F479658

General Info

Members Datasets Scaffolds Average Seq Length
762 523 474 279

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0026975|Ga0501038_0026975_3581_4567
Length 328
Sequence VEQEAEHLMAEQIQKDAELLVSDFTAPSANRRGLRKLAEESPEPQPEIPTEKMTPGRRIARIAMYVGLVIFAIGLLTPFVWMVLSSFKSANEVFSVPVKWLPETWVWQNYIDIWTESNMLVWIRNTLFLAVVVTFLQVLTGSFAAYGFARMRFRGRDVLFLLYVGTIAVPWQSYMIPQFILLSNFKVSNTLWSIILLQAFGAFGVFLMKQFYETIPEELSEAARIDGLSEYAIWRKIMLPLSVPALASLTLLTFVSTWNDYLGPLIYLRNPDLWTIQLGLKSFVSNLFDTNYALLFAGLCISVVPIAIIFMLGQKYFVEGSATSGMKG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
21 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
22 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
23 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
24 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
25 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
26 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
27 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
28 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
29 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
30 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
34 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
35 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
36 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
37 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
38 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
39 2643221558 Rhizobium sp. Root149 Isolate Unclassified
40 2643221591 Devosia sp. Root685 Isolate Unclassified
41 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
42 2643221693 Rhizobium sp. Root491 Isolate Unclassified
43 2643221734 Bosea sp. Root670 Isolate Unclassified
44 2643221736 Bosea sp. Root483D1 Isolate Unclassified
45 2718217882 Rhizobium sp. N741 Isolate Nodule
46 2718217927 Rhizobium sp. N324 Isolate Nodule
47 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
48 2718218009 Rhizobium sp. N561 Isolate Nodule
49 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
50 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
51 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
52 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
53 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
54 2718218363 Rhizobium sp. N113 Isolate Nodule
55 2718218365 Rhizobium sp. N731 Isolate Nodule
56 2718218366 Rhizobium sp. N621 Isolate Nodule
57 2718218423 Rhizobium sp. N941 Isolate Nodule
58 2721755514 Rhizobium sp. N6212 Isolate Nodule
59 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
60 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
61 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
62 2721755809 Rhizobium sp. N541 Isolate Nodule
63 2721755810 Rhizobium sp. N871 Isolate Nodule
64 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
65 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
66 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
67 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
68 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
69 2728369365 Rhizobium sp. N1341 Isolate Nodule
70 2728369397 Rhizobium sp. N1314 Isolate Nodule
71 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
72 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
73 2738543024 Aminobacter sp. AP02 Isolate Unclassified
74 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
75 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
76 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
77 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
78 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
79 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
80 2751185800 Brucella pituitosa AA2 Isolate Unclassified
81 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
82 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
83 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
84 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
85 2773857925 Microvirga vignae BR3299 Isolate Unclassified
86 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
87 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
88 2791355256 Rhizobium sp. M10 Isolate Nodule
89 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
90 2791355261 Rhizobium sp. J15 Isolate Nodule
91 2791355262 Rhizobium sp. M1 Isolate Nodule
92 2791355263 Rhizobium chutanense C5 Isolate Nodule
93 2791355264 Rhizobium sp. S9 Isolate Nodule
94 2791355265 Rhizobium sp. H4 Isolate Nodule
95 2791355266 Rhizobium sp. L43 Isolate Nodule
96 2791355267 Rhizobium sp. L18 Isolate Nodule
97 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
98 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
99 2802429633 Rhizobium anhuiense J3 Isolate Nodule
100 2802429634 Rhizobium anhuiense S10 Isolate Nodule
101 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
102 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
103 2802429637 Rhizobium anhuiense C15 Isolate Nodule
104 2808606394 Promicromonospora sp. C35 Isolate Unclassified
105 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
106 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
107 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
108 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
109 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
110 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
111 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
112 2838048938 Rhizobium pisi 27/80 Isolate Nodule
113 2838061910 Rhizobium phaseoli L15 Isolate Nodule
114 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
115 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
116 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
117 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
118 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
119 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
120 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
121 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
122 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
123 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
124 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
125 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
126 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
127 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
128 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
129 2841760612 Bosea sp. Tri-49 Isolate Nodule
130 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
131 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
132 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
133 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
134 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
135 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
136 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
137 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
138 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
139 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
140 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
141 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
142 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
143 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
144 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
145 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
146 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
147 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
148 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
149 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
150 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
151 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
152 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
153 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
154 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
155 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
156 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
157 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
158 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
159 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
160 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
161 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
162 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
163 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
164 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
165 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
166 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
167 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
168 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
169 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
170 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
171 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
172 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
173 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
174 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
175 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
176 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
177 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
178 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
179 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
180 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
181 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
182 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
183 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
184 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
185 2844104063 Bosea sp. Tri-39 Isolate Nodule
186 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
187 2851182111 Bosea sp. Tri-44 Isolate Nodule
188 2851246043 Bosea sp. Tri-54 Isolate Nodule
189 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
190 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
191 2854911287 Brucella lupini LUP21 Isolate Unclassified
192 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
193 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
194 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
195 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
196 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
197 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
198 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
199 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
200 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
201 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
202 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
203 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
204 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
205 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
206 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
207 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
208 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
209 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
210 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
211 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
212 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
213 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
214 2932401849 Devosia sp. 2618 Isolate Rhizosphere
215 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
216 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
217 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
218 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
219 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
220 2933599457 Rhizobium phaseoli M3 Isolate Nodule
221 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
222 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
223 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
224 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
225 2936381700 Rhizobium chutanense C16 Isolate Unclassified
226 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
227 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
228 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
229 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
230 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
231 2996893221 Rhizobium sp. R635 Isolate Nodule
232 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
233 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
234 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
235 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
236 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
237 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
238 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
239 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
240 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
241 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
242 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
243 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
244 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
245 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
246 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
247 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
248 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
249 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
250 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
251 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
252 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
253 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
254 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
255 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
256 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
257 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
258 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
259 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
260 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
261 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
262 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
263 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
264 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
265 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
266 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
267 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
268 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
269 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
270 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
271 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
272 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
273 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
274 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
275 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
276 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
277 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
278 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
279 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
280 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
281 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
282 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
283 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
284 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
285 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
286 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
287 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
288 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
289 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
290 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
291 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
292 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
293 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
294 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
295 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
296 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
297 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
298 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
299 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
300 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
301 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
302 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
303 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
304 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
305 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
306 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
307 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
308 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
309 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
310 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
311 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
312 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
313 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
314 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
315 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
316 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
317 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
318 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
319 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
320 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
321 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
322 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
323 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
325 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
326 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
328 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
331 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
333 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
335 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
336 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
366 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
368 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
369 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
372 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
373 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
374 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
375 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
376 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
377 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
378 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
379 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
380 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
381 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
382 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
383 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
384 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
385 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
386 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
387 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
388 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
389 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
390 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
391 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
392 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
393 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
394 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
395 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
396 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
397 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
398 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
399 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
400 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
401 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
402 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
403 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
404 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
405 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
406 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
407 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
408 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
409 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
410 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
411 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
412 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
413 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
414 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
415 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
416 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
417 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
418 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
419 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
423 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
440 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
452 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
453 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
454 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
455 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
472 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
473 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
474 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
475 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
476 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
477 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
478 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
479 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
480 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
483 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
484 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
485 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
486 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
487 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
488 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
489 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
490 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
491 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
492 8005275841 Rhizobium sp. N4311 Isolate Nodule
493 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
494 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
495 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
496 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
497 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
498 8005382845 Rhizobium sp. R634 Isolate Nodule
499 8005395548 Rhizobium sp. R339 Isolate Nodule
500 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
501 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
502 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
503 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
504 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
505 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
506 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
507 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
508 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
509 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
510 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
511 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
512 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
513 8018176218 Rhizobium sp. N122 Isolate Nodule
514 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
515 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
516 8024501048 Rhizobium sp. H4 Isolate Nodule
517 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
518 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
519 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
520 8056382006 Rhizobium croatiense 13T Isolate Nodule
521 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
522 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
523 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.07
Metatranscriptomes 0.13
Isolates 37.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 18.24
Nodule 27.03
Rhizoplane 1.05
Rhizosphere 36.88
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1019340 3300002773 Bacteria 1240
2 JGI25159J45721_1000428 3300002987 Bacteria 19374
3 JGI25159J45721_1001350 3300002987 Bacteria 10286
4 JGI25159J45721_1003595 3300002987 Bacteria 5419
5 JGI25151J46595_10000050 3300003187 Bacteria 160395
6 JGI25151J46595_10000959 3300003187 Bacteria 22046
7 JGI25165J46597_1001956 3300003214 Bacteria 8078
8 JGI25153J46596_10002309 3300003215 Bacteria 11089
9 JGI25153J46596_10025630 3300003215 Bacteria 2103
10 JGI25153J46596_10035127 3300003215 Bacteria 1628
11 JGI25153J46596_10052182 3300003215 Bacteria 1166
12 rootH2_10001863 3300003320 Bacteria 6444
13 JGI25160J50197_1002115 3300003354 Bacteria 9444
14 JGI25161J50226_1000600 3300003374 Bacteria 14970
15 Ga0006562J51391_1002952 3300003578 Bacteria 7130
16 Ga0055539_1006565 3300003752 Bacteria 1486
17 Ga0055526_1000212 3300003771 Bacteria 50215
18 Ga0055526_1001290 3300003771 Bacteria 17969
19 Ga0055526_1002100 3300003771 Bacteria 13673
20 Ga0055524_1000018 3300003775 Bacteria 234806
21 Ga0055524_1003912 3300003775 Bacteria 7056
22 Ga0055524_1014379 3300003775 Bacteria 2934
23 Ga0055524_1015814 3300003775 Bacteria 2734
24 Ga0055536_1001192 3300003781 Bacteria 16157
25 Ga0055528_1013145 3300003790 Bacteria 3160
26 Ga0055528_1014938 3300003790 Bacteria 2835
27 Ga0055530_10010116 3300003791 Bacteria 3531
28 Ga0055540_1000098 3300003792 Bacteria 96649
29 Ga0055540_1003220 3300003792 Bacteria 8005
30 Ga0055540_1035828 3300003792 Bacteria 1106
31 Ga0055531_10000527 3300003794 Bacteria 34315
32 Ga0058692_1003432 3300003856 Bacteria 4886
33 Ga0055543_1000019 3300004625 Bacteria 161035
34 Ga0055543_1000477 3300004625 Bacteria 23520
35 Ga0065165_1000014 3300005262 Bacteria 292366
36 Ga0065714_10004509 3300005288 Bacteria 8398
37 Ga0065714_10092202 3300005288 Bacteria 1885
38 Ga0070658_10031142 3300005327 Bacteria 4283
39 Ga0070658_10365111 3300005327 Bacteria 1237
40 Ga0070670_100027564 3300005331 Bacteria 4886
41 Ga0070661_100015601 3300005344 Bacteria 5362
42 Ga0070668_100001518 3300005347 Bacteria 16767
43 Ga0070668_100023340 3300005347 Bacteria 4679
44 Ga0070688_100381391 3300005365 Bacteria 1039
45 Ga0070659_100050009 3300005366 Bacteria 3288
46 Ga0070709_10000541 3300005434 Bacteria 22128
47 Ga0070714_100000252 3300005435 Bacteria 41753
48 Ga0070714_100012899 3300005435 Bacteria 6681
49 Ga0070710_10000365 3300005437 Bacteria 21212
50 Ga0070711_100016976 3300005439 Bacteria 4628
51 Ga0070708_100648439 3300005445 Bacteria 995
52 Ga0070663_100060101 3300005455 Bacteria 2732
53 Ga0070663_100081065 3300005455 Bacteria 2385
54 Ga0070698_100075907 3300005471 Bacteria 3364
55 Ga0070699_100022027 3300005518 Bacteria 5489
56 Ga0070679_100048396 3300005530 Bacteria 4236
57 Ga0070679_100533888 3300005530 Bacteria 1117
58 Ga0070697_100364639 3300005536 Bacteria 1249
59 Ga0068853_100028275 3300005539 Bacteria 4714
60 Ga0068853_100109925 3300005539 Bacteria 2448
61 Ga0068853_100183373 3300005539 Bacteria 1899
62 Ga0068857_100722631 3300005577 Bacteria 947
63 Ga0068852_100012890 3300005616 Bacteria 6373
64 Ga0068852_100018090 3300005616 Bacteria 5544
65 Ga0068863_100236705 3300005841 Bacteria 1762
66 Ga0068858_100176361 3300005842 Bacteria 2017
67 Ga0068860_100000194 3300005843 Bacteria 97196
68 Ga0068860_100059950 3300005843 Bacteria 3617
69 Ga0068860_100357424 3300005843 Bacteria 1438
70 Ga0068860_100536457 3300005843 Bacteria 1171
71 Ga0068862_100047343 3300005844 Bacteria 3669
72 Ga0081539_10053734 3300005985 Bacteria 2253
73 Ga0075365_10001478 3300006038 Bacteria 10696
74 Ga0075365_10012433 3300006038 Bacteria 5058
75 Ga0075368_10000042 3300006042 Bacteria 29657
76 Ga0075368_10025875 3300006042 Bacteria 2253
77 Ga0075363_100000055 3300006048 Bacteria 22632
78 Ga0075363_100013634 3300006048 Bacteria 3948
79 Ga0075364_10000047 3300006051 Bacteria 43094
80 Ga0075364_10001963 3300006051 Bacteria 11460
81 Ga0075364_10002798 3300006051 Bacteria 9812
82 Ga0075364_10020448 3300006051 Bacteria 4163
83 Ga0070716_100001610 3300006173 Bacteria 10163
84 Ga0070712_100002704 3300006175 Bacteria 10953
85 Ga0075362_10005203 3300006177 Bacteria 4742
86 Ga0075362_10006866 3300006177 Bacteria 4264
87 Ga0075367_10000059 3300006178 Bacteria 26861
88 Ga0075367_10108753 3300006178 Bacteria 1700
89 Ga0075369_10000424 3300006186 Bacteria 12828
90 Ga0075369_10053399 3300006186 Bacteria 1754
91 Ga0075366_10000202 3300006195 Bacteria 26309
92 Ga0097621_100423938 3300006237 Bacteria 1195
93 Ga0075370_10000166 3300006353 Bacteria 22632
94 Ga0075434_100305520 3300006871 Bacteria 1611
95 Ga0079104_1000313 3300006946 Bacteria 61175
96 Ga0099826_10012835 3300006948 Bacteria 6314
97 Ga0105240_10232564 3300009093 Bacteria 2141
98 Ga0105245_10172262 3300009098 Bacteria 2062
99 Ga0105247_10003108 3300009101 Bacteria 10976
100 Ga0114129_10000701 3300009147 Bacteria 42196
101 Ga0105243_10103263 3300009148 Bacteria 2370
102 Ga0105241_10049632 3300009174 Bacteria 3196
103 Ga0105248_10223763 3300009177 Bacteria 2118
104 Ga0105237_10000884 3300009545 Bacteria 40454
105 Ga0105237_10008637 3300009545 Bacteria 11008
106 Ga0105237_10223421 3300009545 Bacteria 1883
107 Ga0105238_10022137 3300009551 Bacteria 6482
108 Ga0105249_10297379 3300009553 Bacteria 1618
109 Ga0123341_1000002 3300009765 Bacteria 191257
110 Ga0123342_1024109 3300009766 Bacteria 3853
111 Ga0105239_10005290 3300010375 Bacteria 15165
112 Ga0105239_10278308 3300010375 Bacteria 1883
113 Ga0105246_10226987 3300011119 Bacteria 1468
114 Ga0157314_1001728 3300012500 Bacteria 1533
115 Ga0157373_10003272 3300013100 Bacteria 12235
116 Ga0157371_10016778 3300013102 Bacteria 5455
117 Ga0157371_10246035 3300013102 Bacteria 1287
118 Ga0157370_10000149 3300013104 Bacteria 85824
119 Ga0157370_10035907 3300013104 Bacteria 4813
120 Ga0157370_10048863 3300013104 Bacteria 4052
121 Ga0157370_10059329 3300013104 Bacteria 3635
122 Ga0157369_10024714 3300013105 Bacteria 6677
123 Ga0157369_10239232 3300013105 Bacteria 1896
124 Ga0157369_10392116 3300013105 Bacteria 1441
125 Ga0157369_10565540 3300013105 Bacteria 1175
126 Ga0171462_1002 3300013250 Bacteria 1052134
127 Ga0171462_1030 3300013250 Bacteria 105165
128 Ga0157374_10238327 3300013296 Bacteria 1788
129 Ga0157378_10501573 3300013297 Bacteria 1212
130 Ga0157372_10177191 3300013307 Bacteria 2468
131 Ga0157372_10232779 3300013307 Bacteria 2136
132 Ga0157372_10517641 3300013307 Bacteria 1391
133 Ga0157375_10377974 3300013308 Bacteria 1583
134 Ga0163163_10475225 3300014325 Bacteria 1311
135 Ga0163163_10720633 3300014325 Bacteria 1061
136 Ga0163161_10074113 3300017792 Bacteria 2496
137 Ga0213875_10000070 3300021388 Bacteria 120272
138 Ga0213875_10037015 3300021388 Bacteria 2300
139 Ga0209436_100038 3300025208 Bacteria 76733
140 Ga0209437_100239 3300025233 Bacteria 89942
141 Ga0209677_102856 3300025253 Bacteria 6090
142 Ga0209129_1002259 3300025258 Bacteria 9613
143 Ga0209129_1002413 3300025258 Bacteria 9187
144 Ga0209129_1002652 3300025258 Bacteria 8483
145 Ga0209233_1000245 3300025261 Bacteria 89961
146 Ga0209673_1000206 3300025273 Bacteria 118136
147 Ga0209673_1001634 3300025273 Bacteria 19458
148 Ga0209673_1003851 3300025273 Bacteria 8468
149 Ga0209673_1007844 3300025273 Bacteria 4838
150 Ga0209130_1000024 3300025284 Bacteria 354212
151 Ga0209130_1000097 3300025284 Bacteria 143750
152 Ga0209675_1004488 3300025291 Bacteria 6184
153 Ga0209676_1000792 3300025292 Bacteria 41741
154 Ga0209676_1043469 3300025292 Bacteria 1239
155 Ga0209025_1000017 3300025294 Bacteria 768983
156 Ga0209025_1000190 3300025294 Bacteria 153726
157 Ga0209025_1001592 3300025294 Bacteria 28567
158 Ga0209564_1000059 3300025295 Bacteria 328782
159 Ga0209564_1000721 3300025295 Bacteria 47513
160 Ga0209564_1000987 3300025295 Bacteria 35584
161 Ga0209564_1019184 3300025295 Bacteria 2569
162 Ga0209758_1000115 3300025297 Bacteria 199268
163 Ga0209758_1000245 3300025297 Bacteria 111769
164 Ga0209758_1000505 3300025297 Bacteria 63185
165 Ga0209758_1001100 3300025297 Bacteria 34985
166 Ga0209758_1001881 3300025297 Bacteria 22986
167 Ga0209758_1010146 3300025297 Bacteria 5695
168 Ga0209050_1006362 3300025298 Bacteria 7017
169 Ga0209256_1000032 3300025299 Bacteria 395041
170 Ga0209256_1004637 3300025299 Bacteria 8479
171 Ga0209256_1005767 3300025299 Bacteria 6917
172 Ga0209256_1018978 3300025299 Bacteria 2209
173 Ga0207426_1000003 3300025302 Bacteria 1063212
174 Ga0207426_1000109 3300025302 Bacteria 238665
175 Ga0209051_1000264 3300025303 Bacteria 87736
176 Ga0209051_1002028 3300025303 Bacteria 15424
177 Ga0209051_1006144 3300025303 Bacteria 6823
178 Ga0209051_1009703 3300025303 Bacteria 4935
179 Ga0209051_1030690 3300025303 Bacteria 2081
180 Ga0209257_1003175 3300025304 Bacteria 14617
181 Ga0209257_1004220 3300025304 Bacteria 11383
182 Ga0209257_1021098 3300025304 Bacteria 2379
183 Ga0209257_1021550 3300025304 Bacteria 2336
184 Ga0207692_10000098 3300025898 Bacteria 25627
185 Ga0207710_10009254 3300025900 Bacteria 4142
186 Ga0207699_10002623 3300025906 Bacteria 8491
187 Ga0207705_10004425 3300025909 Bacteria 10621
188 Ga0207705_10054635 3300025909 Bacteria 2878
189 Ga0207705_10198615 3300025909 Bacteria 1519
190 Ga0207695_10158976 3300025913 Bacteria 2193
191 Ga0207671_10000777 3300025914 Bacteria 40486
192 Ga0207693_10013791 3300025915 Bacteria 6507
193 Ga0207663_10001007 3300025916 Bacteria 12893
194 Ga0207657_10083271 3300025919 Bacteria 2684
195 Ga0207652_10035413 3300025921 Bacteria 4213
196 Ga0207694_10034801 3300025924 Bacteria 3863
197 Ga0207659_10223369 3300025926 Bacteria 1516
198 Ga0207664_10000044 3300025929 Bacteria 147216
199 Ga0207664_10035182 3300025929 Bacteria 3863
200 Ga0207665_10008567 3300025939 Bacteria 6730
201 Ga0207691_10082403 3300025940 Bacteria 2889
202 Ga0207711_10283497 3300025941 Bacteria 1526
203 Ga0207661_10143072 3300025944 Bacteria 2060
204 Ga0207667_10003507 3300025949 Bacteria 19386
205 Ga0207712_10265244 3300025961 Bacteria 1394
206 Ga0207668_10028476 3300025972 Bacteria 3653
207 Ga0207703_10066968 3300026035 Bacteria 2955
208 Ga0207639_10175275 3300026041 Bacteria 1820
209 Ga0207678_10010792 3300026067 Bacteria 8026
210 Ga0207702_10225697 3300026078 Bacteria 1748
211 Ga0207641_10354903 3300026088 Bacteria 1398
212 Ga0207675_100111657 3300026118 Bacteria 2579
213 Ga0207698_10122722 3300026142 Bacteria 2202
214 Ga0209281_1000430 3300027111 Bacteria 62241
215 Ga0209371_1000534 3300027312 Bacteria 36079
216 Ga0209282_1031452 3300027666 Bacteria 3255
217 Ga0209813_10000115 3300027866 Bacteria 29380
218 Ga0268265_10181347 3300028380 Bacteria 1809
219 Ga0268264_10000050 3300028381 Bacteria 323697
220 Ga0268264_10108069 3300028381 Bacteria 2431
221 Ga0268264_10550887 3300028381 Bacteria 1131
222 Ga0307515_10000145 3300028794 Bacteria 170814
223 Ga0307515_10134120 3300028794 Bacteria 2705
224 Ga0268256_1003924 3300030500 Bacteria 6442
225 Ga0316177_1094831 3300030731 Bacteria 1128
226 Ga0316181_1106863 3300030744 Bacteria 1300
227 Ga0307509_10114001 3300031507 Bacteria 2699
228 Ga0307516_10002464 3300031730 Bacteria 24733
229 Ga0307516_10055526 3300031730 Bacteria 3865
230 Ga0307405_10131160 3300031731 Bacteria 1732
231 Ga0307413_10530907 3300031824 Bacteria 951
232 Ga0307410_10073678 3300031852 Bacteria 2375
233 Ga0307406_10070391 3300031901 Bacteria 2290
234 Ga0307406_10305551 3300031901 Bacteria 1224
235 Ga0307406_10387666 3300031901 Bacteria 1104
236 Ga0307409_100128806 3300031995 Bacteria 2158
237 Ga0307414_10201112 3300032004 Bacteria 1620
238 Ga0307415_100038103 3300032126 Bacteria 3166
239 Ga0307415_100390487 3300032126 Bacteria 1185
240 Ga0395899_0015678 3300037312 Bacteria 5779
241 Ga0395905_0000791 3300037471 Bacteria 41576
242 Ga0395905_0037409 3300037471 Bacteria 4556
243 Ga0436364_0070103 3300037853 Bacteria 509097
244 Ga0436364_1076786 3300037853 Bacteria 61259
245 Ga0439465_0005789 3300041413 Bacteria 3934
246 Ga0451797_0860499 3300041453 Bacteria 1405
247 Ga0451802_0321686 3300041460 Bacteria 2014
248 Ga0451833_1435920 3300041491 Bacteria 2036
249 Ga0451839_0231278 3300041496 Bacteria 3015
250 Ga0451839_1474213 3300041496 Bacteria 1560
251 Ga0451847_0599232 3300041503 Bacteria 3599
252 Ga0451849_0125500 3300041505 Bacteria 1957
253 Ga0451853_1510171 3300041512 Bacteria 1506
254 Ga0439432_030620 3300042006 Bacteria 1744
255 Ga0439462_0035012 3300042015 Bacteria 1334
256 Ga0451577_0001343 3300042876 Bacteria 33371
257 Ga0451577_0069816 3300042876 Bacteria 3133
258 Ga0453683_0006246 3300044673 Bacteria 8192
259 Ga0453683_0256563 3300044673 Bacteria 1115
260 Ga0466965_0015896 3300044683 Bacteria 3575
261 Ga0466965_0110526 3300044683 Bacteria 1412
262 Ga0466965_0118086 3300044683 Bacteria 1368
263 Ga0453684_0607846 3300044712 Bacteria 1197
264 Ga0466968_0052679 3300044735 Bacteria 1741
265 Ga0466970_0054739 3300044765 Bacteria 2131
266 Ga0495627_069874 3300046453 Bacteria 1027
267 Ga0495584_0112350 3300046491 Bacteria 1379
268 Ga0495585_0001541 3300046492 Bacteria 17891
269 Ga0495594_0012224 3300046499 Bacteria 4471
270 Ga0495596_0060466 3300046500 Bacteria 1476
271 Ga0495583_0039160 3300046506 Bacteria 2235
272 Ga0495606_0036736 3300046507 Bacteria 3333
273 Ga0495610_0141761 3300046512 Bacteria 1034
274 Ga0495620_0014604 3300046515 Bacteria 3986
275 Ga0495643_0068539 3300046522 Bacteria 1867
276 Ga0495643_0092105 3300046522 Bacteria 1562
277 Ga0495643_0107946 3300046522 Bacteria 1418
278 Ga0495648_0061610 3300046524 Bacteria 2227
279 Ga0495609_0023050 3300046538 Bacteria 2863
280 Ga0495597_0008120 3300046542 Bacteria 5279
281 Ga0495633_0026804 3300046558 Bacteria 2823
282 Ga0495668_0020018 3300046616 Bacteria 3849
283 Ga0495611_0133662 3300046648 Bacteria 1158
284 Ga0495661_0036699 3300046665 Bacteria 3066
285 Ga0495671_0030885 3300046692 Bacteria 2741
286 Ga0495660_0079805 3300046810 Bacteria 1718
287 Ga0495660_0152545 3300046810 Bacteria 1140
288 Ga0495681_0003221 3300047470 Bacteria 11393
289 Ga0495686_0050520 3300047472 Bacteria 2612
290 Ga0495686_0200174 3300047472 Bacteria 1147
291 Ga0496105_0106852 3300048908 Bacteria 2310
292 Ga0496106_0000321 3300048909 Bacteria 33762
293 Ga0496106_0003116 3300048909 Bacteria 12382
294 Ga0496112_0200310 3300048915 Bacteria 1956
295 Ga0496114_0119701 3300048917 Bacteria 2264
296 Ga0496116_0000756 3300048919 Bacteria 41062
297 Ga0496116_0002784 3300048919 Bacteria 17968
298 Ga0496116_0041380 3300048919 Bacteria 3162
299 Ga0496116_0088148 3300048919 Bacteria 1897
300 Ga0496116_0095551 3300048919 Bacteria 1793
301 Ga0496117_0000198 3300048920 Bacteria 118551
302 Ga0496117_0035922 3300048920 Bacteria 3714
303 Ga0496117_0100482 3300048920 Bacteria 1832
304 Ga0496117_0117065 3300048920 Bacteria 1646
305 Ga0496117_0152124 3300048920 Bacteria 1368
306 Ga0496118_0001844 3300048921 Bacteria 30349
307 Ga0496118_0030934 3300048921 Bacteria 4453
308 Ga0496118_0239979 3300048921 Bacteria 1038
309 Ga0496119_0000765 3300048922 Bacteria 43163
310 Ga0496119_0001741 3300048922 Bacteria 25371
311 Ga0496119_0003107 3300048922 Bacteria 17519
312 Ga0496119_0016710 3300048922 Bacteria 5564
313 Ga0496120_0000383 3300048923 Bacteria 71479
314 Ga0496120_0000513 3300048923 Bacteria 60418
315 Ga0496120_0008132 3300048923 Bacteria 7694
316 Ga0496120_0024733 3300048923 Bacteria 3738
317 Ga0496121_0000337 3300048924 Bacteria 97711
318 Ga0496121_0000452 3300048924 Bacteria 80796
319 Ga0496121_0051398 3300048924 Bacteria 3471
320 Ga0496121_0063912 3300048924 Bacteria 3004
321 Ga0496121_0369118 3300048924 Bacteria 950
322 Ga0496122_0000296 3300048925 Bacteria 110059
323 Ga0496122_0000561 3300048925 Bacteria 76046
324 Ga0496122_0001292 3300048925 Bacteria 41577
325 Ga0496122_0002101 3300048925 Bacteria 29518
326 Ga0496122_0004711 3300048925 Bacteria 16748
327 Ga0496122_0007068 3300048925 Bacteria 12606
328 Ga0496122_0020552 3300048925 Bacteria 5957
329 Ga0496122_0117448 3300048925 Bacteria 1727
330 Ga0496123_0000053 3300048926 Bacteria 234794
331 Ga0496123_0001189 3300048926 Bacteria 38315
332 Ga0496123_0006674 3300048926 Bacteria 11122
333 Ga0496123_0007234 3300048926 Bacteria 10536
334 Ga0496123_0064426 3300048926 Bacteria 2335
335 Ga0496124_0000267 3300048927 Bacteria 101138
336 Ga0496124_0000508 3300048927 Bacteria 66913
337 Ga0496124_0002031 3300048927 Bacteria 27515
338 Ga0496124_0071289 3300048927 Bacteria 2881
339 Ga0496125_0000045 3300048928 Bacteria 296312
340 Ga0496125_0000129 3300048928 Bacteria 163342
341 Ga0496125_0000772 3300048928 Bacteria 52321
342 Ga0496125_0001091 3300048928 Bacteria 41840
343 Ga0496125_0006259 3300048928 Bacteria 12938
344 Ga0496125_0006513 3300048928 Bacteria 12599
345 Ga0496125_0014392 3300048928 Bacteria 7706
346 Ga0496125_0016952 3300048928 Bacteria 6969
347 Ga0496125_0027245 3300048928 Bacteria 5185
348 Ga0496125_0093875 3300048928 Bacteria 2238
349 Ga0496126_0000002 3300048929 Bacteria 1001703
350 Ga0496126_0000442 3300048929 Bacteria 82842
351 Ga0496126_0001206 3300048929 Bacteria 42138
352 Ga0496126_0003480 3300048929 Bacteria 19873
353 Ga0496126_0014998 3300048929 Bacteria 7811
354 Ga0496126_0087289 3300048929 Bacteria 2749
355 Ga0495678_040659 3300049459 Bacteria 1867
356 Ga0501031_0000022 3300049568 Bacteria 92471
357 Ga0501031_0007152 3300049568 Bacteria 7286
358 Ga0501031_0233912 3300049568 Bacteria 1195
359 Ga0501032_0000063 3300049569 Bacteria 92497
360 Ga0501032_0008960 3300049569 Bacteria 7276
361 Ga0501032_0018028 3300049569 Bacteria 4952
362 Ga0501032_0201055 3300049569 Bacteria 1300
363 Ga0501033_0000073 3300049570 Bacteria 94880
364 Ga0501033_0000697 3300049570 Bacteria 31065
365 Ga0501033_0071794 3300049570 Bacteria 2543
366 Ga0501033_0073608 3300049570 Bacteria 2508
367 Ga0501033_0085052 3300049570 Bacteria 2317
368 Ga0501033_0214140 3300049570 Bacteria 1373
369 Ga0501034_0000276 3300049571 Bacteria 92497
370 Ga0501034_0000622 3300049571 Bacteria 55475
371 Ga0501034_0013005 3300049571 Bacteria 8580
372 Ga0501034_0035104 3300049571 Bacteria 5085
373 Ga0501034_0052155 3300049571 Bacteria 4122
374 Ga0501034_0072676 3300049571 Bacteria 3448
375 Ga0501034_0083001 3300049571 Bacteria 3206
376 Ga0501034_0094135 3300049571 Bacteria 2993
377 Ga0501034_0135748 3300049571 Bacteria 2441
378 Ga0501034_0137155 3300049571 Bacteria 2427
379 Ga0501036_0000030 3300049572 Bacteria 92497
380 Ga0501036_0012719 3300049572 Bacteria 6981
381 Ga0501036_0014451 3300049572 Bacteria 6577
382 Ga0501036_0030159 3300049572 Bacteria 4582
383 Ga0501036_0040089 3300049572 Bacteria 3962
384 Ga0501036_0052763 3300049572 Bacteria 3443
385 Ga0501037_0000075 3300049573 Bacteria 92499
386 Ga0501037_0032078 3300049573 Bacteria 3878
387 Ga0501037_0032171 3300049573 Bacteria 3872
388 Ga0501037_0124512 3300049573 Bacteria 1851
389 Ga0501038_0000058 3300049574 Bacteria 92497
390 Ga0501038_0008148 3300049574 Bacteria 9645
391 Ga0501038_0023731 3300049574 Bacteria 5480
392 Ga0501038_0026975 3300049574 Bacteria 5113
393 Ga0501038_0380249 3300049574 Bacteria 1095
394 Ga0501039_0000054 3300049575 Bacteria 92497
395 Ga0501039_0049443 3300049575 Bacteria 3250
396 Ga0501039_0073021 3300049575 Bacteria 2666
397 Ga0501039_0188569 3300049575 Bacteria 1622
398 Ga0501039_0367029 3300049575 Bacteria 1131
399 Ga0501043_0003373 3300049579 Bacteria 13152
400 Ga0501043_0016377 3300049579 Bacteria 5812
401 Ga0501043_0032830 3300049579 Bacteria 4082
402 Ga0501043_0149679 3300049579 Bacteria 1827
403 Ga0501046_0010359 3300049580 Bacteria 8014
404 Ga0501047_0003485 3300049581 Bacteria 14872
405 Ga0501047_0016776 3300049581 Bacteria 6998
406 Ga0501047_0125713 3300049581 Bacteria 2444
407 Ga0501067_0064623 3300049583 Bacteria 2026
408 Ga0501068_0154724 3300049584 Bacteria 1443
409 Ga0501070_0004341 3300049586 Bacteria 12189
410 Ga0501070_0029921 3300049586 Bacteria 4562
411 Ga0501070_0038308 3300049586 Bacteria 4000
412 Ga0501070_0227623 3300049586 Bacteria 1528
413 Ga0501071_0132248 3300049587 Bacteria 1854
414 Ga0501238_001266 3300049671 Bacteria 2902
415 Ga0501080_0289541 3300049742 Bacteria 1487
416 Ga0501080_0573445 3300049742 Bacteria 1004
417 Ga0501083_0036919 3300049744 Bacteria 3329
418 Ga0501241_006977 3300049758 Bacteria 2075
419 Ga0501035_0000126 3300049822 Bacteria 92497
420 Ga0501035_0001285 3300049822 Bacteria 25916
421 Ga0501035_0049130 3300049822 Bacteria 3781
422 Ga0501035_0088374 3300049822 Bacteria 2730
423 Ga0501035_0217268 3300049822 Bacteria 1633
424 Ga0501035_0362640 3300049822 Bacteria 1211
425 Ga0501044_0000131 3300049823 Bacteria 92497
426 Ga0501044_0074852 3300049823 Bacteria 3439
427 Ga0501044_0081818 3300049823 Bacteria 3268
428 Ga0501044_0274711 3300049823 Bacteria 1620
429 Ga0501045_0055087 3300049824 Bacteria 2908
430 nmdc:mga03683_191_c1 3300050489 Bacteria 10115
431 nmdc:mga03683_51276_c1 3300050489 Bacteria 1722
432 nmdc:mga03n38_120_c1 3300050490 Bacteria 17081
433 nmdc:mga03n38_28340_c1 3300050490 Bacteria 2333
434 nmdc:mga00v17_113078_c1 3300050491 Bacteria 1724
435 nmdc:mga00v17_127908_c1 3300050491 Bacteria 1622
436 nmdc:mga00v17_136_c1 3300050491 Bacteria 43082
437 nmdc:mga00v17_17983_c1 3300050491 Bacteria 4011
438 nmdc:mga00v17_2785_c2 3300050491 Bacteria 3983
439 nmdc:mga0yw44_7277_c1 3300050492 Bacteria 5429
440 nmdc:mga0yw44_75_c1 3300050492 Bacteria 35906
441 nmdc:mga0k408_211491_c1 3300050493 Bacteria 1158
442 nmdc:mga0k408_480_c1 3300050493 Bacteria 21881
443 nmdc:mga06z11_143_c1 3300050494 Bacteria 28490
444 nmdc:mga04h51_88_c1 3300050495 Bacteria 28134
445 nmdc:mga07m45_194098_c1 3300050496 Bacteria 1181
446 nmdc:mga07m45_757_c1 3300050496 Bacteria 13841
447 nmdc:mga05p37_1940_c1 3300050507 Bacteria 24098
448 nmdc:mga0sz30_3461_c1 3300050516 Bacteria 5685
449 nmdc:mga0sz30_422_c1 3300050516 Bacteria 12835
450 Ga0500646_0000413 3300053090 Bacteria 12676
451 Ga0500651_0037001 3300053093 Bacteria 3075
452 Ga0500651_0154662 3300053093 Bacteria 1375
453 Ga0500572_005233 3300053111 Bacteria 2935
454 Ga0500594_0046025 3300053118 Bacteria 1212
455 Ga0500658_0002758 3300053134 Bacteria 6757
456 Ga0500561_0000129 3300053137 Bacteria 14623
457 Ga0500568_0001935 3300053139 Bacteria 12686
458 Ga0500568_0013328 3300053139 Bacteria 3750
459 Ga0500568_0077906 3300053139 Bacteria 1261
460 Ga0500573_0000647 3300053140 Bacteria 15381
461 Ga0500588_0001787 3300053146 Bacteria 4189
462 Ga0500616_0000134 3300053153 Bacteria 129376
463 Ga0500616_0050962 3300053153 Bacteria 2183
464 Ga0500616_0073887 3300053153 Bacteria 1729
465 Ga0500622_0000708 3300053156 Bacteria 29275
466 Ga0500627_0103789 3300053158 Bacteria 1277
467 Ga0500633_0001316 3300053160 Bacteria 4601
468 Ga0500634_0011578 3300053161 Bacteria 4559
469 Ga0500636_0000011 3300053177 Bacteria 140769
470 Ga0500636_0001544 3300053177 Bacteria 12547
471 Ga0500636_0023762 3300053177 Bacteria 3623
472 Ga0500636_0143973 3300053177 Bacteria 1316
473 Ga0500565_000928 3300053734 Bacteria 1802
474 Ga0501082_0284396 3300060353 Bacteria 1440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10000884 Ga0105237_100008845 227
2 3300009551 Ga0105238_10022137 Ga0105238_100221375 227
3 3300025914 Ga0207671_10000777 Ga0207671_1000077722 227
4 3300025924 Ga0207694_10034801 Ga0207694_100348012 227
5 3300044683 Ga0466965_0118086 Ga0466965_0118086_618_1352 244
6 3300009093 Ga0105240_10232564 Ga0105240_102325643 246
7 3300041496 Ga0451839_0231278 Ga0451839_0231278_1129_1869 246
8 3300042876 Ga0451577_0069816 Ga0451577_0069816_721_1557 249
9 3300044673 Ga0453683_0006246 Ga0453683_0006246_1305_2144 249
10 3300044673 Ga0453683_0256563 Ga0453683_0256563_199_1035 249
11 3300048924 Ga0496121_0369118 Ga0496121_0369118_11_766 251
12 3300053734 Ga0500565_000928 Ga0500565_000928_282_1145 251
13 3300048917 Ga0496114_0119701 Ga0496114_0119701_1082_2005 254
14 3300049823 Ga0501044_0081818 Ga0501044_0081818_862_1755 255
15 3300042876 Ga0451577_0001343 Ga0451577_0001343_13609_14472 257
16 3300044712 Ga0453684_0607846 Ga0453684_0607846_196_1059 257
17 3300026078 Ga0207702_10225697 Ga0207702_102256971 258
18 3300037853 Ga0436364_0070103 Ga0436364_0070103_174242_175042 260
19 3300025909 Ga0207705_10054635 Ga0207705_100546353 261
20 3300048919 Ga0496116_0041380 Ga0496116_0041380_718_1503 261
21 3300003752 Ga0055539_1006565 Ga0055539_10065652 262
22 3300025253 Ga0209677_102856 Ga0209677_1028562 262
23 3300048919 Ga0496116_0002784 Ga0496116_0002784_4093_4881 262
24 3300048920 Ga0496117_0000198 Ga0496117_0000198_3135_3923 262
25 3300048921 Ga0496118_0239979 Ga0496118_0239979_46_834 262
26 3300048923 Ga0496120_0000513 Ga0496120_0000513_59572_60360 262
27 3300048923 Ga0496120_0024733 Ga0496120_0024733_1740_2528 262
28 3300048925 Ga0496122_0000561 Ga0496122_0000561_42515_43411 262
29 3300048925 Ga0496122_0001292 Ga0496122_0001292_38289_39077 262
30 3300048926 Ga0496123_0000053 Ga0496123_0000053_228609_229397 262
31 3300048926 Ga0496123_0001189 Ga0496123_0001189_4480_5376 262
32 3300048927 Ga0496124_0000508 Ga0496124_0000508_23784_24680 262
33 3300048927 Ga0496124_0071289 Ga0496124_0071289_924_1712 262
34 3300048928 Ga0496125_0000045 Ga0496125_0000045_26476_27264 262
35 3300048929 Ga0496126_0014998 Ga0496126_0014998_421_1209 262
36 3300013307 Ga0157372_10232779 Ga0157372_102327792 263
37 3300028794 Ga0307515_10134120 Ga0307515_101341202 263
38 3300005577 Ga0068857_100722631 Ga0068857_1007226311 264
39 3300005843 Ga0068860_100357424 Ga0068860_1003574242 264
40 3300010375 Ga0105239_10005290 Ga0105239_1000529011 264
41 3300010375 Ga0105239_10278308 Ga0105239_102783082 264
42 3300013296 Ga0157374_10238327 Ga0157374_102383272 264
43 3300021388 Ga0213875_10000070 Ga0213875_10000070101 264
44 3300021388 Ga0213875_10037015 Ga0213875_100370152 264
45 3300025909 Ga0207705_10004425 Ga0207705_100044254 264
46 3300025919 Ga0207657_10083271 Ga0207657_100832713 264
47 3300026041 Ga0207639_10175275 Ga0207639_101752752 264
48 3300028381 Ga0268264_10550887 Ga0268264_105508872 264
49 3300037853 Ga0436364_1076786 Ga0436364_1076786_7094_7936 264
50 3300041496 Ga0451839_1474213 Ga0451839_1474213_446_1360 264
51 3300048919 Ga0496116_0000756 Ga0496116_0000756_38549_39403 264
52 3300005331 Ga0070670_100027564 Ga0070670_1000275644 265
53 3300005347 Ga0070668_100023340 Ga0070668_1000233404 265
54 3300005365 Ga0070688_100381391 Ga0070688_1003813912 265
55 3300005843 Ga0068860_100059950 Ga0068860_1000599503 265
56 3300005844 Ga0068862_100047343 Ga0068862_1000473433 265
57 3300006051 Ga0075364_10002798 Ga0075364_100027986 265
58 3300009148 Ga0105243_10103263 Ga0105243_101032631 265
59 3300025926 Ga0207659_10223369 Ga0207659_102233692 265
60 3300025940 Ga0207691_10082403 Ga0207691_100824032 265
61 3300025972 Ga0207668_10028476 Ga0207668_100284764 265
62 3300026088 Ga0207641_10354903 Ga0207641_103549032 265
63 3300028380 Ga0268265_10181347 Ga0268265_101813472 265
64 3300028381 Ga0268264_10108069 Ga0268264_101080693 265
65 3300050491 nmdc:mga00v17_113078_c1 nmdc:mga00v17_113078_c1_535_1455 265
66 3300053177 Ga0500636_0143973 Ga0500636_0143973_26_823 265
67 3300005530 Ga0070679_100533888 Ga0070679_1005338882 266
68 3300005445 Ga0070708_100648439 Ga0070708_1006484391 267
69 3300005471 Ga0070698_100075907 Ga0070698_1000759072 267
70 3300005518 Ga0070699_100022027 Ga0070699_1000220275 267
71 3300005841 Ga0068863_100236705 Ga0068863_1002367052 267
72 3300005843 Ga0068860_100536457 Ga0068860_1005364572 267
73 3300014325 Ga0163163_10475225 Ga0163163_104752252 267
74 3300049569 Ga0501032_0008960 Ga0501032_0008960_3477_4289 268
75 3300049570 Ga0501033_0085052 Ga0501033_0085052_324_1136 268
76 3300049571 Ga0501034_0072676 Ga0501034_0072676_1233_2045 268
77 3300049572 Ga0501036_0052763 Ga0501036_0052763_196_1008 268
78 3300049573 Ga0501037_0032078 Ga0501037_0032078_497_1309 268
79 3300049574 Ga0501038_0023731 Ga0501038_0023731_2412_3224 268
80 3300049575 Ga0501039_0049443 Ga0501039_0049443_20_832 268
81 3300049579 Ga0501043_0032830 Ga0501043_0032830_1097_1909 268
82 3300049580 Ga0501046_0010359 Ga0501046_0010359_2560_3372 268
83 3300049581 Ga0501047_0125713 Ga0501047_0125713_1405_2217 268
84 3300049586 Ga0501070_0227623 Ga0501070_0227623_458_1270 268
85 3300049822 Ga0501035_0088374 Ga0501035_0088374_737_1549 268
86 3300049824 Ga0501045_0055087 Ga0501045_0055087_1542_2354 268
87 3300005435 Ga0070714_100000252 Ga0070714_10000025220 269
88 3300025929 Ga0207664_10000044 Ga0207664_100000446 269
89 3300030731 Ga0316177_1094831 Ga0316177_10948312 269
90 3300031824 Ga0307413_10530907 Ga0307413_105309071 269
91 3300046453 Ga0495627_069874 Ga0495627_069874_73_912 269
92 3300046512 Ga0495610_0141761 Ga0495610_0141761_124_963 269
93 3300053139 Ga0500568_0077906 Ga0500568_0077906_39_878 269
94 iso_pu_bacteria 2738541272 2738694041 269
95 iso_pu_bacteria 2738543027 2739327378 269
96 iso_pu_bacteria 2739367654 2739607154 269
97 iso_pu_bacteria 2758568522 2760304937 269
98 iso_pu_bacteria 2758568621 2760621227 269
99 iso_pu_bacteria 2808606394 2809026026 269
100 iso_pu_bacteria 8056579771 8056579868 269
101 3300046522 Ga0495643_0068539 Ga0495643_0068539_204_1052 270
102 3300002987 JGI25159J45721_1000428 JGI25159J45721_10004282 271
103 3300002987 JGI25159J45721_1001350 JGI25159J45721_10013509 271
104 3300002987 JGI25159J45721_1003595 JGI25159J45721_10035954 271
105 3300003187 JGI25151J46595_10000050 JGI25151J46595_10000050114 271
106 3300003214 JGI25165J46597_1001956 JGI25165J46597_10019563 271
107 3300003215 JGI25153J46596_10035127 JGI25153J46596_100351271 271
108 3300003215 JGI25153J46596_10052182 JGI25153J46596_100521821 271
109 3300003374 JGI25161J50226_1000600 JGI25161J50226_10006004 271
110 3300003578 Ga0006562J51391_1002952 Ga0006562J51391_10029524 271
111 3300003771 Ga0055526_1000212 Ga0055526_10002129 271
112 3300003771 Ga0055526_1002100 Ga0055526_10021002 271
113 3300003775 Ga0055524_1000018 Ga0055524_1000018102 271
114 3300003775 Ga0055524_1015814 Ga0055524_10158142 271
115 3300004625 Ga0055543_1000019 Ga0055543_10000194 271
116 3300005262 Ga0065165_1000014 Ga0065165_1000014151 271
117 3300005539 Ga0068853_100183373 Ga0068853_1001833732 271
118 3300006186 Ga0075369_10053399 Ga0075369_100533991 271
119 3300006871 Ga0075434_100305520 Ga0075434_1003055202 271
120 3300009553 Ga0105249_10297379 Ga0105249_102973792 271
121 3300013250 Ga0171462_1030 Ga0171462_103052 271
122 3300025208 Ga0209436_100038 Ga0209436_10003822 271
123 3300025233 Ga0209437_100239 Ga0209437_10023978 271
124 3300025258 Ga0209129_1002259 Ga0209129_10022595 271
125 3300025258 Ga0209129_1002652 Ga0209129_10026522 271
126 3300025261 Ga0209233_1000245 Ga0209233_10002455 271
127 3300025273 Ga0209673_1007844 Ga0209673_10078442 271
128 3300025284 Ga0209130_1000024 Ga0209130_1000024123 271
129 3300025284 Ga0209130_1000097 Ga0209130_100009784 271
130 3300025291 Ga0209675_1004488 Ga0209675_10044883 271
131 3300025292 Ga0209676_1043469 Ga0209676_10434692 271
132 3300025294 Ga0209025_1000017 Ga0209025_1000017384 271
133 3300025294 Ga0209025_1001592 Ga0209025_100159226 271
134 3300025295 Ga0209564_1000059 Ga0209564_100005982 271
135 3300025295 Ga0209564_1000721 Ga0209564_100072119 271
136 3300025297 Ga0209758_1000505 Ga0209758_10005055 271
137 3300025297 Ga0209758_1001100 Ga0209758_10011003 271
138 3300025297 Ga0209758_1001881 Ga0209758_10018813 271
139 3300025299 Ga0209256_1000032 Ga0209256_1000032105 271
140 3300025299 Ga0209256_1005767 Ga0209256_10057671 271
141 3300025302 Ga0207426_1000003 Ga0207426_1000003782 271
142 3300025303 Ga0209051_1030690 Ga0209051_10306902 271
143 3300025304 Ga0209257_1021098 Ga0209257_10210981 271
144 3300025304 Ga0209257_1021550 Ga0209257_10215502 271
145 3300025961 Ga0207712_10265244 Ga0207712_102652442 271
146 3300031852 Ga0307410_10073678 Ga0307410_100736782 271
147 3300031901 Ga0307406_10305551 Ga0307406_103055511 271
148 3300031995 Ga0307409_100128806 Ga0307409_1001288062 271
149 3300032004 Ga0307414_10201112 Ga0307414_102011122 271
150 3300032126 Ga0307415_100390487 Ga0307415_1003904872 271
151 3300041413 Ga0439465_0005789 Ga0439465_0005789_443_1300 271
152 3300046522 Ga0495643_0107946 Ga0495643_0107946_90_947 271
153 3300046810 Ga0495660_0152545 Ga0495660_0152545_185_1033 271
154 3300047472 Ga0495686_0200174 Ga0495686_0200174_82_924 271
155 3300048909 Ga0496106_0000321 Ga0496106_0000321_18371_19228 271
156 3300048919 Ga0496116_0088148 Ga0496116_0088148_833_1687 271
157 3300048919 Ga0496116_0095551 Ga0496116_0095551_733_1590 271
158 3300048920 Ga0496117_0100482 Ga0496117_0100482_186_1037 271
159 3300048920 Ga0496117_0152124 Ga0496117_0152124_425_1282 271
160 3300048921 Ga0496118_0030934 Ga0496118_0030934_1247_2104 271
161 3300048922 Ga0496119_0003107 Ga0496119_0003107_6691_7536 271
162 3300048925 Ga0496122_0002101 Ga0496122_0002101_16645_17490 271
163 3300048925 Ga0496122_0004711 Ga0496122_0004711_14639_15496 271
164 3300048925 Ga0496122_0007068 Ga0496122_0007068_1273_2118 271
165 3300048925 Ga0496122_0020552 Ga0496122_0020552_2894_3739 271
166 3300048925 Ga0496122_0117448 Ga0496122_0117448_442_1284 271
167 3300048926 Ga0496123_0007234 Ga0496123_0007234_1476_2333 271
168 3300048926 Ga0496123_0064426 Ga0496123_0064426_890_1741 271
169 3300048928 Ga0496125_0000129 Ga0496125_0000129_121929_122783 271
170 3300048928 Ga0496125_0000772 Ga0496125_0000772_12361_13206 271
171 3300048928 Ga0496125_0001091 Ga0496125_0001091_5940_6785 271
172 3300048928 Ga0496125_0006513 Ga0496125_0006513_4221_5078 271
173 3300048928 Ga0496125_0014392 Ga0496125_0014392_4024_4869 271
174 3300048928 Ga0496125_0027245 Ga0496125_0027245_500_1360 271
175 3300048928 Ga0496125_0093875 Ga0496125_0093875_281_1126 271
176 3300049568 Ga0501031_0000022 Ga0501031_0000022_71547_72395 271
177 3300049568 Ga0501031_0007152 Ga0501031_0007152_5032_5877 271
178 3300049569 Ga0501032_0000063 Ga0501032_0000063_20075_20923 271
179 3300049569 Ga0501032_0201055 Ga0501032_0201055_430_1287 271
180 3300049570 Ga0501033_0000073 Ga0501033_0000073_73958_74806 271
181 3300049570 Ga0501033_0071794 Ga0501033_0071794_393_1238 271
182 3300049571 Ga0501034_0000276 Ga0501034_0000276_71575_72423 271
183 3300049571 Ga0501034_0052155 Ga0501034_0052155_1513_2358 271
184 3300049571 Ga0501034_0083001 Ga0501034_0083001_1758_2615 271
185 3300049571 Ga0501034_0094135 Ga0501034_0094135_1868_2713 271
186 3300049572 Ga0501036_0000030 Ga0501036_0000030_71575_72423 271
187 3300049572 Ga0501036_0014451 Ga0501036_0014451_1740_2585 271
188 3300049572 Ga0501036_0040089 Ga0501036_0040089_2946_3803 271
189 3300049573 Ga0501037_0000075 Ga0501037_0000075_20077_20925 271
190 3300049574 Ga0501038_0000058 Ga0501038_0000058_20075_20923 271
191 3300049574 Ga0501038_0380249 Ga0501038_0380249_128_985 271
192 3300049575 Ga0501039_0000054 Ga0501039_0000054_20075_20923 271
193 3300049579 Ga0501043_0003373 Ga0501043_0003373_6550_7398 271
194 3300049579 Ga0501043_0149679 Ga0501043_0149679_642_1499 271
195 3300049581 Ga0501047_0003485 Ga0501047_0003485_5465_6313 271
196 3300049583 Ga0501067_0064623 Ga0501067_0064623_284_1141 271
197 3300049586 Ga0501070_0004341 Ga0501070_0004341_1736_2584 271
198 3300049586 Ga0501070_0029921 Ga0501070_0029921_424_1269 271
199 3300049742 Ga0501080_0289541 Ga0501080_0289541_568_1425 271
200 3300049742 Ga0501080_0573445 Ga0501080_0573445_103_948 271
201 3300049744 Ga0501083_0036919 Ga0501083_0036919_2152_3009 271
202 3300049822 Ga0501035_0000126 Ga0501035_0000126_71575_72423 271
203 3300049822 Ga0501035_0217268 Ga0501035_0217268_695_1540 271
204 3300049822 Ga0501035_0362640 Ga0501035_0362640_241_1098 271
205 3300049823 Ga0501044_0000131 Ga0501044_0000131_20075_20923 271
206 3300049823 Ga0501044_0074852 Ga0501044_0074852_1883_2740 271
207 3300049823 Ga0501044_0274711 Ga0501044_0274711_141_986 271
208 3300050516 nmdc:mga0sz30_3461_c1 nmdc:mga0sz30_3461_c1_997_1854 271
209 3300053093 Ga0500651_0037001 Ga0500651_0037001_1936_2793 271
210 3300053139 Ga0500568_0013328 Ga0500568_0013328_2406_3263 271
211 3300053156 Ga0500622_0000708 Ga0500622_0000708_13587_14444 271
212 3300053160 Ga0500633_0001316 Ga0500633_0001316_964_1821 271
213 3300053177 Ga0500636_0023762 Ga0500636_0023762_90_932 271
214 3300060353 Ga0501082_0284396 Ga0501082_0284396_166_1011 271
215 iso_pu_bacteria 2508501050 2508728785 271
216 iso_pu_bacteria 2508501114 2509077085 271
217 iso_pu_bacteria 2510917030 2511200265 271
218 iso_pu_bacteria 2582581283 2585169571 271
219 iso_pu_bacteria 2582581298 2585225841 271
220 iso_pu_bacteria 2585427529 2585546801 271
221 iso_pu_bacteria 2643221591 2643965472 271
222 iso_pu_bacteria 2643221734 2644734404 271
223 iso_pu_bacteria 2643221736 2644742890 271
224 iso_pu_bacteria 2738543024 2739305655 271
225 iso_pu_bacteria 2751185800 2753360691 271
226 iso_pu_bacteria 2758568016 2758640356 271
227 iso_pu_bacteria 2773857925 2774874150 271
228 iso_pu_bacteria 2775506901 2776258186 271
229 iso_pu_bacteria 2775507266 2778178508 271
230 iso_pu_bacteria 2791355267 2793370759 271
231 iso_pu_bacteria 2821443989 2821449774 271
232 iso_pu_bacteria 2835312727 2835313014 271
233 iso_pu_bacteria 2841760612 2841765302 271
234 iso_pu_bacteria 2842110456 2842117374 271
235 iso_pu_bacteria 2842482326 2842486425 271
236 iso_pu_bacteria 2844104063 2844106912 271
237 iso_pu_bacteria 2851182111 2851185901 271
238 iso_pu_bacteria 2851246043 2851248952 271
239 iso_pu_bacteria 2854911287 2854914652 271
240 iso_pu_bacteria 2857516855 2857523839 271
241 iso_pu_bacteria 2884298095 2884298201 271
242 iso_pu_bacteria 2889790730 2889795940 271
243 iso_pu_bacteria 2889914905 2889916160 271
244 iso_pu_bacteria 2891048133 2891052271 271
245 iso_pu_bacteria 2894232714 2894242718 271
246 iso_pu_bacteria 2897803580 2897805048 271
247 iso_pu_bacteria 2915650412 2915651620 271
248 iso_pu_bacteria 2917699015 2917700399 271
249 iso_pu_bacteria 2919100787 2919107825 271
250 iso_pu_bacteria 2932401849 2932404793 271
251 iso_pu_bacteria 2995392953 2995395164 271
252 iso_pu_bacteria 3005445848 3005447272 271
253 iso_pu_bacteria 8002285264 8002289758 271
254 iso_pu_bacteria 8005395548 8005398178 271
255 iso_pu_bacteria 8057529695 8057532521 271
256 3300005536 Ga0070697_100364639 Ga0070697_1003646392 272
257 3300005985 Ga0081539_10053734 Ga0081539_100537342 272
258 3300028794 Ga0307515_10000145 Ga0307515_10000145135 272
259 3300031730 Ga0307516_10055526 Ga0307516_100555262 272
260 3300037471 Ga0395905_0000791 Ga0395905_0000791_3316_4161 272
261 3300037471 Ga0395905_0037409 Ga0395905_0037409_2751_3596 272
262 3300048929 Ga0496126_0001206 Ga0496126_0001206_13507_14424 272
263 3300049570 Ga0501033_0000697 Ga0501033_0000697_17713_18564 272
264 3300049822 Ga0501035_0001285 Ga0501035_0001285_17047_17898 272
265 3300053090 Ga0500646_0000413 Ga0500646_0000413_960_1850 272
266 3300053140 Ga0500573_0000647 Ga0500573_0000647_6365_7204 272
267 3300053146 Ga0500588_0001787 Ga0500588_0001787_2350_3240 272
268 iso_pu_bacteria 2510065019 2510137650 272
269 iso_pu_bacteria 2513237084 2513571709 272
270 iso_pu_bacteria 2513237103 2513712558 272
271 iso_pu_bacteria 2515075009 2515109223 272
272 iso_pu_bacteria 2516653077 2517042350 272
273 iso_pu_bacteria 2765235942 2766064761 272
274 iso_pu_bacteria 2842217011 2842223423 272
275 iso_pu_bacteria 2933586486 2933593472 272
276 iso_pu_bacteria 2936367885 2936373788 272
277 iso_pu_bacteria 2936375103 2936377314 272
278 iso_pu_bacteria 639633055 639645671 272
279 iso_pu_bacteria 8005376324 8005382287 272
280 iso_pu_bacteria 8005460587 8005466356 272
281 iso_pu_bacteria 8024479707 8024486307 272
282 iso_pu_bacteria 8057874678 8057878293 272
283 3300005327 Ga0070658_10365111 Ga0070658_103651112 273
284 3300009147 Ga0114129_10000701 Ga0114129_1000070110 273
285 3300009177 Ga0105248_10223763 Ga0105248_102237632 273
286 3300025941 Ga0207711_10283497 Ga0207711_102834972 273
287 3300050507 nmdc:mga05p37_1940_c1 nmdc:mga05p37_1940_c1_17401_18258 273
288 iso_pu_bacteria 2904113452 2904118430 273
289 iso_pu_bacteria 2913308742 2913313155 273
290 iso_pu_bacteria 2971403814 2971408178 273
291 3300006051 Ga0075364_10020448 Ga0075364_100204483 274
292 3300049571 Ga0501034_0000622 Ga0501034_0000622_51125_52033 274
293 3300050491 nmdc:mga00v17_2785_c2 nmdc:mga00v17_2785_c2_2134_3039 274
294 iso_pu_bacteria 2509276021 2509390555 274
295 iso_pu_bacteria 2509276033 2509442248 274
296 iso_pu_bacteria 2510065019 2510136176 274
297 iso_pu_bacteria 2510461076 2510892818 274
298 iso_pu_bacteria 2510917026 2511168370 274
299 iso_pu_bacteria 2513237084 2513568491 274
300 iso_pu_bacteria 2513237085 2513579417 274
301 iso_pu_bacteria 2513237093 2513630667 274
302 iso_pu_bacteria 2513237103 2513711981 274
303 iso_pu_bacteria 2513237162 2514018313 274
304 iso_pu_bacteria 2515075009 2515108896 274
305 iso_pu_bacteria 2515154113 2515633099 274
306 iso_pu_bacteria 2515154114 2515640304 274
307 iso_pu_bacteria 2515154116 2515656386 274
308 iso_pu_bacteria 2515154134 2515738425 274
309 iso_pu_bacteria 2516653077 2517040838 274
310 iso_pu_bacteria 2516653085 2517080461 274
311 iso_pu_bacteria 2517093000 2517098438 274
312 iso_pu_bacteria 2517287029 2517409928 274
313 iso_pu_bacteria 2524614857 2526060234 274
314 iso_pu_bacteria 2529292951 2530649086 274
315 iso_pu_bacteria 2537561587 2537872993 274
316 iso_pu_bacteria 2554235003 2554244707 274
317 iso_pu_bacteria 2558860242 2559297455 274
318 iso_pu_bacteria 2585427526 2585526787 274
319 iso_pu_bacteria 2585427528 2585543107 274
320 iso_pu_bacteria 2585427593 2585841473 274
321 iso_pu_bacteria 2585427633 2585993794 274
322 iso_pu_bacteria 2585427634 2586004718 274
323 iso_pu_bacteria 2599185210 2599604989 274
324 iso_pu_bacteria 2615840624 2616297141 274
325 iso_pu_bacteria 2643221558 2643814806 274
326 iso_pu_bacteria 2643221693 2644523095 274
327 iso_pu_bacteria 2718217882 2719184814 274
328 iso_pu_bacteria 2718217927 2719389516 274
329 iso_pu_bacteria 2718217997 2719668812 274
330 iso_pu_bacteria 2718218009 2719728834 274
331 iso_pu_bacteria 2718218199 2720489505 274
332 iso_pu_bacteria 2718218232 2720610177 274
333 iso_pu_bacteria 2718218233 2720617605 274
334 iso_pu_bacteria 2718218235 2720628748 274
335 iso_pu_bacteria 2718218269 2720772697 274
336 iso_pu_bacteria 2718218363 2721144525 274
337 iso_pu_bacteria 2718218365 2721156471 274
338 iso_pu_bacteria 2718218366 2721161895 274
339 iso_pu_bacteria 2718218423 2721402284 274
340 iso_pu_bacteria 2721755514 2722843040 274
341 iso_pu_bacteria 2721755556 2723030136 274
342 iso_pu_bacteria 2721755684 2723564541 274
343 iso_pu_bacteria 2721755685 2723569818 274
344 iso_pu_bacteria 2721755809 2724036117 274
345 iso_pu_bacteria 2721755810 2724041859 274
346 iso_pu_bacteria 2721755819 2724092726 274
347 iso_pu_bacteria 2721755822 2724101365 274
348 iso_pu_bacteria 2721755823 2724113111 274
349 iso_pu_bacteria 2724679232 2725949445 274
350 iso_pu_bacteria 2728369352 2730110669 274
351 iso_pu_bacteria 2728369365 2730160929 274
352 iso_pu_bacteria 2728369397 2730296004 274
353 iso_pu_bacteria 2738541333 2739035175 274
354 iso_pu_bacteria 2738543031 2739350926 274
355 iso_pu_bacteria 2739367875 2740062964 274
356 iso_pu_bacteria 2747842429 2747952710 274
357 iso_pu_bacteria 2765235942 2766068928 274
358 iso_pu_bacteria 2791355256 2793297956 274
359 iso_pu_bacteria 2791355259 2793315056 274
360 iso_pu_bacteria 2791355261 2793330759 274
361 iso_pu_bacteria 2791355262 2793333908 274
362 iso_pu_bacteria 2791355263 2793342253 274
363 iso_pu_bacteria 2791355264 2793345705 274
364 iso_pu_bacteria 2791355265 2793354392 274
365 iso_pu_bacteria 2791355266 2793360258 274
366 iso_pu_bacteria 2791355267 2793368720 274
367 iso_pu_bacteria 2802429605 2805928393 274
368 iso_pu_bacteria 2802429606 2805935202 274
369 iso_pu_bacteria 2802429633 2806048077 274
370 iso_pu_bacteria 2802429634 2806054613 274
371 iso_pu_bacteria 2802429635 2806060621 274
372 iso_pu_bacteria 2802429636 2806069459 274
373 iso_pu_bacteria 2802429637 2806076906 274
374 iso_pu_bacteria 2821123053 2821127124 274
375 iso_pu_bacteria 2838016132 2838020458 274
376 iso_pu_bacteria 2838022645 2838025154 274
377 iso_pu_bacteria 2838042994 2838044121 274
378 iso_pu_bacteria 2838048938 2838049899 274
379 iso_pu_bacteria 2838061910 2838062166 274
380 iso_pu_bacteria 2838068647 2838069478 274
381 iso_pu_bacteria 2838668709 2838669326 274
382 iso_pu_bacteria 2838675328 2838678375 274
383 iso_pu_bacteria 2838680041 2838684697 274
384 iso_pu_bacteria 2838686498 2838690526 274
385 iso_pu_bacteria 2838694306 2838698859 274
386 iso_pu_bacteria 2838701080 2838701698 274
387 iso_pu_bacteria 2838707686 2838712261 274
388 iso_pu_bacteria 2838714209 2838716717 274
389 iso_pu_bacteria 2838719591 2838722671 274
390 iso_pu_bacteria 2838724970 2838727468 274
391 iso_pu_bacteria 2838729681 2838733117 274
392 iso_pu_bacteria 2838736955 2838740733 274
393 iso_pu_bacteria 2838742623 2838747294 274
394 iso_pu_bacteria 2841840854 2841844574 274
395 iso_pu_bacteria 2841846520 2841849099 274
396 iso_pu_bacteria 2841851746 2841855447 274
397 iso_pu_bacteria 2841859092 2841861879 274
398 iso_pu_bacteria 2841864319 2841866130 274
399 iso_pu_bacteria 2842110456 2842117033 274
400 iso_pu_bacteria 2842118031 2842122660 274
401 iso_pu_bacteria 2842124991 2842128152 274
402 iso_pu_bacteria 2842130223 2842133268 274
403 iso_pu_bacteria 2842140634 2842144357 274
404 iso_pu_bacteria 2842152218 2842155261 274
405 iso_pu_bacteria 2842156927 2842160846 274
406 iso_pu_bacteria 2842163707 2842164375 274
407 iso_pu_bacteria 2842170452 2842173761 274
408 iso_pu_bacteria 2842175837 2842178882 274
409 iso_pu_bacteria 2842180545 2842184462 274
410 iso_pu_bacteria 2842187318 2842189825 274
411 iso_pu_bacteria 2842192696 2842195965 274
412 iso_pu_bacteria 2842198810 2842200720 274
413 iso_pu_bacteria 2842205361 2842209869 274
414 iso_pu_bacteria 2842211629 2842214139 274
415 iso_pu_bacteria 2842217011 2842219709 274
416 iso_pu_bacteria 2842224351 2842226859 274
417 iso_pu_bacteria 2842229732 2842232045 274
418 iso_pu_bacteria 2842237096 2842241673 274
419 iso_pu_bacteria 2842243621 2842248553 274
420 iso_pu_bacteria 2842250916 2842251878 274
421 iso_pu_bacteria 2842257432 2842262639 274
422 iso_pu_bacteria 2842264693 2842264853 274
423 iso_pu_bacteria 2842271015 2842275160 274
424 iso_pu_bacteria 2842278818 2842283323 274
425 iso_pu_bacteria 2842291075 2842295817 274
426 iso_pu_bacteria 2842304105 2842307404 274
427 iso_pu_bacteria 2842311132 2842312994 274
428 iso_pu_bacteria 2842317721 2842320281 274
429 iso_pu_bacteria 2842341865 2842342027 274
430 iso_pu_bacteria 2842363717 2842365992 274
431 iso_pu_bacteria 2842370503 2842374302 274
432 iso_pu_bacteria 2842377471 2842382221 274
433 iso_pu_bacteria 2842384541 2842389208 274
434 iso_pu_bacteria 2842395702 2842396993 274
435 iso_pu_bacteria 2842402390 2842405909 274
436 iso_pu_bacteria 2842409023 2842412493 274
437 iso_pu_bacteria 2842415677 2842419137 274
438 iso_pu_bacteria 2842422224 2842422669 274
439 iso_pu_bacteria 2842428310 2842429094 274
440 iso_pu_bacteria 2842434925 2842435707 274
441 iso_pu_bacteria 2842441272 2842441431 274
442 iso_pu_bacteria 2842447887 2842448499 274
443 iso_pu_bacteria 2842462802 2842463518 274
444 iso_pu_bacteria 2842469257 2842470037 274
445 iso_pu_bacteria 2842489311 2842489857 274
446 iso_pu_bacteria 2842495871 2842498098 274
447 iso_pu_bacteria 2842515876 2842517855 274
448 iso_pu_bacteria 2844454524 2844460182 274
449 iso_pu_bacteria 2854896431 2854899738 274
450 iso_pu_bacteria 2854916844 2854921037 274
451 iso_pu_bacteria 2857516855 2857517755 274
452 iso_pu_bacteria 2857531043 2857534896 274
453 iso_pu_bacteria 2891048133 2891049959 274
454 iso_pu_bacteria 2899792073 2899792966 274
455 iso_pu_bacteria 2919114240 2919116934 274
456 iso_pu_bacteria 2919171160 2919174284 274
457 iso_pu_bacteria 2926754445 2926758447 274
458 iso_pu_bacteria 2933006813 2933009360 274
459 iso_pu_bacteria 2933011516 2933013484 274
460 iso_pu_bacteria 2933570622 2933573940 274
461 iso_pu_bacteria 2933586486 2933593217 274
462 iso_pu_bacteria 2933599457 2933600141 274
463 iso_pu_bacteria 2935894831 2935898776 274
464 iso_pu_bacteria 2935901341 2935906164 274
465 iso_pu_bacteria 2936367885 2936374638 274
466 iso_pu_bacteria 2936375103 2936375929 274
467 iso_pu_bacteria 2936381700 2936385390 274
468 iso_pu_bacteria 2946041624 2946045447 274
469 iso_pu_bacteria 2996893221 2996897399 274
470 iso_pu_bacteria 639633055 639645421 274
471 iso_pu_bacteria 650716007 650843891 274
472 iso_pu_bacteria 8005275841 8005277859 274
473 iso_pu_bacteria 8005282627 8005285795 274
474 iso_pu_bacteria 8005289223 8005290888 274
475 iso_pu_bacteria 8005301065 8005301240 274
476 iso_pu_bacteria 8005307578 8005308246 274
477 iso_pu_bacteria 8005376324 8005380603 274
478 iso_pu_bacteria 8005382845 8005383127 274
479 iso_pu_bacteria 8005395548 8005398728 274
480 iso_pu_bacteria 8005430974 8005436621 274
481 iso_pu_bacteria 8005460587 8005467613 274
482 iso_pu_bacteria 8005497431 8005501959 274
483 iso_pu_bacteria 8005556819 8005562635 274
484 iso_pu_bacteria 8005563573 8005566409 274
485 iso_pu_bacteria 8005570704 8005571332 274
486 iso_pu_bacteria 8005619151 8005624203 274
487 iso_pu_bacteria 8005626139 8005629465 274
488 iso_pu_bacteria 8005668836 8005673381 274
489 iso_pu_bacteria 8005688590 8005688947 274
490 iso_pu_bacteria 8005695170 8005697079 274
491 iso_pu_bacteria 8018127388 8018132249 274
492 iso_pu_bacteria 8018163183 8018163684 274
493 iso_pu_bacteria 8018176218 8018176415 274
494 iso_pu_bacteria 8023680758 8023681625 274
495 iso_pu_bacteria 8024479707 8024481483 274
496 iso_pu_bacteria 8024501048 8024507384 274
497 iso_pu_bacteria 8054460903 8054464094 274
498 iso_pu_bacteria 8056375014 8056378062 274
499 iso_pu_bacteria 8056382006 8056382137 274
500 iso_pu_bacteria 8057874678 8057881361 274
501 3300005347 Ga0070668_100001518 Ga0070668_10000151812 275
502 3300026118 Ga0207675_100111657 Ga0207675_1001116572 275
503 3300009101 Ga0105247_10003108 Ga0105247_100031088 276
504 3300044735 Ga0466968_0052679 Ga0466968_0052679_10_969 276
505 3300044765 Ga0466970_0054739 Ga0466970_0054739_850_1809 276
506 3300046810 Ga0495660_0079805 Ga0495660_0079805_410_1249 276
507 3300048924 Ga0496121_0051398 Ga0496121_0051398_1244_2074 276
508 iso_pu_bacteria 2513237144 2513912780 276
509 iso_pu_bacteria 2751185734 2753072482 276
510 iso_pu_bacteria 2839986021 2839988842 276
511 iso_pu_bacteria 2870721527 2870727032 276
512 iso_pu_bacteria 2887443736 2887445484 276
513 iso_pu_bacteria 2906799679 2906802150 276
514 iso_pu_bacteria 2932431166 2932434053 276
515 iso_pu_bacteria 3000017691 3000020427 276
516 3300005288 Ga0065714_10004509 Ga0065714_100045093 277
517 3300005288 Ga0065714_10092202 Ga0065714_100922022 277
518 3300005455 Ga0070663_100060101 Ga0070663_1000601013 277
519 3300005455 Ga0070663_100081065 Ga0070663_1000810652 277
520 3300005530 Ga0070679_100048396 Ga0070679_1000483963 277
521 3300009545 Ga0105237_10223421 Ga0105237_102234212 277
522 3300013104 Ga0157370_10059329 Ga0157370_100593292 277
523 3300013105 Ga0157369_10024714 Ga0157369_100247142 277
524 3300013105 Ga0157369_10565540 Ga0157369_105655402 277
525 3300013250 Ga0171462_1002 Ga0171462_1002189 277
526 3300013308 Ga0157375_10377974 Ga0157375_103779742 277
527 3300014325 Ga0163163_10720633 Ga0163163_107206332 277
528 3300017792 Ga0163161_10074113 Ga0163161_100741133 277
529 3300025921 Ga0207652_10035413 Ga0207652_100354133 277
530 3300025944 Ga0207661_10143072 Ga0207661_101430721 277
531 3300026067 Ga0207678_10010792 Ga0207678_100107927 277
532 3300031731 Ga0307405_10131160 Ga0307405_101311601 277
533 3300031901 Ga0307406_10070391 Ga0307406_100703912 277
534 3300031901 Ga0307406_10387666 Ga0307406_103876662 277
535 3300032126 Ga0307415_100038103 Ga0307415_1000381034 277
536 3300037312 Ga0395899_0015678 Ga0395899_0015678_4402_5319 277
537 3300041453 Ga0451797_0860499 Ga0451797_0860499_453_1370 277
538 3300041460 Ga0451802_0321686 Ga0451802_0321686_130_1020 277
539 3300044683 Ga0466965_0015896 Ga0466965_0015896_62_1015 277
540 3300044683 Ga0466965_0110526 Ga0466965_0110526_341_1300 277
541 3300046499 Ga0495594_0012224 Ga0495594_0012224_2302_3195 277
542 3300048908 Ga0496105_0106852 Ga0496105_0106852_593_1510 277
543 3300048915 Ga0496112_0200310 Ga0496112_0200310_142_1059 277
544 3300048922 Ga0496119_0001741 Ga0496119_0001741_9826_10791 277
545 3300049568 Ga0501031_0233912 Ga0501031_0233912_151_1020 277
546 3300049569 Ga0501032_0018028 Ga0501032_0018028_2975_3859 277
547 3300049570 Ga0501033_0214140 Ga0501033_0214140_183_1052 277
548 3300049571 Ga0501034_0135748 Ga0501034_0135748_608_1492 277
549 3300049572 Ga0501036_0030159 Ga0501036_0030159_2934_3803 277
550 3300049573 Ga0501037_0032171 Ga0501037_0032171_1442_2311 277
551 3300049574 Ga0501038_0008148 Ga0501038_0008148_4083_4967 277
552 3300049574 Ga0501038_0026975 Ga0501038_0026975_3581_4567 277
553 3300049575 Ga0501039_0188569 Ga0501039_0188569_331_1200 277
554 3300049575 Ga0501039_0367029 Ga0501039_0367029_10_972 277
555 3300049581 Ga0501047_0016776 Ga0501047_0016776_935_1804 277
556 3300049587 Ga0501071_0132248 Ga0501071_0132248_816_1685 277
557 3300053139 Ga0500568_0001935 Ga0500568_0001935_5539_6459 277
558 iso_pu_bacteria 2643221690 2644502684 277
559 iso_pu_bacteria 2811994872 2812321943 277
560 iso_pu_bacteria 2852677369 2852678396 277
561 iso_pu_bacteria 2928090899 2928092914 277
562 iso_pu_bacteria 2946033335 2946036236 277
563 iso_pu_bacteria 2984580707 2984583534 277
564 iso_pu_bacteria 8045830549 8045833076 277
565 3300002773 JGI25152J39213_1019340 JGI25152J39213_10193401 278
566 3300003187 JGI25151J46595_10000959 JGI25151J46595_1000095911 278
567 3300003215 JGI25153J46596_10002309 JGI25153J46596_100023093 278
568 3300003215 JGI25153J46596_10025630 JGI25153J46596_100256302 278
569 3300003320 rootH2_10001863 rootH2_100018632 278
570 3300003354 JGI25160J50197_1002115 JGI25160J50197_10021154 278
571 3300003771 Ga0055526_1001290 Ga0055526_10012905 278
572 3300003775 Ga0055524_1003912 Ga0055524_10039126 278
573 3300003775 Ga0055524_1014379 Ga0055524_10143792 278
574 3300003781 Ga0055536_1001192 Ga0055536_10011929 278
575 3300003790 Ga0055528_1013145 Ga0055528_10131452 278
576 3300003790 Ga0055528_1014938 Ga0055528_10149383 278
577 3300003791 Ga0055530_10010116 Ga0055530_100101163 278
578 3300003792 Ga0055540_1000098 Ga0055540_100009832 278
579 3300003792 Ga0055540_1003220 Ga0055540_10032202 278
580 3300003792 Ga0055540_1035828 Ga0055540_10358282 278
581 3300003794 Ga0055531_10000527 Ga0055531_1000052722 278
582 3300003856 Ga0058692_1003432 Ga0058692_10034324 278
583 3300004625 Ga0055543_1000477 Ga0055543_10004773 278
584 3300005327 Ga0070658_10031142 Ga0070658_100311424 278
585 3300005344 Ga0070661_100015601 Ga0070661_1000156013 278
586 3300005366 Ga0070659_100050009 Ga0070659_1000500093 278
587 3300005434 Ga0070709_10000541 Ga0070709_1000054111 278
588 3300005435 Ga0070714_100012899 Ga0070714_1000128993 278
589 3300005437 Ga0070710_10000365 Ga0070710_100003659 278
590 3300005439 Ga0070711_100016976 Ga0070711_1000169762 278
591 3300005539 Ga0068853_100028275 Ga0068853_1000282754 278
592 3300005539 Ga0068853_100109925 Ga0068853_1001099252 278
593 3300005616 Ga0068852_100012890 Ga0068852_1000128903 278
594 3300005616 Ga0068852_100018090 Ga0068852_1000180901 278
595 3300005842 Ga0068858_100176361 Ga0068858_1001763612 278
596 3300005843 Ga0068860_100000194 Ga0068860_10000019434 278
597 3300006038 Ga0075365_10001478 Ga0075365_100014782 278
598 3300006038 Ga0075365_10012433 Ga0075365_100124333 278
599 3300006042 Ga0075368_10000042 Ga0075368_100000429 278
600 3300006042 Ga0075368_10025875 Ga0075368_100258752 278
601 3300006048 Ga0075363_100000055 Ga0075363_10000005514 278
602 3300006048 Ga0075363_100013634 Ga0075363_1000136342 278
603 3300006051 Ga0075364_10000047 Ga0075364_1000004722 278
604 3300006051 Ga0075364_10001963 Ga0075364_100019633 278
605 3300006173 Ga0070716_100001610 Ga0070716_1000016102 278
606 3300006175 Ga0070712_100002704 Ga0070712_1000027043 278
607 3300006177 Ga0075362_10005203 Ga0075362_100052035 278
608 3300006177 Ga0075362_10006866 Ga0075362_100068663 278
609 3300006178 Ga0075367_10000059 Ga0075367_1000005917 278
610 3300006178 Ga0075367_10108753 Ga0075367_101087532 278
611 3300006186 Ga0075369_10000424 Ga0075369_100004243 278
612 3300006195 Ga0075366_10000202 Ga0075366_1000020216 278
613 3300006237 Ga0097621_100423938 Ga0097621_1004239382 278
614 3300006353 Ga0075370_10000166 Ga0075370_1000016614 278
615 3300006946 Ga0079104_1000313 Ga0079104_100031354 278
616 3300006948 Ga0099826_10012835 Ga0099826_100128352 278
617 3300009098 Ga0105245_10172262 Ga0105245_101722622 278
618 3300009174 Ga0105241_10049632 Ga0105241_100496323 278
619 3300009545 Ga0105237_10008637 Ga0105237_100086378 278
620 3300009765 Ga0123341_1000002 Ga0123341_100000274 278
621 3300009766 Ga0123342_1024109 Ga0123342_10241093 278
622 3300011119 Ga0105246_10226987 Ga0105246_102269871 278
623 3300012500 Ga0157314_1001728 Ga0157314_10017282 278
624 3300013100 Ga0157373_10003272 Ga0157373_100032722 278
625 3300013102 Ga0157371_10016778 Ga0157371_100167785 278
626 3300013102 Ga0157371_10246035 Ga0157371_102460352 278
627 3300013104 Ga0157370_10000149 Ga0157370_1000014941 278
628 3300013104 Ga0157370_10035907 Ga0157370_100359073 278
629 3300013104 Ga0157370_10048863 Ga0157370_100488634 278
630 3300013105 Ga0157369_10239232 Ga0157369_102392323 278
631 3300013105 Ga0157369_10392116 Ga0157369_103921162 278
632 3300013297 Ga0157378_10501573 Ga0157378_105015732 278
633 3300013307 Ga0157372_10177191 Ga0157372_101771912 278
634 3300013307 Ga0157372_10517641 Ga0157372_105176412 278
635 3300025258 Ga0209129_1002413 Ga0209129_10024135 278
636 3300025273 Ga0209673_1000206 Ga0209673_100020664 278
637 3300025273 Ga0209673_1001634 Ga0209673_100163421 278
638 3300025273 Ga0209673_1003851 Ga0209673_10038516 278
639 3300025292 Ga0209676_1000792 Ga0209676_100079229 278
640 3300025294 Ga0209025_1000190 Ga0209025_100019096 278
641 3300025295 Ga0209564_1000987 Ga0209564_100098733 278
642 3300025295 Ga0209564_1019184 Ga0209564_10191843 278
643 3300025297 Ga0209758_1000115 Ga0209758_100011548 278
644 3300025297 Ga0209758_1000245 Ga0209758_100024560 278
645 3300025297 Ga0209758_1010146 Ga0209758_10101462 278
646 3300025298 Ga0209050_1006362 Ga0209050_10063624 278
647 3300025299 Ga0209256_1004637 Ga0209256_10046375 278
648 3300025299 Ga0209256_1018978 Ga0209256_10189782 278
649 3300025302 Ga0207426_1000109 Ga0207426_100010933 278
650 3300025303 Ga0209051_1000264 Ga0209051_100026432 278
651 3300025303 Ga0209051_1002028 Ga0209051_10020289 278
652 3300025303 Ga0209051_1006144 Ga0209051_10061442 278
653 3300025303 Ga0209051_1009703 Ga0209051_10097033 278
654 3300025304 Ga0209257_1003175 Ga0209257_10031759 278
655 3300025304 Ga0209257_1004220 Ga0209257_100422011 278
656 3300025898 Ga0207692_10000098 Ga0207692_1000009819 278
657 3300025900 Ga0207710_10009254 Ga0207710_100092541 278
658 3300025906 Ga0207699_10002623 Ga0207699_100026231 278
659 3300025909 Ga0207705_10198615 Ga0207705_101986152 278
660 3300025913 Ga0207695_10158976 Ga0207695_101589762 278
661 3300025915 Ga0207693_10013791 Ga0207693_100137915 278
662 3300025916 Ga0207663_10001007 Ga0207663_1000100710 278
663 3300025929 Ga0207664_10035182 Ga0207664_100351823 278
664 3300025939 Ga0207665_10008567 Ga0207665_100085672 278
665 3300025949 Ga0207667_10003507 Ga0207667_100035073 278
666 3300026035 Ga0207703_10066968 Ga0207703_100669682 278
667 3300026142 Ga0207698_10122722 Ga0207698_101227222 278
668 3300027111 Ga0209281_1000430 Ga0209281_10004308 278
669 3300027312 Ga0209371_1000534 Ga0209371_100053424 278
670 3300027666 Ga0209282_1031452 Ga0209282_10314523 278
671 3300027866 Ga0209813_10000115 Ga0209813_100001158 278
672 3300028381 Ga0268264_10000050 Ga0268264_1000005059 278
673 3300030500 Ga0268256_1003924 Ga0268256_10039245 278
674 3300030744 Ga0316181_1106863 Ga0316181_11068632 278
675 3300031507 Ga0307509_10114001 Ga0307509_101140012 278
676 3300031730 Ga0307516_10002464 Ga0307516_1000246418 278
677 3300041491 Ga0451833_1435920 Ga0451833_1435920_682_1518 278
678 3300041503 Ga0451847_0599232 Ga0451847_0599232_1709_2545 278
679 3300041505 Ga0451849_0125500 Ga0451849_0125500_587_1423 278
680 3300041512 Ga0451853_1510171 Ga0451853_1510171_324_1160 278
681 3300042006 Ga0439432_030620 Ga0439432_030620_478_1314 278
682 3300042015 Ga0439462_0035012 Ga0439462_0035012_43_879 278
683 3300046491 Ga0495584_0112350 Ga0495584_0112350_37_873 278
684 3300046492 Ga0495585_0001541 Ga0495585_0001541_15085_15921 278
685 3300046500 Ga0495596_0060466 Ga0495596_0060466_90_926 278
686 3300046506 Ga0495583_0039160 Ga0495583_0039160_556_1392 278
687 3300046507 Ga0495606_0036736 Ga0495606_0036736_1653_2489 278
688 3300046515 Ga0495620_0014604 Ga0495620_0014604_68_904 278
689 3300046522 Ga0495643_0092105 Ga0495643_0092105_32_868 278
690 3300046524 Ga0495648_0061610 Ga0495648_0061610_1143_1979 278
691 3300046538 Ga0495609_0023050 Ga0495609_0023050_1701_2537 278
692 3300046542 Ga0495597_0008120 Ga0495597_0008120_4116_4952 278
693 3300046558 Ga0495633_0026804 Ga0495633_0026804_1423_2259 278
694 3300046616 Ga0495668_0020018 Ga0495668_0020018_2058_2894 278
695 3300046648 Ga0495611_0133662 Ga0495611_0133662_17_853 278
696 3300046665 Ga0495661_0036699 Ga0495661_0036699_1214_2050 278
697 3300046692 Ga0495671_0030885 Ga0495671_0030885_1305_2141 278
698 3300047470 Ga0495681_0003221 Ga0495681_0003221_1032_1868 278
699 3300047472 Ga0495686_0050520 Ga0495686_0050520_245_1081 278
700 3300048909 Ga0496106_0003116 Ga0496106_0003116_8398_9234 278
701 3300048920 Ga0496117_0035922 Ga0496117_0035922_1450_2286 278
702 3300048920 Ga0496117_0117065 Ga0496117_0117065_79_915 278
703 3300048921 Ga0496118_0001844 Ga0496118_0001844_3426_4262 278
704 3300048922 Ga0496119_0000765 Ga0496119_0000765_32188_33024 278
705 3300048922 Ga0496119_0016710 Ga0496119_0016710_230_1066 278
706 3300048923 Ga0496120_0000383 Ga0496120_0000383_16373_17209 278
707 3300048923 Ga0496120_0008132 Ga0496120_0008132_1879_2715 278
708 3300048924 Ga0496121_0000337 Ga0496121_0000337_87978_88814 278
709 3300048924 Ga0496121_0000452 Ga0496121_0000452_19612_20448 278
710 3300048924 Ga0496121_0063912 Ga0496121_0063912_1864_2700 278
711 3300048925 Ga0496122_0000296 Ga0496122_0000296_93209_94045 278
712 3300048926 Ga0496123_0006674 Ga0496123_0006674_2593_3429 278
713 3300048927 Ga0496124_0000267 Ga0496124_0000267_72027_72863 278
714 3300048927 Ga0496124_0002031 Ga0496124_0002031_14074_14910 278
715 3300048928 Ga0496125_0006259 Ga0496125_0006259_880_1716 278
716 3300048928 Ga0496125_0016952 Ga0496125_0016952_5574_6410 278
717 3300048929 Ga0496126_0000002 Ga0496126_0000002_986040_986876 278
718 3300048929 Ga0496126_0000442 Ga0496126_0000442_13086_13922 278
719 3300048929 Ga0496126_0003480 Ga0496126_0003480_348_1184 278
720 3300048929 Ga0496126_0087289 Ga0496126_0087289_1284_2120 278
721 3300049459 Ga0495678_040659 Ga0495678_040659_680_1516 278
722 3300049570 Ga0501033_0073608 Ga0501033_0073608_868_1725 278
723 3300049571 Ga0501034_0013005 Ga0501034_0013005_3536_4375 278
724 3300049571 Ga0501034_0035104 Ga0501034_0035104_1915_2775 278
725 3300049571 Ga0501034_0137155 Ga0501034_0137155_981_1838 278
726 3300049572 Ga0501036_0012719 Ga0501036_0012719_4949_5806 278
727 3300049573 Ga0501037_0124512 Ga0501037_0124512_340_1197 278
728 3300049575 Ga0501039_0073021 Ga0501039_0073021_1396_2253 278
729 3300049579 Ga0501043_0016377 Ga0501043_0016377_105_962 278
730 3300049584 Ga0501068_0154724 Ga0501068_0154724_346_1203 278
731 3300049586 Ga0501070_0038308 Ga0501070_0038308_1480_2337 278
732 3300049671 Ga0501238_001266 Ga0501238_001266_637_1473 278
733 3300049758 Ga0501241_006977 Ga0501241_006977_257_1093 278
734 3300049822 Ga0501035_0049130 Ga0501035_0049130_1793_2650 278
735 3300050489 nmdc:mga03683_191_c1 nmdc:mga03683_191_c1_6622_7458 278
736 3300050489 nmdc:mga03683_51276_c1 nmdc:mga03683_51276_c1_287_1123 278
737 3300050490 nmdc:mga03n38_120_c1 nmdc:mga03n38_120_c1_14104_14940 278
738 3300050490 nmdc:mga03n38_28340_c1 nmdc:mga03n38_28340_c1_1320_2156 278
739 3300050491 nmdc:mga00v17_127908_c1 nmdc:mga00v17_127908_c1_24_860 278
740 3300050491 nmdc:mga00v17_136_c1 nmdc:mga00v17_136_c1_17849_18685 278
741 3300050491 nmdc:mga00v17_17983_c1 nmdc:mga00v17_17983_c1_2067_2903 278
742 3300050492 nmdc:mga0yw44_7277_c1 nmdc:mga0yw44_7277_c1_4466_5302 278
743 3300050492 nmdc:mga0yw44_75_c1 nmdc:mga0yw44_75_c1_9371_10207 278
744 3300050493 nmdc:mga0k408_211491_c1 nmdc:mga0k408_211491_c1_272_1126 278
745 3300050493 nmdc:mga0k408_480_c1 nmdc:mga0k408_480_c1_9728_10564 278
746 3300050494 nmdc:mga06z11_143_c1 nmdc:mga06z11_143_c1_8131_8967 278
747 3300050495 nmdc:mga04h51_88_c1 nmdc:mga04h51_88_c1_17072_17908 278
748 3300050496 nmdc:mga07m45_194098_c1 nmdc:mga07m45_194098_c1_17_853 278
749 3300050496 nmdc:mga07m45_757_c1 nmdc:mga07m45_757_c1_4875_5711 278
750 3300050516 nmdc:mga0sz30_422_c1 nmdc:mga0sz30_422_c1_9371_10207 278
751 3300053093 Ga0500651_0154662 Ga0500651_0154662_423_1259 278
752 3300053111 Ga0500572_005233 Ga0500572_005233_1141_1977 278
753 3300053118 Ga0500594_0046025 Ga0500594_0046025_264_1100 278
754 3300053134 Ga0500658_0002758 Ga0500658_0002758_2991_3827 278
755 3300053137 Ga0500561_0000129 Ga0500561_0000129_4512_5348 278
756 3300053153 Ga0500616_0000134 Ga0500616_0000134_62084_62920 278
757 3300053153 Ga0500616_0050962 Ga0500616_0050962_807_1643 278
758 3300053153 Ga0500616_0073887 Ga0500616_0073887_861_1697 278
759 3300053158 Ga0500627_0103789 Ga0500627_0103789_431_1267 278
760 3300053161 Ga0500634_0011578 Ga0500634_0011578_1298_2134 278
761 3300053177 Ga0500636_0000011 Ga0500636_0000011_27067_27903 278
762 3300053177 Ga0500636_0001544 Ga0500636_0001544_10792_11628 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

137

320

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8674 1 268
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8523 1 268
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8466 9 269
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8378 9 278
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.836 1 268
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9504 11 268 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.923 3 265 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9185 11 268 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.916 11 268 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9065 3 265 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3D4ZJS8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9907 35 278 GO:0005524
GO:0005886
GO:0055085
AF-A0A3D4ZJS8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9826 35 278 GO:0005524
GO:0005886
GO:0055085
AF-A0A4Q2BNR0-F1-model_v4 deleted 0.9793 11 275
AF-A0A238W3S3-F1-model_v4 Carbohydrate ABC transporter membrane protein 2, CUT1 family 0.9742 9 278 GO:0005886
GO:0055085
AF-A0A7K3LZ04-F1-model_v4 ABC transporter permease subunit 0.9737 23 275 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.04 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map