F479635

General Info

Members Datasets Scaffolds Average Seq Length
762 290 1520 330

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10198177|Ga0207674_101981771
Length 384
Sequence VSAVYATCLFCKKPLGKNETFETFPVGKRLAFDAAKGRLWVVCPHCERWNLSPLEDRWEAIESAEKLFRDARQRVSTDNIGLAKLRDGTTLVRIGVPQRPEFAAWRYGDQFGRRRRRQIAIVGAGVGALSALVIGGATAGVGIGGFGWILARAGGNIVRGNPETVVARIRTPAGETLKIRRRHLLETAITPGTSAPFAIDLRYIGGGAHFEGADAMRIASVIVPAANRFGGNKQTVAQAVGTIEESGGAEGFLDRLSQVAAVTTRTRLRPEATGSGAWTLQQGGGVRWGGLQLGGRDSWRERRRFGDQWSTGLFGLDPVQRLALEMALHEDAERAALEGELGELERAWQEAEEIAGISDNLLLPESLTGALDKLRRKPERGSND

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 99.21
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10198177 3300026116 Bacteria 1957
2 Ga0070658_10019530 3300005327 Bacteria 5426
3 Ga0070676_10056837 3300005328 Bacteria 2313
4 Ga0070676_10206283 3300005328 Bacteria 1291
5 Ga0070683_100000212 3300005329 Bacteria 39437
6 Ga0070683_100011145 3300005329 Bacteria 7756
7 Ga0070683_100056067 3300005329 Bacteria 3659
8 Ga0070683_100080376 3300005329 Unclassified 3052
9 Ga0070683_100088370 3300005329 Unclassified 2907
10 Ga0070683_100261708 3300005329 Bacteria 1645
11 Ga0070690_100004655 3300005330 Bacteria 7640
12 Ga0070690_100106051 3300005330 Bacteria 1869
13 Ga0070670_100002832 3300005331 Bacteria 14346
14 Ga0070670_100003527 3300005331 Bacteria 13006
15 Ga0070670_100007611 3300005331 Bacteria 9198
16 Ga0070670_100013334 3300005331 Bacteria 7039
17 Ga0070670_100019279 3300005331 Bacteria 5851
18 Ga0070670_100101159 3300005331 Unclassified 2482
19 Ga0070670_100250001 3300005331 Bacteria 1544
20 Ga0068869_100004474 3300005334 Bacteria 8689
21 Ga0068869_100018000 3300005334 Bacteria 4801
22 Ga0068869_100166599 3300005334 Bacteria 1719
23 Ga0070680_100002751 3300005336 Bacteria 13049
24 Ga0070680_100004200 3300005336 Bacteria 10799
25 Ga0070680_100006243 3300005336 Bacteria 9041
26 Ga0070680_100031477 3300005336 Bacteria 4266
27 Ga0070680_100158126 3300005336 Bacteria 1904
28 Ga0070682_100004935 3300005337 Bacteria 7407
29 Ga0068868_100029367 3300005338 Bacteria 4210
30 Ga0068868_100043932 3300005338 Bacteria 3492
31 Ga0068868_100238482 3300005338 Bacteria 1527
32 Ga0070660_100059044 3300005339 Bacteria 2975
33 Ga0070660_100090121 3300005339 Bacteria 2417
34 Ga0070689_100004026 3300005340 Bacteria 9885
35 Ga0070689_100142297 3300005340 Bacteria 1929
36 Ga0070691_10014872 3300005341 Bacteria 3573
37 Ga0070687_100012294 3300005343 Bacteria 3776
38 Ga0070687_100029824 3300005343 Bacteria 2661
39 Ga0070661_100001600 3300005344 Bacteria 15684
40 Ga0070661_100004241 3300005344 Bacteria 9886
41 Ga0070661_100007075 3300005344 Bacteria 7739
42 Ga0070661_100019436 3300005344 Bacteria 4842
43 Ga0070668_100005416 3300005347 Bacteria 9473
44 Ga0070668_100016456 3300005347 Bacteria 5529
45 Ga0070668_100109317 3300005347 Bacteria 2200
46 Ga0070668_100164778 3300005347 Bacteria 1801
47 Ga0070669_100001623 3300005353 Bacteria 16252
48 Ga0070669_100001987 3300005353 Bacteria 14788
49 Ga0070669_100068854 3300005353 Unclassified 2613
50 Ga0070669_100126886 3300005353 Bacteria 1953
51 Ga0070669_100177330 3300005353 Bacteria 1665
52 Ga0070675_100002385 3300005354 Bacteria 13992
53 Ga0070675_100010668 3300005354 Bacteria 7182
54 Ga0070675_100010999 3300005354 Bacteria 7086
55 Ga0070675_100036555 3300005354 Bacteria 3997
56 Ga0070675_100102477 3300005354 Bacteria 2412
57 Ga0070675_100205980 3300005354 Bacteria 1709
58 Ga0070675_100266074 3300005354 Bacteria 1503
59 Ga0070671_100050599 3300005355 Bacteria 3455
60 Ga0070674_100016979 3300005356 Bacteria 4568
61 Ga0070674_100187876 3300005356 Bacteria 1587
62 Ga0070674_100243587 3300005356 Bacteria 1409
63 Ga0070673_100048799 3300005364 Bacteria 3302
64 Ga0070673_100124545 3300005364 Unclassified 2155
65 Ga0070673_100283902 3300005364 Bacteria 1453
66 Ga0070688_100006914 3300005365 Bacteria 6091
67 Ga0070688_100065626 3300005365 Bacteria 2307
68 Ga0070688_100101873 3300005365 Unclassified 1895
69 Ga0070659_100000786 3300005366 Bacteria 23099
70 Ga0070659_100039275 3300005366 Bacteria 3694
71 Ga0070659_100078415 3300005366 Bacteria 2635
72 Ga0070659_100353428 3300005366 Bacteria 1233
73 Ga0070667_100011736 3300005367 Bacteria 7239
74 Ga0070667_100239161 3300005367 Unclassified 1621
75 Ga0070714_100005787 3300005435 Bacteria 9480
76 Ga0070714_100011211 3300005435 Bacteria 7108
77 Ga0070714_100024630 3300005435 Unclassified 4958
78 Ga0070714_100117211 3300005435 Unclassified 2365
79 Ga0070713_100000318 3300005436 Bacteria 31493
80 Ga0070713_100004113 3300005436 Bacteria 9695
81 Ga0070713_100046489 3300005436 Bacteria 3562
82 Ga0070710_10088708 3300005437 Bacteria 1820
83 Ga0070701_10101420 3300005438 Bacteria 1595
84 Ga0070711_100058634 3300005439 Bacteria 2670
85 Ga0070711_100212608 3300005439 Bacteria 1499
86 Ga0070700_100046251 3300005441 Bacteria 2688
87 Ga0070694_100021755 3300005444 Bacteria 4103
88 Ga0070694_100023634 3300005444 Bacteria 3956
89 Ga0070694_100198724 3300005444 Bacteria 1493
90 Ga0070694_100282881 3300005444 Bacteria 1265
91 Ga0070694_100309852 3300005444 Bacteria 1212
92 Ga0070708_100025007 3300005445 Bacteria 5103
93 Ga0070663_100011577 3300005455 Bacteria 5544
94 Ga0070662_100000688 3300005457 Bacteria 20645
95 Ga0070662_100012673 3300005457 Bacteria 5596
96 Ga0070662_100058063 3300005457 Bacteria 2815
97 Ga0070662_100061303 3300005457 Bacteria 2746
98 Ga0070662_100065528 3300005457 Bacteria 2663
99 Ga0070662_100220984 3300005457 Bacteria 1511
100 Ga0070681_10000203 3300005458 Bacteria 46433
101 Ga0070681_10002461 3300005458 Bacteria 16966
102 Ga0070681_10003935 3300005458 Bacteria 14006
103 Ga0070681_10007481 3300005458 Bacteria 10674
104 Ga0070681_10022183 3300005458 Bacteria 6373
105 Ga0070681_10036089 3300005458 Unclassified 4966
106 Ga0070681_10041972 3300005458 Unclassified 4585
107 Ga0068867_100007712 3300005459 Bacteria 7612
108 Ga0068867_100008713 3300005459 Bacteria 7162
109 Ga0070685_10166626 3300005466 Bacteria 1409
110 Ga0070706_100037714 3300005467 Archaea 4463
111 Ga0070707_100176246 3300005468 Bacteria 2084
112 Ga0070698_100001461 3300005471 Bacteria 26242
113 Ga0070698_100036464 3300005471 Bacteria 5079
114 Ga0070698_100056272 3300005471 Bacteria 3987
115 Ga0070698_100060884 3300005471 Bacteria 3808
116 Ga0070698_100075248 3300005471 Archaea 3381
117 Ga0070698_100084572 3300005471 Bacteria 3161
118 Ga0070698_100085618 3300005471 Bacteria 3139
119 Ga0070698_100105550 3300005471 Bacteria 2787
120 Ga0070698_100334731 3300005471 Bacteria 1445
121 Ga0070699_100066694 3300005518 Bacteria 3125
122 Ga0070699_100089349 3300005518 Bacteria 2692
123 Ga0070679_100000214 3300005530 Bacteria 47230
124 Ga0070679_100004341 3300005530 Bacteria 13095
125 Ga0070679_100007469 3300005530 Bacteria 10217
126 Ga0070679_100010139 3300005530 Bacteria 8932
127 Ga0070679_100011725 3300005530 Bacteria 8355
128 Ga0070679_100016410 3300005530 Bacteria 7141
129 Ga0070679_100046000 3300005530 Bacteria 4349
130 Ga0070679_100073334 3300005530 Bacteria 3415
131 Ga0070679_100151352 3300005530 Bacteria 2296
132 Ga0070679_100161707 3300005530 Bacteria 2213
133 Ga0070679_100305609 3300005530 Unclassified 1541
134 Ga0070684_100005184 3300005535 Bacteria 9966
135 Ga0070684_100009324 3300005535 Bacteria 7727
136 Ga0070684_100023573 3300005535 Bacteria 5152
137 Ga0070684_100082985 3300005535 Bacteria 2839
138 Ga0070684_100094737 3300005535 Bacteria 2660
139 Ga0070684_100131009 3300005535 Bacteria 2262
140 Ga0070684_100303638 3300005535 Bacteria 1465
141 Ga0070684_100343357 3300005535 Unclassified 1373
142 Ga0068853_100013999 3300005539 Bacteria 6562
143 Ga0068853_100470736 3300005539 Bacteria 1184
144 Ga0070672_100012962 3300005543 Bacteria 5875
145 Ga0070672_100025942 3300005543 Bacteria 4353
146 Ga0070672_100039410 3300005543 Bacteria 3619
147 Ga0070672_100067679 3300005543 Bacteria 2830
148 Ga0070693_100001777 3300005547 Bacteria 9829
149 Ga0070693_100010031 3300005547 Bacteria 4727
150 Ga0070665_100018336 3300005548 Bacteria 7015
151 Ga0068855_100032710 3300005563 Bacteria 6209
152 Ga0068855_100081425 3300005563 Bacteria 3752
153 Ga0068855_100292790 3300005563 Unclassified 1804
154 Ga0070664_100000800 3300005564 Bacteria 24260
155 Ga0070664_100001632 3300005564 Bacteria 17957
156 Ga0070664_100016349 3300005564 Bacteria 6082
157 Ga0070664_100016995 3300005564 Bacteria 5971
158 Ga0070664_100026134 3300005564 Bacteria 4841
159 Ga0070664_100047395 3300005564 Unclassified 3630
160 Ga0070664_100050049 3300005564 Bacteria 3535
161 Ga0070664_100106779 3300005564 Bacteria 2440
162 Ga0070664_100185420 3300005564 Bacteria 1851
163 Ga0068857_100011926 3300005577 Bacteria 7557
164 Ga0068857_100016373 3300005577 Bacteria 6497
165 Ga0068857_100019618 3300005577 Bacteria 5939
166 Ga0068854_100085831 3300005578 Unclassified 2332
167 Ga0068854_100104845 3300005578 Bacteria 2125
168 Ga0068856_100000688 3300005614 Bacteria 36724
169 Ga0068856_100263845 3300005614 Bacteria 1738
170 Ga0070702_100000930 3300005615 Bacteria 11459
171 Ga0068852_100008096 3300005616 Bacteria 7714
172 Ga0068852_100011875 3300005616 Bacteria 6585
173 Ga0068852_100016276 3300005616 Bacteria 5793
174 Ga0068852_100025598 3300005616 Unclassified 4783
175 Ga0068859_100006306 3300005617 Bacteria 12028
176 Ga0068859_100098960 3300005617 Bacteria 2971
177 Ga0068859_100104711 3300005617 Bacteria 2889
178 Ga0068859_100199725 3300005617 Bacteria 2084
179 Ga0068864_100003639 3300005618 Bacteria 12740
180 Ga0068864_100021610 3300005618 Bacteria 5388
181 Ga0068864_100073530 3300005618 Unclassified 2981
182 Ga0068864_100083677 3300005618 Unclassified 2802
183 Ga0068866_10033406 3300005718 Bacteria 2496
184 Ga0068861_100012009 3300005719 Bacteria 6033
185 Ga0068861_100022544 3300005719 Bacteria 4539
186 Ga0068861_100032095 3300005719 Bacteria 3863
187 Ga0068861_100034623 3300005719 Bacteria 3735
188 Ga0068851_10019460 3300005834 Unclassified 3281
189 Ga0068870_10003148 3300005840 Bacteria 6961
190 Ga0068870_10027339 3300005840 Bacteria 2852
191 Ga0068870_10042740 3300005840 Bacteria 2361
192 Ga0068863_100004426 3300005841 Bacteria 13856
193 Ga0068863_100007587 3300005841 Bacteria 10608
194 Ga0068863_100146570 3300005841 Bacteria 2258
195 Ga0068858_100009593 3300005842 Bacteria 9231
196 Ga0068860_100010330 3300005843 Bacteria 9231
197 Ga0068860_100072838 3300005843 Bacteria 3265
198 Ga0068860_100102193 3300005843 Bacteria 2735
199 Ga0068860_100344220 3300005843 Bacteria 1466
200 Ga0068860_100485674 3300005843 Bacteria 1231
201 Ga0068862_100000532 3300005844 Bacteria 39799
202 Ga0068862_100002120 3300005844 Bacteria 17875
203 Ga0068862_100023561 3300005844 Bacteria 5159
204 Ga0068862_100339234 3300005844 Bacteria 1391
205 Ga0070717_10003174 3300006028 Bacteria 11740
206 Ga0068871_100009622 3300006358 Bacteria 7018
207 Ga0068871_100247053 3300006358 Bacteria 1553
208 Ga0075428_100064075 3300006844 Bacteria 4025
209 Ga0075428_100102309 3300006844 Bacteria 3124
210 Ga0075428_100110725 3300006844 Bacteria 2991
211 Ga0075428_100190257 3300006844 Bacteria 2220
212 Ga0075430_100005952 3300006846 Bacteria 10298
213 Ga0075430_100010311 3300006846 Bacteria 7912
214 Ga0075430_100011844 3300006846 Bacteria 7422
215 Ga0075430_100033812 3300006846 Bacteria 4338
216 Ga0075430_100039391 3300006846 Bacteria 4001
217 Ga0075430_100109374 3300006846 Bacteria 2305
218 Ga0075430_100124745 3300006846 Bacteria 2146
219 Ga0075430_100208762 3300006846 Bacteria 1620
220 Ga0075430_100299104 3300006846 Bacteria 1331
221 Ga0075431_100045831 3300006847 Bacteria 4507
222 Ga0075431_100066766 3300006847 Bacteria 3714
223 Ga0075431_100125320 3300006847 Bacteria 2651
224 Ga0075431_100168949 3300006847 Bacteria 2248
225 Ga0075431_100244251 3300006847 Bacteria 1825
226 Ga0075431_100260273 3300006847 Bacteria 1761
227 Ga0075433_10098496 3300006852 Unclassified 2588
228 Ga0075433_10187243 3300006852 Unclassified 1841
229 Ga0075434_100020843 3300006871 Bacteria 6365
230 Ga0075434_100024845 3300006871 Bacteria 5857
231 Ga0075434_100030401 3300006871 Bacteria 5318
232 Ga0075434_100168155 3300006871 Bacteria 2212
233 Ga0075429_100049973 3300006880 Bacteria 3638
234 Ga0075429_100056200 3300006880 Bacteria 3425
235 Ga0075429_100083410 3300006880 Unclassified 2786
236 Ga0075429_100093780 3300006880 Bacteria 2618
237 Ga0075429_100320340 3300006880 Unclassified 1357
238 Ga0068865_100024985 3300006881 Bacteria 3924
239 Ga0068865_100222727 3300006881 Bacteria 1475
240 Ga0075436_100009011 3300006914 Bacteria 6827
241 Ga0097620_100006306 3300006931 Bacteria 12028
242 Ga0097620_100098966 3300006931 Bacteria 2971
243 Ga0097620_100104702 3300006931 Bacteria 2889
244 Ga0097620_100199721 3300006931 Bacteria 2084
245 Ga0075435_100077430 3300007076 Bacteria 2726
246 Ga0075435_100110772 3300007076 Bacteria 2283
247 Ga0075435_100187414 3300007076 Bacteria 1750
248 Ga0105240_10250599 3300009093 Unclassified 2048
249 Ga0111539_10025648 3300009094 Bacteria 7223
250 Ga0111539_10065774 3300009094 Bacteria 4283
251 Ga0111539_10074346 3300009094 Unclassified 4004
252 Ga0111539_10166925 3300009094 Unclassified 2573
253 Ga0111539_10375323 3300009094 Bacteria 1655
254 Ga0111539_10424682 3300009094 Bacteria 1548
255 Ga0105245_10020091 3300009098 Bacteria 5855
256 Ga0105245_10326420 3300009098 Bacteria 1513
257 Ga0105245_10573252 3300009098 Unclassified 1153
258 Ga0114129_10058540 3300009147 Bacteria 5389
259 Ga0114129_10118161 3300009147 Bacteria 3652
260 Ga0114129_10192247 3300009147 Bacteria 2770
261 Ga0114129_10475264 3300009147 Bacteria 1636
262 Ga0105241_10006974 3300009174 Bacteria 8312
263 Ga0105242_10111951 3300009176 Bacteria 2328
264 Ga0105242_10149764 3300009176 Bacteria 2034
265 Ga0105242_10169902 3300009176 Bacteria 1915
266 Ga0105242_10211336 3300009176 Bacteria 1729
267 Ga0105248_10005447 3300009177 Bacteria 13986
268 Ga0105248_10010434 3300009177 Bacteria 10231
269 Ga0105248_10153603 3300009177 Bacteria 2597
270 Ga0105248_10205487 3300009177 Unclassified 2219
271 Ga0105248_10352835 3300009177 Bacteria 1656
272 Ga0105237_10038184 3300009545 Bacteria 4851
273 Ga0105238_10027413 3300009551 Bacteria 5804
274 Ga0105238_10049213 3300009551 Bacteria 4246
275 Ga0105238_10245336 3300009551 Unclassified 1769
276 Ga0105238_10316150 3300009551 Bacteria 1547
277 Ga0105249_10000075 3300009553 Bacteria 145150
278 Ga0105249_10000277 3300009553 Bacteria 54091
279 Ga0105249_10019194 3300009553 Bacteria 6096
280 Ga0105249_10088446 3300009553 Bacteria 2893
281 Ga0105239_10063215 3300010375 Bacteria 4063
282 Ga0105246_10002193 3300011119 Bacteria 11779
283 Ga0157373_10012037 3300013100 Bacteria 6359
284 Ga0157373_10013689 3300013100 Bacteria 5948
285 Ga0157373_10037762 3300013100 Bacteria 3461
286 Ga0157371_10006728 3300013102 Bacteria 9397
287 Ga0157371_10029747 3300013102 Bacteria 3946
288 Ga0157370_10000373 3300013104 Bacteria 56343
289 Ga0157369_10031066 3300013105 Bacteria 5886
290 Ga0157369_10044399 3300013105 Bacteria 4838
291 Ga0157369_10138243 3300013105 Unclassified 2578
292 Ga0157374_10051122 3300013296 Bacteria 3845
293 Ga0157374_10066151 3300013296 Bacteria 3397
294 Ga0157374_10109036 3300013296 Bacteria 2661
295 Ga0157378_10012936 3300013297 Bacteria 7300
296 Ga0157378_10095117 3300013297 Bacteria 2713
297 Ga0163162_10032621 3300013306 Bacteria 5173
298 Ga0163162_10057160 3300013306 Bacteria 3929
299 Ga0163162_10287725 3300013306 Bacteria 1775
300 Ga0157372_10003297 3300013307 Bacteria 17438
301 Ga0157372_10006067 3300013307 Bacteria 12837
302 Ga0157372_10009010 3300013307 Bacteria 10607
303 Ga0157372_10012360 3300013307 Bacteria 9098
304 Ga0157372_10024696 3300013307 Bacteria 6532
305 Ga0157372_10033490 3300013307 Bacteria 5644
306 Ga0157372_10064776 3300013307 Bacteria 4101
307 Ga0157372_10079094 3300013307 Unclassified 3717
308 Ga0157372_10132822 3300013307 Bacteria 2865
309 Ga0157372_10199830 3300013307 Bacteria 2315
310 Ga0157372_10213141 3300013307 Unclassified 2238
311 Ga0157372_10276291 3300013307 Bacteria 1953
312 Ga0157375_10013367 3300013308 Bacteria 7301
313 Ga0157375_10049007 3300013308 Bacteria 4136
314 Ga0157375_10059463 3300013308 Bacteria 3787
315 Ga0157375_10140234 3300013308 Bacteria 2544
316 Ga0157375_10159122 3300013308 Bacteria 2399
317 Ga0163163_10004551 3300014325 Bacteria 11843
318 Ga0163163_10019656 3300014325 Bacteria 6346
319 Ga0163163_10096921 3300014325 Unclassified 2970
320 Ga0157380_10007946 3300014326 Bacteria 7553
321 Ga0157380_10022969 3300014326 Bacteria 4704
322 Ga0157380_10035014 3300014326 Bacteria 3876
323 Ga0157380_10483272 3300014326 Bacteria 1198
324 Ga0182008_10087080 3300014497 Bacteria 1538
325 Ga0157377_10001250 3300014745 Bacteria 10870
326 Ga0157377_10024950 3300014745 Unclassified 3183
327 Ga0157377_10117200 3300014745 Unclassified 1609
328 Ga0157377_10125207 3300014745 Bacteria 1562
329 Ga0157379_10109282 3300014968 Bacteria 2483
330 Ga0157376_10007194 3300014969 Bacteria 7914
331 Ga0157376_10302962 3300014969 Unclassified 1513
332 Ga0182007_10057720 3300015262 Bacteria 1274
333 Ga0163161_10009962 3300017792 Bacteria 6583
334 Ga0163161_10048311 3300017792 Bacteria 3073
335 Ga0163161_10132893 3300017792 Bacteria 1879
336 Ga0206356_11376601 3300020070 Bacteria 2253
337 Ga0206354_10720845 3300020081 Bacteria 2203
338 Ga0206353_10209995 3300020082 Bacteria 1140
339 Ga0207656_10007621 3300025321 Bacteria 3952
340 Ga0207656_10016758 3300025321 Unclassified 2858
341 Ga0207682_10033828 3300025893 Bacteria 2059
342 Ga0207642_10034076 3300025899 Bacteria 2161
343 Ga0207688_10002492 3300025901 Bacteria 9911
344 Ga0207699_10054399 3300025906 Bacteria 2377
345 Ga0207645_10000126 3300025907 Bacteria 58037
346 Ga0207645_10000294 3300025907 Bacteria 41976
347 Ga0207643_10008112 3300025908 Bacteria 5634
348 Ga0207643_10010705 3300025908 Bacteria 4942
349 Ga0207643_10014810 3300025908 Bacteria 4241
350 Ga0207643_10098785 3300025908 Bacteria 1710
351 Ga0207705_10016998 3300025909 Bacteria 5210
352 Ga0207684_10030249 3300025910 Archaea 4611
353 Ga0207654_10013736 3300025911 Unclassified 4172
354 Ga0207707_10010208 3300025912 Bacteria 8152
355 Ga0207707_10013409 3300025912 Bacteria 7146
356 Ga0207707_10014075 3300025912 Bacteria 6973
357 Ga0207707_10017462 3300025912 Bacteria 6256
358 Ga0207707_10024041 3300025912 Bacteria 5328
359 Ga0207707_10025867 3300025912 Bacteria 5133
360 Ga0207707_10051805 3300025912 Bacteria 3574
361 Ga0207707_10056868 3300025912 Bacteria 3404
362 Ga0207707_10301353 3300025912 Bacteria 1386
363 Ga0207707_10405583 3300025912 Bacteria 1170
364 Ga0207695_10011232 3300025913 Bacteria 10859
365 Ga0207695_10029099 3300025913 Bacteria 6113
366 Ga0207695_10043539 3300025913 Unclassified 4784
367 Ga0207695_10063825 3300025913 Bacteria 3795
368 Ga0207693_10251333 3300025915 Bacteria 1387
369 Ga0207663_10193323 3300025916 Bacteria 1462
370 Ga0207660_10005613 3300025917 Bacteria 8147
371 Ga0207660_10015509 3300025917 Bacteria 5030
372 Ga0207660_10021456 3300025917 Bacteria 4343
373 Ga0207660_10189083 3300025917 Bacteria 1602
374 Ga0207662_10000711 3300025918 Bacteria 15229
375 Ga0207662_10002952 3300025918 Bacteria 8646
376 Ga0207662_10008825 3300025918 Bacteria 5531
377 Ga0207662_10067136 3300025918 Bacteria 2162
378 Ga0207657_10016167 3300025919 Bacteria 7203
379 Ga0207657_10037627 3300025919 Bacteria 4318
380 Ga0207657_10148872 3300025919 Unclassified 1908
381 Ga0207649_10003837 3300025920 Bacteria 8197
382 Ga0207649_10013146 3300025920 Bacteria 4617
383 Ga0207649_10048424 3300025920 Unclassified 2621
384 Ga0207649_10106375 3300025920 Bacteria 1866
385 Ga0207652_10012014 3300025921 Bacteria 6989
386 Ga0207652_10015261 3300025921 Bacteria 6235
387 Ga0207652_10041589 3300025921 Bacteria 3908
388 Ga0207652_10052010 3300025921 Bacteria 3514
389 Ga0207652_10085782 3300025921 Unclassified 2760
390 Ga0207652_10112713 3300025921 Unclassified 2414
391 Ga0207652_10130153 3300025921 Bacteria 2244
392 Ga0207652_10144225 3300025921 Bacteria 2130
393 Ga0207652_10277293 3300025921 Bacteria 1512
394 Ga0207646_10168184 3300025922 Bacteria 1979
395 Ga0207681_10001038 3300025923 Bacteria 18033
396 Ga0207681_10002221 3300025923 Bacteria 12362
397 Ga0207681_10042424 3300025923 Unclassified 3039
398 Ga0207681_10098738 3300025923 Bacteria 2101
399 Ga0207694_10015473 3300025924 Bacteria 5753
400 Ga0207694_10099012 3300025924 Unclassified 2309
401 Ga0207694_10345939 3300025924 Bacteria 1230
402 Ga0207650_10019893 3300025925 Bacteria 4725
403 Ga0207650_10030435 3300025925 Bacteria 3888
404 Ga0207650_10155722 3300025925 Bacteria 1807
405 Ga0207659_10003881 3300025926 Bacteria 9013
406 Ga0207659_10029463 3300025926 Bacteria 3742
407 Ga0207659_10072794 3300025926 Bacteria 2514
408 Ga0207659_10079495 3300025926 Bacteria 2419
409 Ga0207659_10102220 3300025926 Unclassified 2163
410 Ga0207659_10245995 3300025926 Bacteria 1449
411 Ga0207659_10318073 3300025926 Bacteria 1283
412 Ga0207687_10021346 3300025927 Bacteria 4301
413 Ga0207687_10209922 3300025927 Bacteria 1527
414 Ga0207700_10001570 3300025928 Bacteria 12958
415 Ga0207664_10010448 3300025929 Bacteria 6557
416 Ga0207664_10050733 3300025929 Unclassified 3273
417 Ga0207644_10056411 3300025931 Bacteria 2835
418 Ga0207644_10099890 3300025931 Bacteria 2178
419 Ga0207644_10178076 3300025931 Bacteria 1665
420 Ga0207644_10200453 3300025931 Bacteria 1574
421 Ga0207690_10004883 3300025932 Bacteria 7909
422 Ga0207690_10006007 3300025932 Bacteria 7194
423 Ga0207690_10072136 3300025932 Bacteria 2384
424 Ga0207706_10000472 3300025933 Bacteria 43032
425 Ga0207706_10003170 3300025933 Bacteria 15795
426 Ga0207706_10006226 3300025933 Bacteria 11091
427 Ga0207706_10020426 3300025933 Bacteria 5955
428 Ga0207706_10035044 3300025933 Bacteria 4465
429 Ga0207706_10117252 3300025933 Bacteria 2342
430 Ga0207706_10143875 3300025933 Bacteria 2098
431 Ga0207706_10190251 3300025933 Bacteria 1802
432 Ga0207706_10289564 3300025933 Unclassified 1428
433 Ga0207670_10093818 3300025936 Bacteria 2128
434 Ga0207670_10137492 3300025936 Bacteria 1798
435 Ga0207670_10290446 3300025936 Bacteria 1277
436 Ga0207669_10083279 3300025937 Unclassified 2057
437 Ga0207704_10139562 3300025938 Bacteria 1693
438 Ga0207665_10156628 3300025939 Bacteria 1635
439 Ga0207691_10000248 3300025940 Bacteria 53460
440 Ga0207691_10002354 3300025940 Bacteria 18504
441 Ga0207691_10006593 3300025940 Bacteria 11211
442 Ga0207691_10040044 3300025940 Bacteria 4333
443 Ga0207691_10071524 3300025940 Bacteria 3130
444 Ga0207691_10078899 3300025940 Bacteria 2963
445 Ga0207711_10015581 3300025941 Bacteria 6310
446 Ga0207711_10173576 3300025941 Bacteria 1957
447 Ga0207711_10256765 3300025941 Bacteria 1606
448 Ga0207689_10008296 3300025942 Bacteria 9052
449 Ga0207689_10012676 3300025942 Bacteria 7203
450 Ga0207689_10051944 3300025942 Bacteria 3378
451 Ga0207661_10000796 3300025944 Bacteria 20630
452 Ga0207661_10004013 3300025944 Bacteria 10288
453 Ga0207661_10012192 3300025944 Bacteria 6242
454 Ga0207661_10050479 3300025944 Bacteria 3314
455 Ga0207661_10074175 3300025944 Unclassified 2788
456 Ga0207661_10121497 3300025944 Bacteria 2224
457 Ga0207679_10000957 3300025945 Bacteria 18523
458 Ga0207679_10002675 3300025945 Bacteria 11003
459 Ga0207679_10002711 3300025945 Bacteria 10954
460 Ga0207679_10009978 3300025945 Bacteria 6100
461 Ga0207679_10055842 3300025945 Bacteria 2913
462 Ga0207679_10102263 3300025945 Bacteria 2243
463 Ga0207679_10152508 3300025945 Unclassified 1883
464 Ga0207667_10078710 3300025949 Bacteria 3417
465 Ga0207667_10125948 3300025949 Bacteria 2638
466 Ga0207667_10151626 3300025949 Bacteria 2385
467 Ga0207667_10312804 3300025949 Unclassified 1604
468 Ga0207651_10225945 3300025960 Unclassified 1516
469 Ga0207712_10001329 3300025961 Bacteria 16923
470 Ga0207712_10006793 3300025961 Bacteria 7216
471 Ga0207712_10018700 3300025961 Bacteria 4515
472 Ga0207712_10093234 3300025961 Bacteria 2222
473 Ga0207668_10001958 3300025972 Bacteria 12050
474 Ga0207668_10013395 3300025972 Bacteria 5048
475 Ga0207640_10008894 3300025981 Bacteria 5595
476 Ga0207640_10112333 3300025981 Bacteria 1934
477 Ga0207658_10165535 3300025986 Bacteria 1816
478 Ga0207658_10305260 3300025986 Unclassified 1373
479 Ga0207639_10024773 3300026041 Bacteria 4347
480 Ga0207678_10029241 3300026067 Bacteria 4808
481 Ga0207708_10008816 3300026075 Bacteria 7465
482 Ga0207708_10013505 3300026075 Bacteria 6106
483 Ga0207702_10022731 3300026078 Bacteria 5201
484 Ga0207641_10016841 3300026088 Bacteria 5985
485 Ga0207648_10007822 3300026089 Bacteria 10437
486 Ga0207648_10032581 3300026089 Bacteria 4600
487 Ga0207648_10078779 3300026089 Bacteria 2875
488 Ga0207648_10081232 3300026089 Bacteria 2828
489 Ga0207648_10100297 3300026089 Bacteria 2536
490 Ga0207648_10228833 3300026089 Unclassified 1653
491 Ga0207676_10003946 3300026095 Bacteria 10473
492 Ga0207676_10150908 3300026095 Unclassified 2001
493 Ga0207674_10000736 3300026116 Bacteria 42809
494 Ga0207674_10001081 3300026116 Bacteria 35413
495 Ga0207674_10002802 3300026116 Bacteria 21703
496 Ga0207674_10008570 3300026116 Bacteria 11788
497 Ga0207674_10013184 3300026116 Bacteria 9195
498 Ga0207674_10025709 3300026116 Bacteria 6269
499 Ga0207674_10043177 3300026116 Bacteria 4650
500 Ga0207674_10156774 3300026116 Unclassified 2232
501 Ga0207675_100000373 3300026118 Bacteria 43010
502 Ga0207675_100000705 3300026118 Bacteria 33099
503 Ga0207675_100015530 3300026118 Bacteria 7102
504 Ga0207675_100055526 3300026118 Bacteria 3695
505 Ga0207683_10058281 3300026121 Bacteria 3391
506 Ga0207698_10022859 3300026142 Bacteria 4358
507 Ga0207698_10300029 3300026142 Bacteria 1495
508 Ga0207698_10401176 3300026142 Bacteria 1310
509 Ga0207428_10108999 3300027907 Bacteria 2132
510 Ga0207428_10132017 3300027907 Unclassified 1910
511 Ga0207428_10163289 3300027907 Bacteria 1690
512 Ga0207428_10259966 3300027907 Bacteria 1293
513 Ga0268266_10135853 3300028379 Unclassified 2203
514 Ga0268265_10002452 3300028380 Bacteria 13971
515 Ga0268265_10018137 3300028380 Bacteria 4873
516 Ga0268265_10042120 3300028380 Bacteria 3385
517 Ga0268265_10090310 3300028380 Unclassified 2446
518 Ga0268264_10047610 3300028381 Bacteria 3564
519 Ga0268264_10142171 3300028381 Bacteria 2141
520 Ga0307408_100001699 3300031548 Bacteria 16180
521 Ga0307408_100007234 3300031548 Bacteria 7342
522 Ga0316579_10007452 3300031691 Bacteria 4520
523 Ga0316576_10000930 3300031727 Bacteria 14931
524 Ga0316576_10003712 3300031727 Bacteria 9014
525 Ga0316576_10151575 3300031727 Bacteria 1747
526 Ga0316578_10002578 3300031728 Bacteria 8013
527 Ga0316578_10002703 3300031728 Bacteria 7885
528 Ga0316578_10042327 3300031728 Bacteria 2640
529 Ga0316578_10127745 3300031728 Bacteria 1529
530 Ga0316577_10002654 3300031733 Bacteria 8883
531 Ga0316577_10005564 3300031733 Bacteria 6612
532 Ga0316577_10010984 3300031733 Bacteria 4899
533 Ga0307410_10076489 3300031852 Bacteria 2337
534 Ga0307410_10193974 3300031852 Bacteria 1546
535 Ga0307406_10002463 3300031901 Bacteria 10081
536 Ga0307406_10260852 3300031901 Bacteria 1311
537 Ga0307406_10268349 3300031901 Bacteria 1295
538 Ga0307407_10040084 3300031903 Bacteria 2609
539 Ga0307412_10052111 3300031911 Unclassified 2708
540 Ga0307409_100094264 3300031995 Unclassified 2463
541 Ga0307409_100293740 3300031995 Bacteria 1508
542 Ga0307409_100330533 3300031995 Bacteria 1430
543 Ga0307409_100346887 3300031995 Bacteria 1399
544 Ga0307416_100141204 3300032002 Unclassified 2189
545 Ga0307416_100436311 3300032002 Bacteria 1358
546 Ga0307414_10066957 3300032004 Bacteria 2570
547 Ga0307411_10300909 3300032005 Bacteria 1286
548 Ga0316583_10000547 3300032133 Bacteria 11313
549 Ga0316585_10007427 3300032137 Bacteria 3159
550 Ga0316580_10012384 3300032139 Bacteria 2598
551 Ga0316580_10048678 3300032139 Bacteria 1306
552 Ga0373926_0009426 3300035083 Bacteria 3264
553 Ga0373934_0000434 3300035086 Bacteria 14604
554 Ga0373934_0003824 3300035086 Bacteria 5540
555 Ga0373944_0001640 3300035089 Bacteria 5660
556 Ga0373923_0020036 3300035111 Unclassified 2595
557 Ga0373945_0008077 3300035116 Bacteria 3418
558 Ga0373953_0002604 3300035117 Bacteria 5459
559 Ga0373953_0042324 3300035117 Unclassified 1815
560 Ga0373954_0019107 3300035118 Bacteria 3089
561 Ga0373956_0001595 3300035119 Bacteria 9353
562 Ga0373943_0119930 3300035170 Bacteria 1397
563 Ga0373955_0000254 3300035172 Bacteria 22169
564 Ga0373955_0063064 3300035172 Unclassified 2051
565 Ga0316574_0027584 3300035398 Bacteria 3421
566 Ga0316574_0094320 3300035398 Unclassified 1911
567 Ga0373924_0006339 3300035410 Bacteria 4235
568 Ga0373927_0010299 3300035695 Bacteria 6244
569 Ga0373927_0166223 3300035695 Bacteria 1446
570 Ga0373933_0001729 3300035724 Bacteria 12678
571 Ga0373933_0029776 3300035724 Unclassified 3158
572 Ga0373933_0077525 3300035724 Bacteria 2031
573 Ga0373947_0000186 3300035725 Bacteria 34199
574 Ga0373937_0000789 3300036401 Bacteria 27119
575 Ga0373937_0009359 3300036401 Bacteria 8511
576 Ga0373937_0014413 3300036401 Bacteria 6980
577 Ga0316582_0060265 3300036647 Bacteria 2432
578 Ga0316584_0005612 3300036712 Bacteria 8446
579 Ga0316584_0012245 3300036712 Bacteria 6046
580 Ga0316584_0020063 3300036712 Bacteria 4841
581 Ga0373925_0001878 3300037068 Bacteria 17447
582 Ga0395899_0018198 3300037312 Bacteria 5345
583 Ga0395900_0171718 3300037418 Bacteria 2206
584 Ga0395905_0007712 3300037471 Bacteria 10680
585 Ga0395905_0061474 3300037471 Bacteria 3514
586 Ga0395905_0118455 3300037471 Bacteria 2489
587 Ga0395901_0030678 3300038443 Bacteria 5539
588 Ga0395901_0034343 3300038443 Bacteria 5237
589 Ga0436365_0261644 3300039437 Bacteria 1995
590 Ga0436365_0280359 3300039437 Bacteria 2651
591 Ga0451577_0000001 3300042876 Bacteria 2461803
592 Ga0451576_0063557 3300045051 Bacteria 3848
593 Ga0451576_0109417 3300045051 Bacteria 2876
594 Ga0451576_0432331 3300045051 Bacteria 1381
595 Ga0466967_0176468 3300045976 Bacteria 2013
596 Ga0495592_0002911 3300046454 Bacteria 12182
597 Ga0495603_0001056 3300046455 Bacteria 15980
598 Ga0495629_0004582 3300046459 Bacteria 10340
599 Ga0495629_0010765 3300046459 Bacteria 6653
600 Ga0495629_0028523 3300046459 Bacteria 3963
601 Ga0495629_0049253 3300046459 Unclassified 2953
602 Ga0495629_0183876 3300046459 Bacteria 1448
603 Ga0495651_0008457 3300046462 Bacteria 7886
604 Ga0495653_0000121 3300046463 Bacteria 65169
605 Ga0495653_0090454 3300046463 Bacteria 2239
606 Ga0495580_0001133 3300046472 Bacteria 23486
607 Ga0495580_0040550 3300046472 Bacteria 3325
608 Ga0495582_0000761 3300046473 Bacteria 17820
609 Ga0495582_0086635 3300046473 Bacteria 1743
610 Ga0495639_0000085 3300046475 Bacteria 44710
611 Ga0495664_0024713 3300046477 Bacteria 3493
612 Ga0495594_0004061 3300046499 Bacteria 7525
613 Ga0495594_0049591 3300046499 Bacteria 2308
614 Ga0495608_0000119 3300046511 Bacteria 56470
615 Ga0495628_0001425 3300046516 Bacteria 21962
616 Ga0495628_0062624 3300046516 Bacteria 2915
617 Ga0495630_0000682 3300046517 Bacteria 24297
618 Ga0495630_0003427 3300046517 Bacteria 11039
619 Ga0495630_0077800 3300046517 Bacteria 2501
620 Ga0495630_0239366 3300046517 Bacteria 1387
621 Ga0495652_0002104 3300046529 Bacteria 20985
622 Ga0495652_0015164 3300046529 Bacteria 6901
623 Ga0495665_0000095 3300046531 Bacteria 40690
624 Ga0495665_0006585 3300046531 Bacteria 6274
625 Ga0495587_0002462 3300046536 Bacteria 12360
626 Ga0495587_0002771 3300046536 Bacteria 11698
627 Ga0495587_0003973 3300046536 Bacteria 9805
628 Ga0495645_0000260 3300046543 Bacteria 38847
629 Ga0495645_0003304 3300046543 Bacteria 10927
630 Ga0495645_0021609 3300046543 Bacteria 4650
631 Ga0495633_0089424 3300046558 Bacteria 1432
632 Ga0495667_0000610 3300046559 Bacteria 22843
633 Ga0495667_0003524 3300046559 Bacteria 10506
634 Ga0495667_0042351 3300046559 Unclassified 3019
635 Ga0495634_0124387 3300046642 Unclassified 1649
636 Ga0495635_0000039 3300046663 Bacteria 89884
637 Ga0495635_0143611 3300046663 Unclassified 1625
638 Ga0495635_0182789 3300046663 Bacteria 1425
639 Ga0495588_0001958 3300046674 Bacteria 8788
640 Ga0495588_0038100 3300046674 Bacteria 2445
641 Ga0495657_0000719 3300046675 Bacteria 29714
642 Ga0495599_0000210 3300046678 Bacteria 37773
643 Ga0495599_0047264 3300046678 Unclassified 2697
644 Ga0495623_0000064 3300046679 Bacteria 66746
645 Ga0495623_0038794 3300046679 Bacteria 3045
646 Ga0495646_0004847 3300046680 Bacteria 8499
647 Ga0495646_0062166 3300046680 Unclassified 2221
648 Ga0495658_0000214 3300046683 Bacteria 33133
649 Ga0495658_0098446 3300046683 Bacteria 1742
650 Ga0495658_0109072 3300046683 Bacteria 1662
651 Ga0495658_0131044 3300046683 Bacteria 1526
652 Ga0495613_0001921 3300046689 Bacteria 15770
653 Ga0495613_0024671 3300046689 Unclassified 4480
654 Ga0495613_0087516 3300046689 Bacteria 2258
655 Ga0495613_0212539 3300046689 Bacteria 1360
656 Ga0495600_0000298 3300046809 Bacteria 26505
657 Ga0495581_0001562 3300047315 Bacteria 12793
658 Ga0495581_0027289 3300047315 Bacteria 3311
659 Ga0495581_0079165 3300047315 Bacteria 1902
660 Ga0495581_0102312 3300047315 Bacteria 1665
661 Ga0495604_0000414 3300047317 Bacteria 38496
662 Ga0495674_0002069 3300047319 Bacteria 19680
663 Ga0495672_0005932 3300047320 Bacteria 9573
664 Ga0495672_0008923 3300047320 Bacteria 7321
665 Ga0495680_0014771 3300047322 Bacteria 6749
666 Ga0495675_0001435 3300047444 Bacteria 14433
667 Ga0495675_0001606 3300047444 Bacteria 13591
668 Ga0495675_0023019 3300047444 Bacteria 3971
669 Ga0495684_0000149 3300047471 Bacteria 51531
670 Ga0495684_0007650 3300047471 Bacteria 8361
671 Ga0495684_0071094 3300047471 Bacteria 2645
672 Ga0495684_0146979 3300047471 Bacteria 1765
673 Ga0495593_0003446 3300047673 Bacteria 9477
674 Ga0495593_0094820 3300047673 Bacteria 1535
675 Ga0495602_0014359 3300048088 Bacteria 8042
676 Ga0495602_0111508 3300048088 Bacteria 2221
677 Ga0495614_0000097 3300048089 Bacteria 29511
678 Ga0496106_0061103 3300048909 Bacteria 2858
679 Ga0496108_0247462 3300048911 Unclassified 1551
680 Ga0496109_0066719 3300048912 Unclassified 3296
681 Ga0496113_0012617 3300048916 Bacteria 5686
682 Ga0501299_023812 3300049522 Bacteria 1138
683 Ga0501031_0127404 3300049568 Bacteria 1663
684 Ga0501032_0074852 3300049569 Bacteria 2256
685 Ga0501033_0268943 3300049570 Bacteria 1205
686 Ga0501034_0034553 3300049571 Bacteria 5125
687 Ga0501034_0058130 3300049571 Bacteria 3887
688 Ga0501036_0112556 3300049572 Bacteria 2300
689 Ga0501037_0018494 3300049573 Bacteria 5137
690 Ga0501037_0038833 3300049573 Bacteria 3506
691 Ga0501038_0094124 3300049574 Bacteria 2505
692 Ga0501039_0094708 3300049575 Bacteria 2328
693 Ga0501040_0011492 3300049576 Bacteria 5796
694 Ga0501041_0051216 3300049577 Bacteria 2516
695 Ga0501042_0113533 3300049578 Bacteria 1951
696 Ga0501043_0078299 3300049579 Bacteria 2597
697 Ga0501043_0079022 3300049579 Bacteria 2585
698 Ga0501043_0131047 3300049579 Bacteria 1965
699 Ga0501043_0172035 3300049579 Unclassified 1690
700 Ga0501047_0003113 3300049581 Bacteria 15736
701 Ga0501047_0057528 3300049581 Bacteria 3759
702 Ga0501047_0131443 3300049581 Bacteria 2384
703 Ga0501070_0266130 3300049586 Bacteria 1401
704 Ga0501074_0098764 3300049590 Bacteria 2090
705 Ga0501075_0020594 3300049591 Bacteria 4800
706 Ga0501075_0252905 3300049591 Bacteria 1343
707 Ga0501076_0025835 3300049592 Bacteria 4547
708 Ga0501076_0240928 3300049592 Bacteria 1480
709 Ga0501233_023925 3300049668 Bacteria 1332
710 Ga0501079_0313579 3300049741 Bacteria 1227
711 Ga0501081_0026940 3300049743 Bacteria 3878
712 Ga0501035_0017125 3300049822 Bacteria 6677
713 Ga0501044_0009498 3300049823 Bacteria 10591
714 Ga0501044_0100306 3300049823 Bacteria 2914
715 Ga0501044_0202184 3300049823 Bacteria 1944
716 Ga0501045_0015775 3300049824 Bacteria 5359
717 nmdc:mga05p37_115394_c1 3300050507 Bacteria 3301
718 nmdc:mga05p37_294143_c1 3300050507 Bacteria 1932
719 nmdc:mga05p37_444379_c1 3300050507 Bacteria 1503
720 nmdc:mga05p37_58464_c2 3300050507 Bacteria 3801
721 nmdc:mga09592_153684_c1 3300050508 Bacteria 1986
722 nmdc:mga09592_196138_c1 3300050508 Bacteria 1748
723 nmdc:mga09592_8430_c1 3300050508 Bacteria 8380
724 nmdc:mga0qj67_109635_c1 3300050509 Bacteria 2228
725 nmdc:mga0qj67_153953_c1 3300050509 Bacteria 1865
726 nmdc:mga0qj67_17290_c1 3300050509 Bacteria 5482
727 nmdc:mga0qj67_24850_c1 3300050509 Bacteria 4623
728 nmdc:mga0qj67_31500_c1 3300050509 Bacteria 4131
729 nmdc:mga0qj67_33663_c1 3300050509 Bacteria 3999
730 nmdc:mga0qj67_37188_c1 3300050509 Bacteria 3812
731 nmdc:mga0qj67_45158_c1 3300050509 Bacteria 3476
732 nmdc:mga0qj67_8372_c1 3300050509 Bacteria 7668
733 nmdc:mga06r32_285745_c1 3300050510 Bacteria 1636
734 nmdc:mga06r32_42484_c1 3300050510 Bacteria 4322
735 nmdc:mga06r32_45181_c1 3300050510 Bacteria 4198
736 nmdc:mga06r32_48025_c1 3300050510 Bacteria 4079
737 nmdc:mga06r32_50814_c1 3300050510 Bacteria 3965
738 nmdc:mga06r32_545468_c1 3300050510 Bacteria 1134
739 nmdc:mga06r32_59027_c1 3300050510 Bacteria 3688
740 nmdc:mga06r32_595347_c1 3300050510 Bacteria 1077
741 nmdc:mga08y16_200275_c1 3300050511 Bacteria 2069
742 nmdc:mga08y16_25208_c1 3300050511 Bacteria 6270
743 nmdc:mga08y16_4197_c1 3300050511 Bacteria 15041
744 nmdc:mga08y16_61539_c1 3300050511 Bacteria 3920
745 nmdc:mga08y16_93302_c1 3300050511 Bacteria 3136
746 nmdc:mga0n895_29563_c1 3300050512 Bacteria 5228
747 nmdc:mga0n895_429391_c1 3300050512 Bacteria 1335
748 nmdc:mga0n895_5093_c1 3300050512 Bacteria 10915
749 nmdc:mga0n895_62622_c1 3300050512 Bacteria 3677
750 nmdc:mga0rr50_176892_c1 3300050513 Bacteria 1742
751 nmdc:mga0rr50_90723_c1 3300050513 Bacteria 2378
752 nmdc:mga08x19_69784_c1 3300050514 Bacteria 2289
753 nmdc:mga08x19_74995_c1 3300050514 Unclassified 2211
754 nmdc:mga0a205_234308_c1 3300050515 Bacteria 1718
755 nmdc:mga0a205_6344_c1 3300050515 Bacteria 10678
756 Ga0495601_0012074 3300053077 Bacteria 5178
757 Ga0495612_0001019 3300053078 Bacteria 11499
758 Ga0495612_0026189 3300053078 Bacteria 2344
759 Ga0495619_0001031 3300053085 Bacteria 18273
760 Ga0501082_0110526 3300060353 Bacteria 2379
761 Ga0207674_10198177
762 Ga0070658_10019530
763 Ga0070676_10056837
764 Ga0070676_10206283
765 Ga0070683_100000212
766 Ga0070683_100011145
767 Ga0070683_100056067
768 Ga0070683_100080376
769 Ga0070683_100088370
770 Ga0070683_100261708
771 Ga0070690_100004655
772 Ga0070690_100106051
773 Ga0070670_100002832
774 Ga0070670_100003527
775 Ga0070670_100007611
776 Ga0070670_100013334
777 Ga0070670_100019279
778 Ga0070670_100101159
779 Ga0070670_100250001
780 Ga0068869_100004474
781 Ga0068869_100018000
782 Ga0068869_100166599
783 Ga0070680_100002751
784 Ga0070680_100004200
785 Ga0070680_100006243
786 Ga0070680_100031477
787 Ga0070680_100158126
788 Ga0070682_100004935
789 Ga0068868_100029367
790 Ga0068868_100043932
791 Ga0068868_100238482
792 Ga0070660_100059044
793 Ga0070660_100090121
794 Ga0070689_100004026
795 Ga0070689_100142297
796 Ga0070691_10014872
797 Ga0070687_100012294
798 Ga0070687_100029824
799 Ga0070661_100001600
800 Ga0070661_100004241
801 Ga0070661_100007075
802 Ga0070661_100019436
803 Ga0070668_100005416
804 Ga0070668_100016456
805 Ga0070668_100109317
806 Ga0070668_100164778
807 Ga0070669_100001623
808 Ga0070669_100001987
809 Ga0070669_100068854
810 Ga0070669_100126886
811 Ga0070669_100177330
812 Ga0070675_100002385
813 Ga0070675_100010668
814 Ga0070675_100010999
815 Ga0070675_100036555
816 Ga0070675_100102477
817 Ga0070675_100205980
818 Ga0070675_100266074
819 Ga0070671_100050599
820 Ga0070674_100016979
821 Ga0070674_100187876
822 Ga0070674_100243587
823 Ga0070673_100048799
824 Ga0070673_100124545
825 Ga0070673_100283902
826 Ga0070688_100006914
827 Ga0070688_100065626
828 Ga0070688_100101873
829 Ga0070659_100000786
830 Ga0070659_100039275
831 Ga0070659_100078415
832 Ga0070659_100353428
833 Ga0070667_100011736
834 Ga0070667_100239161
835 Ga0070714_100005787
836 Ga0070714_100011211
837 Ga0070714_100024630
838 Ga0070714_100117211
839 Ga0070713_100000318
840 Ga0070713_100004113
841 Ga0070713_100046489
842 Ga0070710_10088708
843 Ga0070701_10101420
844 Ga0070711_100058634
845 Ga0070711_100212608
846 Ga0070700_100046251
847 Ga0070694_100021755
848 Ga0070694_100023634
849 Ga0070694_100198724
850 Ga0070694_100282881
851 Ga0070694_100309852
852 Ga0070708_100025007
853 Ga0070663_100011577
854 Ga0070662_100000688
855 Ga0070662_100012673
856 Ga0070662_100058063
857 Ga0070662_100061303
858 Ga0070662_100065528
859 Ga0070662_100220984
860 Ga0070681_10000203
861 Ga0070681_10002461
862 Ga0070681_10003935
863 Ga0070681_10007481
864 Ga0070681_10022183
865 Ga0070681_10036089
866 Ga0070681_10041972
867 Ga0068867_100007712
868 Ga0068867_100008713
869 Ga0070685_10166626
870 Ga0070706_100037714
871 Ga0070707_100176246
872 Ga0070698_100001461
873 Ga0070698_100036464
874 Ga0070698_100056272
875 Ga0070698_100060884
876 Ga0070698_100075248
877 Ga0070698_100084572
878 Ga0070698_100085618
879 Ga0070698_100105550
880 Ga0070698_100334731
881 Ga0070699_100066694
882 Ga0070699_100089349
883 Ga0070679_100000214
884 Ga0070679_100004341
885 Ga0070679_100007469
886 Ga0070679_100010139
887 Ga0070679_100011725
888 Ga0070679_100016410
889 Ga0070679_100046000
890 Ga0070679_100073334
891 Ga0070679_100151352
892 Ga0070679_100161707
893 Ga0070679_100305609
894 Ga0070684_100005184
895 Ga0070684_100009324
896 Ga0070684_100023573
897 Ga0070684_100082985
898 Ga0070684_100094737
899 Ga0070684_100131009
900 Ga0070684_100303638
901 Ga0070684_100343357
902 Ga0068853_100013999
903 Ga0068853_100470736
904 Ga0070672_100012962
905 Ga0070672_100025942
906 Ga0070672_100039410
907 Ga0070672_100067679
908 Ga0070693_100001777
909 Ga0070693_100010031
910 Ga0070665_100018336
911 Ga0068855_100032710
912 Ga0068855_100081425
913 Ga0068855_100292790
914 Ga0070664_100000800
915 Ga0070664_100001632
916 Ga0070664_100016349
917 Ga0070664_100016995
918 Ga0070664_100026134
919 Ga0070664_100047395
920 Ga0070664_100050049
921 Ga0070664_100106779
922 Ga0070664_100185420
923 Ga0068857_100011926
924 Ga0068857_100016373
925 Ga0068857_100019618
926 Ga0068854_100085831
927 Ga0068854_100104845
928 Ga0068856_100000688
929 Ga0068856_100263845
930 Ga0070702_100000930
931 Ga0068852_100008096
932 Ga0068852_100011875
933 Ga0068852_100016276
934 Ga0068852_100025598
935 Ga0068859_100006306
936 Ga0068859_100098960
937 Ga0068859_100104711
938 Ga0068859_100199725
939 Ga0068864_100003639
940 Ga0068864_100021610
941 Ga0068864_100073530
942 Ga0068864_100083677
943 Ga0068866_10033406
944 Ga0068861_100012009
945 Ga0068861_100022544
946 Ga0068861_100032095
947 Ga0068861_100034623
948 Ga0068851_10019460
949 Ga0068870_10003148
950 Ga0068870_10027339
951 Ga0068870_10042740
952 Ga0068863_100004426
953 Ga0068863_100007587
954 Ga0068863_100146570
955 Ga0068858_100009593
956 Ga0068860_100010330
957 Ga0068860_100072838
958 Ga0068860_100102193
959 Ga0068860_100344220
960 Ga0068860_100485674
961 Ga0068862_100000532
962 Ga0068862_100002120
963 Ga0068862_100023561
964 Ga0068862_100339234
965 Ga0070717_10003174
966 Ga0068871_100009622
967 Ga0068871_100247053
968 Ga0075428_100064075
969 Ga0075428_100102309
970 Ga0075428_100110725
971 Ga0075428_100190257
972 Ga0075430_100005952
973 Ga0075430_100010311
974 Ga0075430_100011844
975 Ga0075430_100033812
976 Ga0075430_100039391
977 Ga0075430_100109374
978 Ga0075430_100124745
979 Ga0075430_100208762
980 Ga0075430_100299104
981 Ga0075431_100045831
982 Ga0075431_100066766
983 Ga0075431_100125320
984 Ga0075431_100168949
985 Ga0075431_100244251
986 Ga0075431_100260273
987 Ga0075433_10098496
988 Ga0075433_10187243
989 Ga0075434_100020843
990 Ga0075434_100024845
991 Ga0075434_100030401
992 Ga0075434_100168155
993 Ga0075429_100049973
994 Ga0075429_100056200
995 Ga0075429_100083410
996 Ga0075429_100093780
997 Ga0075429_100320340
998 Ga0068865_100024985
999 Ga0068865_100222727
1000 Ga0075436_100009011
1001 Ga0097620_100006306
1002 Ga0097620_100098966
1003 Ga0097620_100104702
1004 Ga0097620_100199721
1005 Ga0075435_100077430
1006 Ga0075435_100110772
1007 Ga0075435_100187414
1008 Ga0105240_10250599
1009 Ga0111539_10025648
1010 Ga0111539_10065774
1011 Ga0111539_10074346
1012 Ga0111539_10166925
1013 Ga0111539_10375323
1014 Ga0111539_10424682
1015 Ga0105245_10020091
1016 Ga0105245_10326420
1017 Ga0105245_10573252
1018 Ga0114129_10058540
1019 Ga0114129_10118161
1020 Ga0114129_10192247
1021 Ga0114129_10475264
1022 Ga0105241_10006974
1023 Ga0105242_10111951
1024 Ga0105242_10149764
1025 Ga0105242_10169902
1026 Ga0105242_10211336
1027 Ga0105248_10005447
1028 Ga0105248_10010434
1029 Ga0105248_10153603
1030 Ga0105248_10205487
1031 Ga0105248_10352835
1032 Ga0105237_10038184
1033 Ga0105238_10027413
1034 Ga0105238_10049213
1035 Ga0105238_10245336
1036 Ga0105238_10316150
1037 Ga0105249_10000075
1038 Ga0105249_10000277
1039 Ga0105249_10019194
1040 Ga0105249_10088446
1041 Ga0105239_10063215
1042 Ga0105246_10002193
1043 Ga0157373_10012037
1044 Ga0157373_10013689
1045 Ga0157373_10037762
1046 Ga0157371_10006728
1047 Ga0157371_10029747
1048 Ga0157370_10000373
1049 Ga0157369_10031066
1050 Ga0157369_10044399
1051 Ga0157369_10138243
1052 Ga0157374_10051122
1053 Ga0157374_10066151
1054 Ga0157374_10109036
1055 Ga0157378_10012936
1056 Ga0157378_10095117
1057 Ga0163162_10032621
1058 Ga0163162_10057160
1059 Ga0163162_10287725
1060 Ga0157372_10003297
1061 Ga0157372_10006067
1062 Ga0157372_10009010
1063 Ga0157372_10012360
1064 Ga0157372_10024696
1065 Ga0157372_10033490
1066 Ga0157372_10064776
1067 Ga0157372_10079094
1068 Ga0157372_10132822
1069 Ga0157372_10199830
1070 Ga0157372_10213141
1071 Ga0157372_10276291
1072 Ga0157375_10013367
1073 Ga0157375_10049007
1074 Ga0157375_10059463
1075 Ga0157375_10140234
1076 Ga0157375_10159122
1077 Ga0163163_10004551
1078 Ga0163163_10019656
1079 Ga0163163_10096921
1080 Ga0157380_10007946
1081 Ga0157380_10022969
1082 Ga0157380_10035014
1083 Ga0157380_10483272
1084 Ga0182008_10087080
1085 Ga0157377_10001250
1086 Ga0157377_10024950
1087 Ga0157377_10117200
1088 Ga0157377_10125207
1089 Ga0157379_10109282
1090 Ga0157376_10007194
1091 Ga0157376_10302962
1092 Ga0182007_10057720
1093 Ga0163161_10009962
1094 Ga0163161_10048311
1095 Ga0163161_10132893
1096 Ga0206356_11376601
1097 Ga0206354_10720845
1098 Ga0206353_10209995
1099 Ga0207656_10007621
1100 Ga0207656_10016758
1101 Ga0207682_10033828
1102 Ga0207642_10034076
1103 Ga0207688_10002492
1104 Ga0207699_10054399
1105 Ga0207645_10000126
1106 Ga0207645_10000294
1107 Ga0207643_10008112
1108 Ga0207643_10010705
1109 Ga0207643_10014810
1110 Ga0207643_10098785
1111 Ga0207705_10016998
1112 Ga0207684_10030249
1113 Ga0207654_10013736
1114 Ga0207707_10010208
1115 Ga0207707_10013409
1116 Ga0207707_10014075
1117 Ga0207707_10017462
1118 Ga0207707_10024041
1119 Ga0207707_10025867
1120 Ga0207707_10051805
1121 Ga0207707_10056868
1122 Ga0207707_10301353
1123 Ga0207707_10405583
1124 Ga0207695_10011232
1125 Ga0207695_10029099
1126 Ga0207695_10043539
1127 Ga0207695_10063825
1128 Ga0207693_10251333
1129 Ga0207663_10193323
1130 Ga0207660_10005613
1131 Ga0207660_10015509
1132 Ga0207660_10021456
1133 Ga0207660_10189083
1134 Ga0207662_10000711
1135 Ga0207662_10002952
1136 Ga0207662_10008825
1137 Ga0207662_10067136
1138 Ga0207657_10016167
1139 Ga0207657_10037627
1140 Ga0207657_10148872
1141 Ga0207649_10003837
1142 Ga0207649_10013146
1143 Ga0207649_10048424
1144 Ga0207649_10106375
1145 Ga0207652_10012014
1146 Ga0207652_10015261
1147 Ga0207652_10041589
1148 Ga0207652_10052010
1149 Ga0207652_10085782
1150 Ga0207652_10112713
1151 Ga0207652_10130153
1152 Ga0207652_10144225
1153 Ga0207652_10277293
1154 Ga0207646_10168184
1155 Ga0207681_10001038
1156 Ga0207681_10002221
1157 Ga0207681_10042424
1158 Ga0207681_10098738
1159 Ga0207694_10015473
1160 Ga0207694_10099012
1161 Ga0207694_10345939
1162 Ga0207650_10019893
1163 Ga0207650_10030435
1164 Ga0207650_10155722
1165 Ga0207659_10003881
1166 Ga0207659_10029463
1167 Ga0207659_10072794
1168 Ga0207659_10079495
1169 Ga0207659_10102220
1170 Ga0207659_10245995
1171 Ga0207659_10318073
1172 Ga0207687_10021346
1173 Ga0207687_10209922
1174 Ga0207700_10001570
1175 Ga0207664_10010448
1176 Ga0207664_10050733
1177 Ga0207644_10056411
1178 Ga0207644_10099890
1179 Ga0207644_10178076
1180 Ga0207644_10200453
1181 Ga0207690_10004883
1182 Ga0207690_10006007
1183 Ga0207690_10072136
1184 Ga0207706_10000472
1185 Ga0207706_10003170
1186 Ga0207706_10006226
1187 Ga0207706_10020426
1188 Ga0207706_10035044
1189 Ga0207706_10117252
1190 Ga0207706_10143875
1191 Ga0207706_10190251
1192 Ga0207706_10289564
1193 Ga0207670_10093818
1194 Ga0207670_10137492
1195 Ga0207670_10290446
1196 Ga0207669_10083279
1197 Ga0207704_10139562
1198 Ga0207665_10156628
1199 Ga0207691_10000248
1200 Ga0207691_10002354
1201 Ga0207691_10006593
1202 Ga0207691_10040044
1203 Ga0207691_10071524
1204 Ga0207691_10078899
1205 Ga0207711_10015581
1206 Ga0207711_10173576
1207 Ga0207711_10256765
1208 Ga0207689_10008296
1209 Ga0207689_10012676
1210 Ga0207689_10051944
1211 Ga0207661_10000796
1212 Ga0207661_10004013
1213 Ga0207661_10012192
1214 Ga0207661_10050479
1215 Ga0207661_10074175
1216 Ga0207661_10121497
1217 Ga0207679_10000957
1218 Ga0207679_10002675
1219 Ga0207679_10002711
1220 Ga0207679_10009978
1221 Ga0207679_10055842
1222 Ga0207679_10102263
1223 Ga0207679_10152508
1224 Ga0207667_10078710
1225 Ga0207667_10125948
1226 Ga0207667_10151626
1227 Ga0207667_10312804
1228 Ga0207651_10225945
1229 Ga0207712_10001329
1230 Ga0207712_10006793
1231 Ga0207712_10018700
1232 Ga0207712_10093234
1233 Ga0207668_10001958
1234 Ga0207668_10013395
1235 Ga0207640_10008894
1236 Ga0207640_10112333
1237 Ga0207658_10165535
1238 Ga0207658_10305260
1239 Ga0207639_10024773
1240 Ga0207678_10029241
1241 Ga0207708_10008816
1242 Ga0207708_10013505
1243 Ga0207702_10022731
1244 Ga0207641_10016841
1245 Ga0207648_10007822
1246 Ga0207648_10032581
1247 Ga0207648_10078779
1248 Ga0207648_10081232
1249 Ga0207648_10100297
1250 Ga0207648_10228833
1251 Ga0207676_10003946
1252 Ga0207676_10150908
1253 Ga0207674_10000736
1254 Ga0207674_10001081
1255 Ga0207674_10002802
1256 Ga0207674_10008570
1257 Ga0207674_10013184
1258 Ga0207674_10025709
1259 Ga0207674_10043177
1260 Ga0207674_10156774
1261 Ga0207675_100000373
1262 Ga0207675_100000705
1263 Ga0207675_100015530
1264 Ga0207675_100055526
1265 Ga0207683_10058281
1266 Ga0207698_10022859
1267 Ga0207698_10300029
1268 Ga0207698_10401176
1269 Ga0207428_10108999
1270 Ga0207428_10132017
1271 Ga0207428_10163289
1272 Ga0207428_10259966
1273 Ga0268266_10135853
1274 Ga0268265_10002452
1275 Ga0268265_10018137
1276 Ga0268265_10042120
1277 Ga0268265_10090310
1278 Ga0268264_10047610
1279 Ga0268264_10142171
1280 Ga0307408_100001699
1281 Ga0307408_100007234
1282 Ga0316579_10007452
1283 Ga0316576_10000930
1284 Ga0316576_10003712
1285 Ga0316576_10151575
1286 Ga0316578_10002578
1287 Ga0316578_10002703
1288 Ga0316578_10042327
1289 Ga0316578_10127745
1290 Ga0316577_10002654
1291 Ga0316577_10005564
1292 Ga0316577_10010984
1293 Ga0307410_10076489
1294 Ga0307410_10193974
1295 Ga0307406_10002463
1296 Ga0307406_10260852
1297 Ga0307406_10268349
1298 Ga0307407_10040084
1299 Ga0307412_10052111
1300 Ga0307409_100094264
1301 Ga0307409_100293740
1302 Ga0307409_100330533
1303 Ga0307409_100346887
1304 Ga0307416_100141204
1305 Ga0307416_100436311
1306 Ga0307414_10066957
1307 Ga0307411_10300909
1308 Ga0316583_10000547
1309 Ga0316585_10007427
1310 Ga0316580_10012384
1311 Ga0316580_10048678
1312 Ga0373926_0009426
1313 Ga0373934_0000434
1314 Ga0373934_0003824
1315 Ga0373944_0001640
1316 Ga0373923_0020036
1317 Ga0373945_0008077
1318 Ga0373953_0002604
1319 Ga0373953_0042324
1320 Ga0373954_0019107
1321 Ga0373956_0001595
1322 Ga0373943_0119930
1323 Ga0373955_0000254
1324 Ga0373955_0063064
1325 Ga0316574_0027584
1326 Ga0316574_0094320
1327 Ga0373924_0006339
1328 Ga0373927_0010299
1329 Ga0373927_0166223
1330 Ga0373933_0001729
1331 Ga0373933_0029776
1332 Ga0373933_0077525
1333 Ga0373947_0000186
1334 Ga0373937_0000789
1335 Ga0373937_0009359
1336 Ga0373937_0014413
1337 Ga0316582_0060265
1338 Ga0316584_0005612
1339 Ga0316584_0012245
1340 Ga0316584_0020063
1341 Ga0373925_0001878
1342 Ga0395899_0018198
1343 Ga0395900_0171718
1344 Ga0395905_0007712
1345 Ga0395905_0061474
1346 Ga0395905_0118455
1347 Ga0395901_0030678
1348 Ga0395901_0034343
1349 Ga0436365_0261644
1350 Ga0436365_0280359
1351 Ga0451577_0000001
1352 Ga0451576_0063557
1353 Ga0451576_0109417
1354 Ga0451576_0432331
1355 Ga0466967_0176468
1356 Ga0495592_0002911
1357 Ga0495603_0001056
1358 Ga0495629_0004582
1359 Ga0495629_0010765
1360 Ga0495629_0028523
1361 Ga0495629_0049253
1362 Ga0495629_0183876
1363 Ga0495651_0008457
1364 Ga0495653_0000121
1365 Ga0495653_0090454
1366 Ga0495580_0001133
1367 Ga0495580_0040550
1368 Ga0495582_0000761
1369 Ga0495582_0086635
1370 Ga0495639_0000085
1371 Ga0495664_0024713
1372 Ga0495594_0004061
1373 Ga0495594_0049591
1374 Ga0495608_0000119
1375 Ga0495628_0001425
1376 Ga0495628_0062624
1377 Ga0495630_0000682
1378 Ga0495630_0003427
1379 Ga0495630_0077800
1380 Ga0495630_0239366
1381 Ga0495652_0002104
1382 Ga0495652_0015164
1383 Ga0495665_0000095
1384 Ga0495665_0006585
1385 Ga0495587_0002462
1386 Ga0495587_0002771
1387 Ga0495587_0003973
1388 Ga0495645_0000260
1389 Ga0495645_0003304
1390 Ga0495645_0021609
1391 Ga0495633_0089424
1392 Ga0495667_0000610
1393 Ga0495667_0003524
1394 Ga0495667_0042351
1395 Ga0495634_0124387
1396 Ga0495635_0000039
1397 Ga0495635_0143611
1398 Ga0495635_0182789
1399 Ga0495588_0001958
1400 Ga0495588_0038100
1401 Ga0495657_0000719
1402 Ga0495599_0000210
1403 Ga0495599_0047264
1404 Ga0495623_0000064
1405 Ga0495623_0038794
1406 Ga0495646_0004847
1407 Ga0495646_0062166
1408 Ga0495658_0000214
1409 Ga0495658_0098446
1410 Ga0495658_0109072
1411 Ga0495658_0131044
1412 Ga0495613_0001921
1413 Ga0495613_0024671
1414 Ga0495613_0087516
1415 Ga0495613_0212539
1416 Ga0495600_0000298
1417 Ga0495581_0001562
1418 Ga0495581_0027289
1419 Ga0495581_0079165
1420 Ga0495581_0102312
1421 Ga0495604_0000414
1422 Ga0495674_0002069
1423 Ga0495672_0005932
1424 Ga0495672_0008923
1425 Ga0495680_0014771
1426 Ga0495675_0001435
1427 Ga0495675_0001606
1428 Ga0495675_0023019
1429 Ga0495684_0000149
1430 Ga0495684_0007650
1431 Ga0495684_0071094
1432 Ga0495684_0146979
1433 Ga0495593_0003446
1434 Ga0495593_0094820
1435 Ga0495602_0014359
1436 Ga0495602_0111508
1437 Ga0495614_0000097
1438 Ga0496106_0061103
1439 Ga0496108_0247462
1440 Ga0496109_0066719
1441 Ga0496113_0012617
1442 Ga0501299_023812
1443 Ga0501031_0127404
1444 Ga0501032_0074852
1445 Ga0501033_0268943
1446 Ga0501034_0034553
1447 Ga0501034_0058130
1448 Ga0501036_0112556
1449 Ga0501037_0018494
1450 Ga0501037_0038833
1451 Ga0501038_0094124
1452 Ga0501039_0094708
1453 Ga0501040_0011492
1454 Ga0501041_0051216
1455 Ga0501042_0113533
1456 Ga0501043_0078299
1457 Ga0501043_0079022
1458 Ga0501043_0131047
1459 Ga0501043_0172035
1460 Ga0501047_0003113
1461 Ga0501047_0057528
1462 Ga0501047_0131443
1463 Ga0501070_0266130
1464 Ga0501074_0098764
1465 Ga0501075_0020594
1466 Ga0501075_0252905
1467 Ga0501076_0025835
1468 Ga0501076_0240928
1469 Ga0501233_023925
1470 Ga0501079_0313579
1471 Ga0501081_0026940
1472 Ga0501035_0017125
1473 Ga0501044_0009498
1474 Ga0501044_0100306
1475 Ga0501044_0202184
1476 Ga0501045_0015775
1477 nmdc:mga05p37_115394_c1
1478 nmdc:mga05p37_294143_c1
1479 nmdc:mga05p37_444379_c1
1480 nmdc:mga05p37_58464_c2
1481 nmdc:mga09592_153684_c1
1482 nmdc:mga09592_196138_c1
1483 nmdc:mga09592_8430_c1
1484 nmdc:mga0qj67_109635_c1
1485 nmdc:mga0qj67_153953_c1
1486 nmdc:mga0qj67_17290_c1
1487 nmdc:mga0qj67_24850_c1
1488 nmdc:mga0qj67_31500_c1
1489 nmdc:mga0qj67_33663_c1
1490 nmdc:mga0qj67_37188_c1
1491 nmdc:mga0qj67_45158_c1
1492 nmdc:mga0qj67_8372_c1
1493 nmdc:mga06r32_285745_c1
1494 nmdc:mga06r32_42484_c1
1495 nmdc:mga06r32_45181_c1
1496 nmdc:mga06r32_48025_c1
1497 nmdc:mga06r32_50814_c1
1498 nmdc:mga06r32_545468_c1
1499 nmdc:mga06r32_59027_c1
1500 nmdc:mga06r32_595347_c1
1501 nmdc:mga08y16_200275_c1
1502 nmdc:mga08y16_25208_c1
1503 nmdc:mga08y16_4197_c1
1504 nmdc:mga08y16_61539_c1
1505 nmdc:mga08y16_93302_c1
1506 nmdc:mga0n895_29563_c1
1507 nmdc:mga0n895_429391_c1
1508 nmdc:mga0n895_5093_c1
1509 nmdc:mga0n895_62622_c1
1510 nmdc:mga0rr50_176892_c1
1511 nmdc:mga0rr50_90723_c1
1512 nmdc:mga08x19_69784_c1
1513 nmdc:mga08x19_74995_c1
1514 nmdc:mga0a205_234308_c1
1515 nmdc:mga0a205_6344_c1
1516 Ga0495601_0012074
1517 Ga0495612_0001019
1518 Ga0495612_0026189
1519 Ga0495619_0001031
1520 Ga0501082_0110526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g2g-assembly2.cif.gz_B-3 crystal structure of prmt3 with compound yd1113 0.6616 138 175
6mop-assembly1.cif.gz_A crystal structure of the all-trans retinal-bound r111k:y134f:t54v:r132q:p39y:r59y:l121e mutant of human cellular retinoic acid binding protein ii in the dark at 1.9 angstrom resolution 0.6573 149 174
6nny-assembly1.cif.gz_A crystal structure of the all-trans retinal-bound r111k:y134f:t54v:r132q:p39e:r59y:l121e mutant of human cellular retinoic acid binding protein ii in the dark at 1.67 angstrom resolution 0.6572 149 174
6mqi-assembly1.cif.gz_A crystal structure of the all-trans retinal bound r111k:y134f:t54v:r132q:p39y:r59y:l121q mutant of human cellular retinoic acid binding protein ii irradiated with 400 nm laser for 5 minutes at 1.87 angstrom resolution 0.65 149 174
5xy3-assembly1.cif.gz_k large subunit of trichomonas vaginalis ribosome 0.6471 148 175
ID Description Score Start End Superfamily
af_Q4D0Z6_458_653_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7511 148 177 2.130.10.10
af_Q9TW27_156_240_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.694 148 174 3.30.160.20
af_Q4CSM7_65_352_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.6888 149 177 2.120.10.10
af_Q7KTZ2_316_422_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.6843 147 173 3.30.505.10
af_A0A0R0LFK6_355_940_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6805 146 175 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7X3XT55-F1-model_v4 Uncharacterized protein 0.8152 123 312
AF-A0A0S7ZP57-F1-model_v4 Uncharacterized protein 0.7639 154 311
AF-A0A7X4EYH7-F1-model_v4 Uncharacterized protein 0.7518 162 313
AF-A0A0S7ZP57-F1-model_v4 Uncharacterized protein 0.7206 154 311
AF-A0A7Y5NAC9-F1-model_v4 Uncharacterized protein 0.7172 128 313

Map