3300046794 Bacteria 620
585 Ga0495600_0056705 3300046809 Bacteria 2559
586 Ga0495600_0090207 3300046809 Bacteria 1999
587 Ga0495600_0521716 3300046809 Bacteria 728
588 Ga0495660_0007643 3300046810 Bacteria 6348
589 Ga0495660_0015967 3300046810 Bacteria 4332
590 Ga0495660_0022740 3300046810 Bacteria 3577
591 Ga0495660_0035439 3300046810 Bacteria 2787
592 Ga0495660_0035809 3300046810 Bacteria 2770
593 Ga0495660_0051128 3300046810 Bacteria 2249
594 Ga0495660_0086619 3300046810 Bacteria 1635
595 Ga0495660_0104285 3300046810 Bacteria 1455
596 Ga0495660_0106952 3300046810 Bacteria 1432
597 Ga0495660_0114857 3300046810 Bacteria 1369
598 Ga0495660_0142255 3300046810 Bacteria 1192
599 Ga0495660_0167557 3300046810 Bacteria 1072
600 Ga0495660_0168261 3300046810 Bacteria 1069
601 Ga0495660_0215380 3300046810 Bacteria 908
602 Ga0495660_0225738 3300046810 Bacteria 880
603 Ga0495660_0272335 3300046810 Bacteria 777
604 Ga0495660_0328993 3300046810 Bacteria 684
605 Ga0495581_0027287 3300047315 Bacteria 3311
606 Ga0495581_0116090 3300047315 Bacteria 1556
607 Ga0495604_0304493 3300047317 Bacteria 1069
608 Ga0495604_0311556 3300047317 Bacteria 1054
609 Ga0495636_0364602 3300047318 Bacteria 683
610 Ga0495674_0631566 3300047319 Bacteria 846
611 Ga0495672_0001779 3300047320 Bacteria 20703
612 Ga0495672_0002617 3300047320 Bacteria 16300
613 Ga0495672_0007784 3300047320 Bacteria 8011
614 Ga0495672_0020330 3300047320 Bacteria 4355
615 Ga0495672_0020857 3300047320 Bacteria 4285
616 Ga0495672_0028539 3300047320 Bacteria 3529
617 Ga0495672_0035728 3300047320 Bacteria 3058
618 Ga0495672_0053209 3300047320 Bacteria 2373
619 Ga0495672_0080148 3300047320 Bacteria 1822
620 Ga0495672_0125438 3300047320 Bacteria 1358
621 Ga0495672_0175415 3300047320 Bacteria 1089
622 Ga0495672_0310791 3300047320 Bacteria 743
623 Ga0495676_0009200 3300047321 Bacteria 9001
624 Ga0495680_0012375 3300047322 Bacteria 7509
625 Ga0495680_0042231 3300047322 Bacteria 3620
626 Ga0495680_0058783 3300047322 Bacteria 2969
627 Ga0495683_0006656 3300047323 Bacteria 6297
628 Ga0495683_0007518 3300047323 Bacteria 5881
629 Ga0495683_0020425 3300047323 Bacteria 3416
630 Ga0495683_0022977 3300047323 Bacteria 3205
631 Ga0495683_0028127 3300047323 Bacteria 2874
632 Ga0495683_0085227 3300047323 Bacteria 1536
633 Ga0495683_0129983 3300047323 Bacteria 1188
634 Ga0495683_0187802 3300047323 Bacteria 939
635 Ga0495683_0448714 3300047323 Bacteria 529
636 Ga0495687_012005 3300047443 Bacteria 4610
637 Ga0495687_018566 3300047443 Bacteria 3435
638 Ga0495687_022015 3300047443 Bacteria 3069
639 Ga0495675_0029117 3300047444 Bacteria 3520
640 Ga0495679_009287 3300047446 Bacteria 3946
641 Ga0495679_009857 3300047446 Bacteria 3789
642 Ga0495679_010358 3300047446 Bacteria 3663
643 Ga0495679_019761 3300047446 Bacteria 2359
644 Ga0495679_060918 3300047446 Bacteria 1106
645 Ga0495679_072255 3300047446 Bacteria 992
646 Ga0495685_063733 3300047447 Bacteria 1240
647 Ga0495673_0002096 3300047469 Bacteria 14527
648 Ga0495673_0012041 3300047469 Bacteria 4613
649 Ga0495673_0015287 3300047469 Bacteria 3957
650 Ga0495673_0019292 3300047469 Bacteria 3417
651 Ga0495673_0046674 3300047469 Bacteria 1918
652 Ga0495673_0066196 3300047469 Bacteria 1532
653 Ga0495673_0122196 3300047469 Bacteria 1030
654 Ga0495673_0141918 3300047469 Bacteria 935
655 Ga0495681_0001422 3300047470 Bacteria 17992
656 Ga0495681_0001863 3300047470 Bacteria 15484
657 Ga0495681_0009559 3300047470 Bacteria 5957
658 Ga0495681_0016569 3300047470 Bacteria 4122
659 Ga0495681_0019537 3300047470 Bacteria 3696
660 Ga0495681_0020058 3300047470 Bacteria 3634
661 Ga0495681_0023030 3300047470 Bacteria 3318
662 Ga0495681_0023145 3300047470 Bacteria 3306
663 Ga0495681_0023668 3300047470 Bacteria 3256
664 Ga0495681_0068885 3300047470 Bacteria 1608
665 Ga0495681_0099574 3300047470 Bacteria 1272
666 Ga0495681_0122754 3300047470 Bacteria 1113
667 Ga0495684_0034916 3300047471 Bacteria 3858
668 Ga0495686_0007030 3300047472 Bacteria 8497
669 Ga0495686_0017914 3300047472 Bacteria 4762
670 Ga0495686_0024122 3300047472 Bacteria 3999
671 Ga0495686_0130607 3300047472 Bacteria 1489
672 Ga0495686_0158427 3300047472 Bacteria 1324
673 Ga0495686_0470175 3300047472 Bacteria 665
674 Ga0495593_0095484 3300047673 Bacteria 1528
675 Ga0495593_0201389 3300047673 Bacteria 1000
676 Ga0495593_0530165 3300047673 Bacteria 590
677 Ga0495626_0002378 3300048091 Bacteria 13138
678 Ga0495626_0003048 3300048091 Bacteria 11005
679 Ga0495626_0003904 3300048091 Bacteria 9342
680 Ga0495626_0011223 3300048091 Bacteria 4744
681 Ga0495626_0025632 3300048091 Bacteria 2881
682 Ga0495626_0051814 3300048091 Bacteria 1892
683 Ga0495626_0065551 3300048091 Bacteria 1643
684 Ga0495626_0070777 3300048091 Bacteria 1568
685 Ga0495626_0111756 3300048091 Bacteria 1182
686 Ga0495626_0273500 3300048091 Bacteria 672
687 Ga0495626_0441648 3300048091 Bacteria 500
688 Ga0496106_0506540 3300048909 Bacteria 970
689 Ga0496110_0082961 3300048913 Bacteria 2859
690 Ga0496110_0135740 3300048913 Bacteria 2223
691 Ga0496112_0443783 3300048915 Bacteria 1236
692 Ga0496116_0005287 3300048919 Bacteria 12042
693 Ga0496116_0032140 3300048919 Bacteria 3744
694 Ga0496117_0070281 3300048920 Bacteria 2353
695 Ga0496117_0091421 3300048920 Bacteria 1957
696 Ga0496117_0099475 3300048920 Bacteria 1845
697 Ga0496118_0117521 3300048921 Bacteria 1744
698 Ga0496118_0163452 3300048921 Bacteria 1372
699 Ga0496118_0291498 3300048921 Bacteria 901
700 Ga0496118_0291503 3300048921 Bacteria 901
701 Ga0496121_0043623 3300048924 Bacteria 3880
702 Ga0496121_0166086 3300048924 Bacteria 1608
703 Ga0496121_0201868 3300048924 Bacteria 1416
704 Ga0496121_0557501 3300048924 Bacteria 715
705 Ga0496122_0043323 3300048925 Bacteria 3527
706 Ga0496122_0104755 3300048925 Bacteria 1878
707 Ga0496123_0082888 3300048926 Bacteria 1941
708 Ga0496123_0235876 3300048926 Bacteria 912
709 Ga0496124_0005624 3300048927 Bacteria 14021
710 Ga0496124_0037282 3300048927 Bacteria 4230
711 Ga0496124_0171952 3300048927 Bacteria 1676
712 Ga0496124_0523284 3300048927 Bacteria 789
713 Ga0495678_005409 3300049459 Bacteria 7056
714 Ga0495678_010673 3300049459 Bacteria 4444
715 Ga0495678_024727 3300049459 Bacteria 2589
716 Ga0495678_029002 3300049459 Bacteria 2328
717 Ga0495678_035397 3300049459 Bacteria 2047
718 Ga0495678_049114 3300049459 Bacteria 1641
719 Ga0495678_056167 3300049459 Bacteria 1499
720 Ga0495678_059219 3300049459 Bacteria 1444
721 Ga0495678_061968 3300049459 Bacteria 1401
722 Ga0495678_085663 3300049459 Bacteria 1121
723 Ga0495678_093244 3300049459 Bacteria 1056
724 Ga0495678_215356 3300049459 Bacteria 585
725 Ga0495682_0006351 3300049460 Bacteria 4788
726 Ga0495682_0032524 3300049460 Bacteria 1926
727 Ga0495682_0104710 3300049460 Bacteria 1014
728 Ga0495682_0104900 3300049460 Bacteria 1013
729 Ga0495682_0119525 3300049460 Bacteria 943
730 Ga0501222_004958 3300049662 Bacteria 1804
731 Ga0501227_046091 3300049665 Bacteria 1089
732 Ga0501240_005027 3300049673 Bacteria 1563
733 Ga0501241_001976 3300049758 Bacteria 4024
734 Ga0501241_037236 3300049758 Bacteria 934
735 Ga0501241_077586 3300049758 Bacteria 687
736 Ga0501269_002860 3300049766 Bacteria 2104
737 Ga0501226_003326 3300049853 Bacteria 1910
738 nmdc:mga03683_129555_c1 3300050489 Bacteria 1128
739 nmdc:mga03683_471560_c1 3300050489 Bacteria 606
740 nmdc:mga00v17_207045_c1 3300050491 Bacteria 1269
741 nmdc:mga00v17_220580_c1 3300050491 Bacteria 1228
742 nmdc:mga00v17_245669_c1 3300050491 Bacteria 1161
743 nmdc:mga00v17_26786_c1 3300050491 Bacteria 3362
744 nmdc:mga08x19_161261_c1 3300050514 Bacteria 1523
745 nmdc:mga08x19_255445_c1 3300050514 Bacteria 1211
746 nmdc:mga08x19_413294_c1 3300050514 Bacteria 947
747 nmdc:mga08x19_879461_c1 3300050514 Bacteria 636
748 nmdc:mga0sz30_177587_c1 3300050516 Bacteria 944
749 nmdc:mga0sz30_277533_c1 3300050516 Bacteria 747
750 nmdc:mga0sz30_88595_c1 3300050516 Bacteria 619
751 Ga0500647_0450780 3300053091 Bacteria 509
752 Ga0500572_002893 3300053111 Bacteria 4032
753 Ga0500621_082719 3300053126 Bacteria 1285
754 Ga0500568_0059329 3300053139 Bacteria 1485
755 Ga0500586_084470 3300053145 Bacteria 1114
756 2511303292 2511231012 Bacteria 6738011
757 2511318781 2511231015 Bacteria 6598026
758 2511351988 2511231020 Bacteria 6115223
759 2643955194 2643221589 Bacteria 6250934
760 2644023547 2643221602 Bacteria 6249926
761 2739257691 2738543015 Bacteria 6750701
762 2904551818 2904550169 Bacteria 6221258
763 2939637179 2939636861 Bacteria 6297853
764 8056130668 8056125926 Bacteria 6228218
765 8056155359 8056155041 Bacteria 6486948
766 Ga0495584_0005487
767 MRS2a_Contig_520
768 SwRhRL2b_contig_1650147
769 JGI25163J39215_1001572
770 JGI25164J39214_1000446
771 JGI25165J46597_1000861
772 Ga0055538_1000137
773 Ga0055539_1000186
774 Ga0055533_1000187
775 Ga0055532_1000189
776 Ga0055525_1000257
777 Ga0055530_10012001
778 Ga0055540_1038564
779 Ga0055541_1000121
780 Ga0065714_10068720
781 Ga0065714_10071243
782 Ga0065714_10079886
783 Ga0065714_10099421
784 Ga0065714_10111307
785 Ga0065714_10511364
786 Ga0065714_10521255
787 Ga0065704_10001148
788 Ga0065704_10117817
789 Ga0065704_10145183
790 Ga0065704_10267489
791 Ga0065704_10330527
792 Ga0065704_10405749
793 Ga0065712_10138017
794 Ga0070669_100002259
795 Ga0070675_101429338
796 Ga0070662_100001777
797 Ga0068853_100001638
798 Ga0070665_100054387
799 Ga0070665_100342264
800 Ga0068854_100055661
801 Ga0068851_10000031
802 Ga0075365_10590981
803 Ga0075364_10195345
804 Ga0075364_10220953
805 Ga0075364_10280151
806 Ga0075364_10309123
807 Ga0075364_10310427
808 Ga0075364_10369203
809 Ga0075364_10453679
810 Ga0075364_10823882
811 Ga0075364_10865472
812 Ga0075364_10950995
813 Ga0075432_10001282
814 Ga0075432_10002018
815 Ga0075432_10012314
816 Ga0075432_10033852
817 Ga0075432_10060514
818 Ga0075432_10084058
819 Ga0075432_10123204
820 Ga0075432_10143889
821 Ga0075432_10343665
822 Ga0075362_10073177
823 Ga0075362_10080314
824 Ga0075362_10172851
825 Ga0075362_10691601
826 Ga0075369_10086056
827 Ga0075369_10244406
828 Ga0075369_10600020
829 Ga0075436_100190650
830 Ga0075436_100378373
831 Ga0075436_100528707
832 Ga0075436_100994017
833 Ga0075436_101025379
834 Ga0075436_101046234
835 Ga0079104_1001807
836 Ga0079104_1032587
837 Ga0099826_10003825
838 Ga0105251_10003131
839 Ga0105251_10014005
840 Ga0105251_10018427
841 Ga0105244_10016271
842 Ga0105244_10066914
843 Ga0105244_10144899
844 Ga0105244_10192584
845 Ga0105244_10314461
846 Ga0105244_10594813
847 Ga0105250_10011553
848 Ga0105250_10040787
849 Ga0105250_10175167
850 Ga0105246_10106414
851 Ga0157345_1000120
852 Ga0157345_1011404
853 Ga0157347_1008076
854 Ga0157373_10028192
855 Ga0157373_10160940
856 Ga0157371_10171156
857 Ga0157370_10072014
858 Ga0157370_10621064
859 Ga0157370_10636572
860 Ga0157370_11114760
861 Ga0157370_11376947
862 Ga0163162_10083362
863 Ga0163162_11849928
864 Ga0182008_10018397
865 Ga0182008_10045078
866 Ga0182008_10153134
867 Ga0182006_1013223
868 Ga0182007_10037984
869 Ga0182007_10248576
870 Ga0182005_1006536
871 Ga0182005_1063394
872 Ga0163161_10002686
873 Ga0163161_10041163
874 Ga0163161_10130974
875 Ga0163161_10160654
876 Ga0163161_10195851
877 Ga0163161_10306350
878 Ga0163161_10369626
879 Ga0163161_10600390
880 Ga0209435_101032
881 Ga0209760_100106
882 Ga0209784_100032
883 Ga0209566_100036
884 Ga0209674_100054
885 Ga0209147_100248
886 Ga0209563_100055
887 Ga0207427_100004
888 Ga0209437_100028
889 Ga0209258_100755
890 Ga0209646_1000429
891 Ga0209677_100033
892 Ga0209759_1033223
893 Ga0209233_1000008
894 Ga0209676_1000365
895 Ga0209050_1001519
896 Ga0209051_1013522
897 Ga0207656_10000044
898 Ga0207696_1000377
899 Ga0207696_1008926
900 Ga0207655_1013087
901 Ga0207655_1014263
902 Ga0207655_1022968
903 Ga0207655_1032827
904 Ga0207655_1063513
905 Ga0207655_1078412
906 Ga0207655_1152271
907 Ga0207655_1171753
908 Ga0207713_1000859
909 Ga0207713_1002514
910 Ga0207713_1003964
911 Ga0207713_1004063
912 Ga0207713_1021004
913 Ga0207650_10000987
914 Ga0207706_10000117
915 Ga0207706_11375760
916 Ga0207709_10240515
917 Ga0207711_10021198
918 Ga0207639_10000977
919 Ga0209281_1000010
920 Ga0209281_1000049
921 Ga0209281_1003555
922 Ga0209281_1029879
923 Ga0209981_1010858
924 Ga0209282_1007500
925 Ga0207428_10013162
926 Ga0207428_10042647
927 Ga0207428_10042836
928 Ga0207428_10046687
929 Ga0207428_10065074
930 Ga0207428_10109911
931 Ga0207428_10128560
932 Ga0207428_10202901
933 Ga0207428_10286535
934 Ga0207428_10884506
935 Ga0268266_10057074
936 Ga0268266_10228915
937 Ga0314311_1066460
938 Ga0316179_1053443
939 Ga0316178_1123752
940 Ga0316183_1114373
941 Ga0316181_1271327
942 Ga0316182_1313319
943 Ga0307513_10822858
944 Ga0307408_100076241
945 Ga0307408_100080237
946 Ga0307408_101621590
947 Ga0307516_10351205
948 Ga0307405_10030881
949 Ga0307405_10102735
950 Ga0307405_10104555
951 Ga0307405_10774186
952 Ga0307413_10259474
953 Ga0307413_11285939
954 Ga0307413_11582500
955 Ga0307406_10100564
956 Ga0307406_10122395
957 Ga0307406_10683811
958 Ga0307407_10139628
959 Ga0307407_10615791
960 Ga0307412_10005681
961 Ga0307412_10024361
962 Ga0307412_10269981
963 Ga0307412_11047070
964 Ga0307412_11049508
965 Ga0307412_12284523
966 Ga0307409_100047188
967 Ga0307409_100254530
968 Ga0307416_100356710
969 Ga0307416_100417647
970 Ga0307416_100715554
971 Ga0307416_101150704
972 Ga0307414_10054909
973 Ga0307414_10166655
974 Ga0307414_10414948
975 Ga0307414_10464955
976 Ga0307414_10810007
977 Ga0307411_10031044
978 Ga0307411_12163011
979 Ga0307510_10005747
980 Ga0307510_10602894
981 Ga0439438_002414
982 Ga0439438_003562
983 Ga0439438_008927
984 Ga0439438_032684
985 Ga0439438_055500
986 Ga0439447_007775
987 Ga0439447_009183
988 Ga0439447_017895
989 Ga0439447_024064
990 Ga0439447_059753
991 Ga0439466_0012036
992 Ga0439466_0041124
993 Ga0439466_0074881
994 Ga0439465_0003644
995 Ga0439465_0024430
996 Ga0439431_0013316
997 Ga0439445_0002766
998 Ga0439432_002509
999 Ga0439432_066946
1000 Ga0439432_077413
1001 Ga0439451_000388
1002 Ga0439452_000523
1003 Ga0439452_002230
1004 Ga0439452_024258
1005 Ga0439452_076561
1006 Ga0439456_012157
1007 Ga0439456_016543
1008 Ga0439456_054797
1009 Ga0450911_005912
1010 Ga0450911_057630
1011 Ga0450919_003760
1012 Ga0450922_002230
1013 Ga0450923_025933
1014 Ga0450890_001220
1015 Ga0450902_002795
1016 Ga0450902_043952
1017 Ga0450903_008217
1018 Ga0450903_009318
1019 Ga0450903_015175
1020 Ga0450903_020276
1021 Ga0450905_001881
1022 Ga0450905_015273
1023 Ga0450906_004888
1024 Ga0450907_003792
1025 Ga0450907_029504
1026 Ga0450910_006367
1027 Ga0439446_0051035
1028 Ga0439446_0138995
1029 Ga0450908_006497
1030 Ga0439434_0137646
1031 Ga0439460_0004886
1032 Ga0450918_062589
1033 Ga0450901_002160
1034 Ga0495617_002328
1035 Ga0495617_007074
1036 Ga0495617_008250
1037 Ga0495617_037374
1038 Ga0495617_046581
1039 Ga0495617_086087
1040 Ga0495617_092750
1041 Ga0495627_000496
1042 Ga0495627_003932
1043 Ga0495627_010221
1044 Ga0495627_027087
1045 Ga0495627_036546
1046 Ga0495627_049449
1047 Ga0495627_096657
1048 Ga0495627_100949
1049 Ga0495603_0043565
1050 Ga0495603_0782325
1051 Ga0495590_0001399
1052 Ga0495590_0008908
1053 Ga0495590_0022445
1054 Ga0495590_0079357
1055 Ga0495590_0089159
1056 Ga0495591_000926
1057 Ga0495591_006595
1058 Ga0495591_015292
1059 Ga0495591_027098
1060 Ga0495591_040217
1061 Ga0495591_042398
1062 Ga0495591_044306
1063 Ga0495629_0021666
1064 Ga0495638_0005113
1065 Ga0495638_0012946
1066 Ga0495638_0017539
1067 Ga0495638_0027451
1068 Ga0495638_0029678
1069 Ga0495638_0045556
1070 Ga0495638_0129516
1071 Ga0495638_0144590
1072 Ga0495638_0150055
1073 Ga0495638_0160663
1074 Ga0495638_0306736
1075 Ga0495638_0570781
1076 Ga0495653_0004647
1077 Ga0495653_0004686
1078 Ga0495653_0062904
1079 Ga0495650_0011262
1080 Ga0495650_0015141
1081 Ga0495650_0018377
1082 Ga0495650_0053071
1083 Ga0495650_0063915
1084 Ga0495582_0030058
1085 Ga0495605_0003048
1086 Ga0495605_0003479
1087 Ga0495605_0042432
1088 Ga0495605_0053517
1089 Ga0495605_0056765
1090 Ga0495605_0064939
1091 Ga0495605_0080082
1092 Ga0495605_0119658
1093 Ga0495605_0167264
1094 Ga0495605_0279133
1095 Ga0495639_0000543
1096 Ga0495639_0011193
1097 Ga0495639_0121056
1098 Ga0495584_0003173
1099 Ga0495584_0003361
1100 Ga0495584_0003474
1101 Ga0495584_0012727
1102 Ga0495584_0015589
1103 Ga0495584_0016351
1104 Ga0495584_0108408
1105 Ga0495584_0125916
1106 Ga0495584_0135729
1107 Ga0495584_0307546
1108 Ga0495585_0002538
1109 Ga0495585_0006873
1110 Ga0495585_0008634
1111 Ga0495585_0082983
1112 Ga0495585_0093837
1113 Ga0495585_0096228
1114 Ga0495585_0112506
1115 Ga0495585_0152246
1116 Ga0495594_0146440
1117 Ga0495594_0471589
1118 Ga0495596_0000653
1119 Ga0495596_0003447
1120 Ga0495607_0004794
1121 Ga0495607_0012338
1122 Ga0495607_0023456
1123 Ga0495607_0037265
1124 Ga0495607_0053663
1125 Ga0495607_0076483
1126 Ga0495607_0103106
1127 Ga0495607_0155281
1128 Ga0495607_0209301
1129 Ga0495583_0016786
1130 Ga0495583_0027307
1131 Ga0495583_0067857
1132 Ga0495583_0107859
1133 Ga0495583_0128362
1134 Ga0495606_0008889
1135 Ga0495606_0015365
1136 Ga0495606_0021192
1137 Ga0495606_0050983
1138 Ga0495606_0091066
1139 Ga0495606_0104806
1140 Ga0495606_0119807
1141 Ga0495606_0169922
1142 Ga0495610_0007785
1143 Ga0495610_0008059
1144 Ga0495610_0009573
1145 Ga0495610_0011606
1146 Ga0495610_0028453
1147 Ga0495610_0044729
1148 Ga0495610_0118254
1149 Ga0495610_0343197
1150 Ga0495616_0012135
1151 Ga0495616_0012435
1152 Ga0495616_0039527
1153 Ga0495616_0061437
1154 Ga0495616_0147336
1155 Ga0495616_0331787
1156 Ga0495620_0006238
1157 Ga0495620_0012554
1158 Ga0495620_0054925
1159 Ga0495620_0063798
1160 Ga0495620_0080268
1161 Ga0495630_0010241
1162 Ga0495631_0001105
1163 Ga0495631_0002107
1164 Ga0495631_0007735
1165 Ga0495631_0027198
1166 Ga0495631_0068278
1167 Ga0495631_0131451
1168 Ga0495631_0291184
1169 Ga0495632_0002291
1170 Ga0495632_0005105
1171 Ga0495632_0008024
1172 Ga0495632_0025562
1173 Ga0495632_0056109
1174 Ga0495632_0060841
1175 Ga0495632_0061527
1176 Ga0495632_0106125
1177 Ga0495632_0147640
1178 Ga0495632_0160270
1179 Ga0495632_0262069
1180 Ga0495637_0001279
1181 Ga0495637_0003102
1182 Ga0495637_0013511
1183 Ga0495637_0014237
1184 Ga0495637_0015893
1185 Ga0495637_0018857
1186 Ga0495637_0020246
1187 Ga0495637_0036415
1188 Ga0495637_0078417
1189 Ga0495637_0103638
1190 Ga0495637_0110230
1191 Ga0495643_0014005
1192 Ga0495643_0018386
1193 Ga0495643_0019963
1194 Ga0495643_0021023
1195 Ga0495643_0048721
1196 Ga0495643_0082869
1197 Ga0495643_0089508
1198 Ga0495643_0132089
1199 Ga0495643_0205064
1200 Ga0495644_0000852
1201 Ga0495644_0005971
1202 Ga0495644_0013512
1203 Ga0495644_0028364
1204 Ga0495644_0071300
1205 Ga0495644_0083143
1206 Ga0495644_0105968
1207 Ga0495648_0011394
1208 Ga0495648_0020749
1209 Ga0495648_0026601
1210 Ga0495648_0028911
1211 Ga0495648_0031032
1212 Ga0495648_0036027
1213 Ga0495648_0063639
1214 Ga0495648_0078278
1215 Ga0495648_0115022
1216 Ga0495648_0199011
1217 Ga0495648_0374782
1218 Ga0495666_0013826
1219 Ga0495666_0094092
1220 Ga0495666_0214549
1221 Ga0495642_0001561
1222 Ga0495642_0006529
1223 Ga0495654_0003247
1224 Ga0495654_0003478
1225 Ga0495654_0006687
1226 Ga0495654_0009053
1227 Ga0495654_0019189
1228 Ga0495654_0022942
1229 Ga0495654_0028984
1230 Ga0495654_0034869
1231 Ga0495654_0036225
1232 Ga0495654_0070543
1233 Ga0495654_0071820
1234 Ga0495654_0080394
1235 Ga0495654_0109942
1236 Ga0495654_0135783
1237 Ga0495654_0159930
1238 Ga0495654_0195211
1239 Ga0495586_0166510
1240 Ga0495586_0443090
1241 Ga0495587_0030834
1242 Ga0495609_0002981
1243 Ga0495609_0084763
1244 Ga0495609_0090944
1245 Ga0495609_0177883
1246 Ga0495597_0009221
1247 Ga0495597_0011626
1248 Ga0495597_0011951
1249 Ga0495597_0036187
1250 Ga0495597_0051726
1251 Ga0495597_0067519
1252 Ga0495597_0120378
1253 Ga0495597_0239828
1254 Ga0495645_0208219
1255 Ga0495622_0003422
1256 Ga0495622_0005124
1257 Ga0495622_0006482
1258 Ga0495622_0035534
1259 Ga0495622_0101796
1260 Ga0495622_0141019
1261 Ga0495633_0014110
1262 Ga0495633_0015141
1263 Ga0495633_0103717
1264 Ga0495633_0132101
1265 Ga0495633_0218859
1266 Ga0495656_0170228
1267 Ga0495656_0581572
1268 Ga0495668_0002257
1269 Ga0495668_0009836
1270 Ga0495668_0020099
1271 Ga0495668_0047270
1272 Ga0495668_0734012
1273 Ga0495634_0238114
1274 Ga0495611_0055401
1275 Ga0495611_0073803
1276 Ga0495611_0080457
1277 Ga0495611_0113417
1278 Ga0495611_0117572
1279 Ga0495611_0374250
1280 Ga0495625_0008545
1281 Ga0495625_0008967
1282 Ga0495625_0013349
1283 Ga0495625_0034530
1284 Ga0495625_0037274
1285 Ga0495625_0125439
1286 Ga0495625_0222371
1287 Ga0495635_0010877
1288 Ga0495659_0002189
1289 Ga0495659_0125730
1290 Ga0495659_0228280
1291 Ga0495661_0005123
1292 Ga0495661_0007973
1293 Ga0495661_0027312
1294 Ga0495661_0081476
1295 Ga0495661_0106983
1296 Ga0495661_0111263
1297 Ga0495661_0114494
1298 Ga0495661_0125281
1299 Ga0495661_0141508
1300 Ga0495588_0011580
1301 Ga0495588_0025100
1302 Ga0495588_0200433
1303 Ga0495588_0204479
1304 Ga0495588_0730010
1305 Ga0495657_0163570
1306 Ga0495623_0043056
1307 Ga0495646_0105141
1308 Ga0495669_0001327
1309 Ga0495669_0204988
1310 Ga0495613_0160178
1311 Ga0495670_0004375
1312 Ga0495670_0006080
1313 Ga0495670_0012361
1314 Ga0495670_0030013
1315 Ga0495670_0055268
1316 Ga0495670_0291519
1317 Ga0495670_0350648
1318 Ga0495670_0396378
1319 Ga0495670_0840650
1320 Ga0495671_0001455
1321 Ga0495671_0012671
1322 Ga0495671_0022602
1323 Ga0495671_0022982
1324 Ga0495671_0023045
1325 Ga0495671_0057030
1326 Ga0495671_0064730
1327 Ga0495671_0095238
1328 Ga0495671_0101983
1329 Ga0495671_0226038
1330 Ga0495671_0234069
1331 Ga0495649_0005116
1332 Ga0495649_0008842
1333 Ga0495649_0013089
1334 Ga0495649_0018010
1335 Ga0495649_0019428
1336 Ga0495649_0024397
1337 Ga0495649_0027145
1338 Ga0495649_0032185
1339 Ga0495649_0052512
1340 Ga0495649_0064291
1341 Ga0495649_0111394
1342 Ga0495589_0001150
1343 Ga0495589_0013109
1344 Ga0495589_0015041
1345 Ga0495589_0015659
1346 Ga0495589_0024103
1347 Ga0495589_0059771
1348 Ga0495589_0105656
1349 Ga0495589_0411385
1350 Ga0495600_0056705
1351 Ga0495600_0090207
1352 Ga0495600_0521716
1353 Ga0495660_0007643
1354 Ga0495660_0015967
1355 Ga0495660_0022740
1356 Ga0495660_0035439
1357 Ga0495660_0035809
1358 Ga0495660_0051128
1359 Ga0495660_0086619
1360 Ga0495660_0104285
1361 Ga0495660_0106952
1362 Ga0495660_0114857
1363 Ga0495660_0142255
1364 Ga0495660_0167557
1365 Ga0495660_0168261
1366 Ga0495660_0215380
1367 Ga0495660_0225738
1368 Ga0495660_0272335
1369 Ga0495660_0328993
1370 Ga0495581_0027287
1371 Ga0495581_0116090
1372 Ga0495604_0304493
1373 Ga0495604_0311556
1374 Ga0495636_0364602
1375 Ga0495674_0631566
1376 Ga0495672_0001779
1377 Ga0495672_0002617
1378 Ga0495672_0007784
1379 Ga0495672_0020330
1380 Ga0495672_0020857
1381 Ga0495672_0028539
1382 Ga0495672_0035728
1383 Ga0495672_0053209
1384 Ga0495672_0080148
1385 Ga0495672_0125438
1386 Ga0495672_0175415
1387 Ga0495672_0310791
1388 Ga0495676_0009200
1389 Ga0495680_0012375
1390 Ga0495680_0042231
1391 Ga0495680_0058783
1392 Ga0495683_0006656
1393 Ga0495683_0007518
1394 Ga0495683_0020425
1395 Ga0495683_0022977
1396 Ga0495683_0028127
1397 Ga0495683_0085227
1398 Ga0495683_0129983
1399 Ga0495683_0187802
1400 Ga0495683_0448714
1401 Ga0495687_012005
1402 Ga0495687_018566
1403 Ga0495687_022015
1404 Ga0495675_0029117
1405 Ga0495679_009287
1406 Ga0495679_009857
1407 Ga0495679_010358
1408 Ga0495679_019761
1409 Ga0495679_060918
1410 Ga0495679_072255
1411 Ga0495685_063733
1412 Ga0495673_0002096
1413 Ga0495673_0012041
1414 Ga0495673_0015287
1415 Ga0495673_0019292
1416 Ga0495673_0046674
1417 Ga0495673_0066196
1418 Ga0495673_0122196
1419 Ga0495673_0141918
1420 Ga0495681_0001422
1421 Ga0495681_0001863
1422 Ga0495681_0009559
1423 Ga0495681_0016569
1424 Ga0495681_0019537
1425 Ga0495681_0020058
1426 Ga0495681_0023030
1427 Ga0495681_0023145
1428 Ga0495681_0023668
1429 Ga0495681_0068885
1430 Ga0495681_0099574
1431 Ga0495681_0122754
1432 Ga0495684_0034916
1433 Ga0495686_0007030
1434 Ga0495686_0017914
1435 Ga0495686_0024122
1436 Ga0495686_0130607
1437 Ga0495686_0158427
1438 Ga0495686_0470175
1439 Ga0495593_0095484
1440 Ga0495593_0201389
1441 Ga0495593_0530165
1442 Ga0495626_0002378
1443 Ga0495626_0003048
1444 Ga0495626_0003904
1445 Ga0495626_0011223
1446 Ga0495626_0025632
1447 Ga0495626_0051814
1448 Ga0495626_0065551
1449 Ga0495626_0070777
1450 Ga0495626_0111756
1451 Ga0495626_0273500
1452 Ga0495626_0441648
1453 Ga0496106_0506540
1454 Ga0496110_0082961
1455 Ga0496110_0135740
1456 Ga0496112_0443783
1457 Ga0496116_0005287
1458 Ga0496116_0032140
1459 Ga0496117_0070281
1460 Ga0496117_0091421
1461 Ga0496117_0099475
1462 Ga0496118_0117521
1463 Ga0496118_0163452
1464 Ga0496118_0291498
1465 Ga0496118_0291503
1466 Ga0496121_0043623
1467 Ga0496121_0166086
1468 Ga0496121_0201868
1469 Ga0496121_0557501
1470 Ga0496122_0043323
1471 Ga0496122_0104755
1472 Ga0496123_0082888
1473 Ga0496123_0235876
1474 Ga0496124_0005624
1475 Ga0496124_0037282
1476 Ga0496124_0171952
1477 Ga0496124_0523284
1478 Ga0495678_005409
1479 Ga0495678_010673
1480 Ga0495678_024727
1481 Ga0495678_029002
1482 Ga0495678_035397
1483 Ga0495678_049114
1484 Ga0495678_056167
1485 Ga0495678_059219
1486 Ga0495678_061968
1487 Ga0495678_085663
1488 Ga0495678_093244
1489 Ga0495678_215356
1490 Ga0495682_0006351
1491 Ga0495682_0032524
1492 Ga0495682_0104710
1493 Ga0495682_0104900
1494 Ga0495682_0119525
1495 Ga0501222_004958
1496 Ga0501227_046091
1497 Ga0501240_005027
1498 Ga0501241_001976
1499 Ga0501241_037236
1500 Ga0501241_077586
1501 Ga0501269_002860
1502 Ga0501226_003326
1503 nmdc:mga03683_129555_c1
1504 nmdc:mga03683_471560_c1
1505 nmdc:mga00v17_207045_c1
1506 nmdc:mga00v17_220580_c1
1507 nmdc:mga00v17_245669_c1
1508 nmdc:mga00v17_26786_c1
1509 nmdc:mga08x19_161261_c1
1510 nmdc:mga08x19_255445_c1
1511 nmdc:mga08x19_413294_c1
1512 nmdc:mga08x19_879461_c1
1513 nmdc:mga0sz30_177587_c1
1514 nmdc:mga0sz30_277533_c1
1515 nmdc:mga0sz30_88595_c1
1516 Ga0500647_0450780
1517 Ga0500572_002893
1518 Ga0500621_082719
1519 Ga0500568_0059329
1520 Ga0500586_084470
1521 2511303292
1522 2511318781
1523 2511351988
1524 2643955194
1525 2644023547
1526 2739257691
1527 2904551818
1528 2939637179
1529 8056130668
1530 8056155359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13467

RHH_4

Ribbon-helix-helix domain

61

129

0.92

Map