F479610

General Info

Members Datasets Scaffolds Average Seq Length
762 305 612 108

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10586022|Ga0065704_105860221
Length 120
Sequence VKSYGSNTRLVYSSDSGRVCPECARPVNSCVCRKKSGPTGGDGIVRIRRESKGRGGKTVTVIVGVPLNVEGIRALVGELKKRCGTGGTVKDGVIEIQGDHRDLLMSELAAKGYKVKAAGG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
9 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
10 2561511199 Enterobacter sp. R4-368 Isolate Nodule
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
14 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
15 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
16 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
17 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
18 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
19 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
20 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
21 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
22 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
23 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
24 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
25 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
26 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
27 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
28 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
29 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
30 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
31 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
32 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
33 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
34 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
35 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
36 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
37 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
38 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
39 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
40 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
41 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
42 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
43 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
44 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
45 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
46 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
47 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
48 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
49 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
50 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
51 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
52 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
53 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
54 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
55 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
56 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
57 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
58 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
59 2636415599 Klebsiella variicola DX120E Isolate Unclassified
60 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
61 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
62 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
63 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
64 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
65 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
66 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
67 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
68 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
69 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
70 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
71 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
72 2751185917 Enterobacter sp. HK169 Isolate Unclassified
73 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
74 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
75 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
76 2775507074 Klebsiella sp. D5A Isolate Unclassified
77 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
78 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
79 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
80 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
81 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
82 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
83 2821118458 Enterobacter asburiae 609 Isolate Unclassified
84 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
85 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
86 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
87 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
88 2847085930 Erwinia persicina B64 Isolate Bulb
89 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
90 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
91 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
92 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
93 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
94 2865014394 Pantoea sp. R-71966 Isolate Unclassified
95 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
96 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
97 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
98 2876601092 Pantoea endophytica 596 Isolate Unclassified
99 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
100 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
101 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
102 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
103 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
104 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
105 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
106 2904504865 Serratia marcescens 1822 Isolate Unclassified
107 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
108 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
109 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
110 2919150387 Rahnella aceris 1817 Isolate Unclassified
111 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
112 2927143783 Rahnella sp. 2050 Isolate Unclassified
113 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
114 2932406140 Serratia sp. 2723 Isolate Rhizosphere
115 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
116 2937539931 Pantoea sp. LS15 Isolate Unclassified
117 2937967321 Serratia sp. YC16 Isolate Unclassified
118 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
119 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
120 2939577877 Serratia sp. 509 Isolate Rhizosphere
121 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
122 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
123 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
124 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
125 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
126 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
127 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
128 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
129 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
130 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
131 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
132 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
133 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
134 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
135 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
136 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
137 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
138 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
139 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
140 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
141 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
142 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
143 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
144 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
145 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
148 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
149 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
154 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
155 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
156 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
157 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
158 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
159 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
165 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
166 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
167 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
168 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
176 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
177 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
178 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
181 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
191 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
212 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
287 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
291 640753048 Serratia proteamaculans 568 Isolate Endosphere
292 8004592986 Serratia sp. S119 Isolate Unclassified
293 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
294 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
295 8018221730 Enterobacter sp. CM29 Isolate Unclassified
296 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
297 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
298 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
299 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
300 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
301 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
302 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
303 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
304 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
305 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.31
Metatranscriptomes 0
Isolates 19.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0.13
Endosphere 4.46
Nodule 3.41
Rhizoplane 9.97
Rhizosphere 54.2
Stem 0
Stem Tuber 0.79
Unclassified 26.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1380939 2162886007 Bacteria 3855
2 SwRhRL2b_contig_570928 2162886007 Bacteria 2160
3 JGI24739J22299_10000362 3300001989 Bacteria 15565
4 JGI25162J39368_1000033 3300002737 Bacteria 194080
5 JGI25162J39368_1002511 3300002737 Bacteria 7022
6 JGI25163J39215_1000004 3300002771 Bacteria 136984
7 JGI25163J39215_1006699 3300002771 Bacteria 671
8 JGI25164J39214_1000017 3300002772 Bacteria 200566
9 JGI25152J39213_1000368 3300002773 Bacteria 27846
10 rootH2_10034177 3300003320 Bacteria 9480
11 Ga0055538_1000035 3300003751 Bacteria 194080
12 Ga0055539_1000046 3300003752 Bacteria 194080
13 Ga0055533_1000056 3300003756 Bacteria 194080
14 Ga0055525_1000067 3300003759 Bacteria 194080
15 Ga0055541_1000033 3300003841 Bacteria 194080
16 Ga0058692_1000084 3300003856 Bacteria 65638
17 Ga0058692_1000137 3300003856 Bacteria 46529
18 Ga0058692_1000195 3300003856 Bacteria 36739
19 Ga0058692_1000315 3300003856 Bacteria 24159
20 Ga0058692_1000507 3300003856 Bacteria 17209
21 Ga0058692_1001165 3300003856 Bacteria 10119
22 Ga0058692_1002057 3300003856 Bacteria 6931
23 Ga0058692_1004462 3300003856 Bacteria 4140
24 Ga0058692_1013233 3300003856 Bacteria 1927
25 Ga0058692_1020137 3300003856 Bacteria 1408
26 Ga0058692_1023493 3300003856 Bacteria 1252
27 Ga0058692_1028935 3300003856 Bacteria 1064
28 Ga0058692_1047434 3300003856 Bacteria 725
29 Ga0058692_1047459 3300003856 Bacteria 725
30 Ga0065703_1022688 3300005272 Bacteria 840
31 Ga0065704_10000015 3300005289 Bacteria 105766
32 Ga0065704_10000612 3300005289 Bacteria 18794
33 Ga0065704_10000781 3300005289 Bacteria 12445
34 Ga0065704_10001396 3300005289 Bacteria 9564
35 Ga0065704_10011231 3300005289 Bacteria 2357
36 Ga0065704_10070889 3300005289 Bacteria 14989
37 Ga0065704_10091395 3300005289 Bacteria 2680
38 Ga0065704_10586022 3300005289 Unclassified 615
39 Ga0065704_10691244 3300005289 Bacteria 565
40 Ga0070668_100071006 3300005347 Bacteria 2712
41 Ga0070665_100000600 3300005548 Bacteria 49830
42 Ga0070665_100399528 3300005548 Bacteria 1382
43 Ga0070665_101003917 3300005548 Bacteria 847
44 Ga0068857_100170289 3300005577 Bacteria 1979
45 Ga0075364_10000385 3300006051 Bacteria 21908
46 Ga0075364_10022833 3300006051 Bacteria 3957
47 Ga0075364_10094630 3300006051 Bacteria 1985
48 Ga0075366_10012395 3300006195 Bacteria 4836
49 Ga0079104_1000021 3300006946 Bacteria 247219
50 Ga0079104_1000030 3300006946 Bacteria 207526
51 Ga0079104_1000065 3300006946 Bacteria 158192
52 Ga0079104_1000462 3300006946 Bacteria 45858
53 Ga0079104_1000800 3300006946 Bacteria 26572
54 Ga0079104_1001605 3300006946 Bacteria 14741
55 Ga0079104_1001609 3300006946 Bacteria 14723
56 Ga0079104_1001617 3300006946 Bacteria 14682
57 Ga0079104_1001853 3300006946 Bacteria 12856
58 Ga0079104_1002430 3300006946 Bacteria 10058
59 Ga0079104_1009841 3300006946 Bacteria 3204
60 Ga0079104_1011303 3300006946 Bacteria 2878
61 Ga0105251_10000251 3300009011 Bacteria 53888
62 Ga0105251_10000863 3300009011 Bacteria 27156
63 Ga0105251_10001028 3300009011 Bacteria 24490
64 Ga0105251_10002099 3300009011 Bacteria 16056
65 Ga0105251_10002470 3300009011 Bacteria 14510
66 Ga0105251_10002478 3300009011 Bacteria 14460
67 Ga0105251_10002724 3300009011 Bacteria 13542
68 Ga0105251_10011069 3300009011 Bacteria 5175
69 Ga0105251_10017940 3300009011 Bacteria 3779
70 Ga0105251_10119033 3300009011 Bacteria 1200
71 Ga0105251_10133140 3300009011 Bacteria 1126
72 Ga0105251_10137453 3300009011 Bacteria 1106
73 Ga0105251_10160839 3300009011 Bacteria 1012
74 Ga0105251_10306060 3300009011 Bacteria 721
75 Ga0105251_10475966 3300009011 Bacteria 581
76 Ga0105251_10508837 3300009011 Bacteria 563
77 Ga0105251_10623714 3300009011 Bacteria 513
78 Ga0105244_10000015 3300009036 Bacteria 256814
79 Ga0105244_10000028 3300009036 Bacteria 201928
80 Ga0105244_10000070 3300009036 Bacteria 119389
81 Ga0105244_10000173 3300009036 Bacteria 65370
82 Ga0105244_10000321 3300009036 Bacteria 45946
83 Ga0105244_10001933 3300009036 Bacteria 16097
84 Ga0105244_10004691 3300009036 Bacteria 9313
85 Ga0105244_10006078 3300009036 Bacteria 7896
86 Ga0105244_10058682 3300009036 Bacteria 1941
87 Ga0105244_10060520 3300009036 Bacteria 1907
88 Ga0105244_10062069 3300009036 Bacteria 1879
89 Ga0105244_10112842 3300009036 Bacteria 1321
90 Ga0105244_10125569 3300009036 Bacteria 1240
91 Ga0105244_10125686 3300009036 Bacteria 1240
92 Ga0105244_10143735 3300009036 Bacteria 1146
93 Ga0105244_10229432 3300009036 Bacteria 869
94 Ga0105244_10259131 3300009036 Bacteria 810
95 Ga0105244_10270200 3300009036 Bacteria 790
96 Ga0105244_10312534 3300009036 Bacteria 726
97 Ga0105250_10000001 3300009092 Bacteria 617357
98 Ga0105250_10000060 3300009092 Bacteria 106781
99 Ga0105250_10000070 3300009092 Bacteria 96227
100 Ga0105250_10000455 3300009092 Bacteria 29419
101 Ga0105250_10001103 3300009092 Bacteria 15227
102 Ga0105250_10002351 3300009092 Bacteria 9555
103 Ga0105250_10002354 3300009092 Bacteria 9547
104 Ga0105250_10005578 3300009092 Bacteria 5629
105 Ga0105250_10015630 3300009092 Bacteria 3107
106 Ga0105250_10031851 3300009092 Bacteria 2117
107 Ga0105250_10035373 3300009092 Bacteria 2004
108 Ga0105250_10160079 3300009092 Bacteria 940
109 Ga0105250_10209218 3300009092 Bacteria 824
110 Ga0105250_10242512 3300009092 Bacteria 769
111 Ga0105247_10000012 3300009101 Bacteria 292188
112 Ga0105243_10247975 3300009148 Bacteria 1588
113 Ga0105241_10000002 3300009174 Bacteria 869480
114 Ga0105239_11280796 3300010375 Bacteria 845
115 Ga0105246_10088591 3300011119 Bacteria 2224
116 Ga0105246_10649781 3300011119 Bacteria 918
117 Ga0157373_10000504 3300013100 Bacteria 30735
118 Ga0157373_10000664 3300013100 Bacteria 26867
119 Ga0157373_10003718 3300013100 Bacteria 11545
120 Ga0157373_10362482 3300013100 Bacteria 1035
121 Ga0157371_10000061 3300013102 Bacteria 170142
122 Ga0157371_10000424 3300013102 Bacteria 51829
123 Ga0157371_10001362 3300013102 Bacteria 25641
124 Ga0157371_10002445 3300013102 Bacteria 17704
125 Ga0157371_10014596 3300013102 Bacteria 5922
126 Ga0157371_10077588 3300013102 Bacteria 2352
127 Ga0157371_10083322 3300013102 Bacteria 2264
128 Ga0157370_10000254 3300013104 Bacteria 67990
129 Ga0157370_10001904 3300013104 Bacteria 25698
130 Ga0157370_10006276 3300013104 Bacteria 13151
131 Ga0157369_10021355 3300013105 Bacteria 7241
132 Ga0157369_10023314 3300013105 Bacteria 6894
133 Ga0157369_10572805 3300013105 Bacteria 1166
134 Ga0163162_10061488 3300013306 Bacteria 3793
135 Ga0163162_11548978 3300013306 Bacteria 755
136 Ga0157372_10001114 3300013307 Bacteria 29198
137 Ga0157372_10019270 3300013307 Bacteria 7347
138 Ga0157372_10055145 3300013307 Bacteria 4437
139 Ga0157372_10055712 3300013307 Bacteria 4416
140 Ga0157372_10319343 3300013307 Bacteria 1808
141 Ga0157372_10564785 3300013307 Bacteria 1326
142 Ga0157372_11517516 3300013307 Bacteria 772
143 Ga0157375_11633956 3300013308 Bacteria 762
144 Ga0182008_10017622 3300014497 Bacteria 3704
145 Ga0182008_10063183 3300014497 Bacteria 1824
146 Ga0182006_1000051 3300015261 Bacteria 183089
147 Ga0182006_1010456 3300015261 Bacteria 4126
148 Ga0182006_1042313 3300015261 Bacteria 1785
149 Ga0182007_10025120 3300015262 Bacteria 2078
150 Ga0183366_1001 3300015679 Bacteria 2743932
151 Ga0183370_1001 3300015680 Bacteria 2743932
152 Ga0183369_1001 3300015685 Bacteria 2743932
153 Ga0183368_1001 3300015687 Bacteria 2743932
154 Ga0163161_10000001 3300017792 Bacteria 2041488
155 Ga0163161_10135677 3300017792 Bacteria 1860
156 Ga0163161_10159263 3300017792 Bacteria 1721
157 Ga0213876_10000069 3300021384 Bacteria 125594
158 Ga0209760_100260 3300025207 Bacteria 20270
159 Ga0209760_110207 3300025207 Bacteria 617
160 Ga0209784_100001 3300025224 Bacteria 3600592
161 Ga0209566_100001 3300025225 Bacteria 3600765
162 Ga0209674_100002 3300025226 Bacteria 3600592
163 Ga0209563_100002 3300025230 Bacteria 2045675
164 Ga0207427_100032 3300025231 Bacteria 349939
165 Ga0209437_100001 3300025233 Bacteria 2045675
166 Ga0209437_100073 3300025233 Bacteria 302948
167 Ga0207425_1006998 3300025245 Bacteria 3029
168 Ga0209677_100002 3300025253 Bacteria 2045675
169 Ga0209129_1000004 3300025258 Bacteria 884499
170 Ga0207696_1000001 3300025711 Bacteria 2579611
171 Ga0207696_1000028 3300025711 Bacteria 400424
172 Ga0207696_1000038 3300025711 Bacteria 328221
173 Ga0207696_1000190 3300025711 Bacteria 95127
174 Ga0207696_1000280 3300025711 Bacteria 60106
175 Ga0207696_1000350 3300025711 Bacteria 47297
176 Ga0207696_1000579 3300025711 Bacteria 28553
177 Ga0207696_1001236 3300025711 Bacteria 14452
178 Ga0207696_1005020 3300025711 Bacteria 5573
179 Ga0207696_1005298 3300025711 Bacteria 5369
180 Ga0207696_1047476 3300025711 Bacteria 1237
181 Ga0207696_1207519 3300025711 Bacteria 513
182 Ga0207655_1000001 3300025728 Bacteria 1866413
183 Ga0207655_1000002 3300025728 Bacteria 1148694
184 Ga0207655_1000061 3300025728 Bacteria 258893
185 Ga0207655_1000091 3300025728 Bacteria 203263
186 Ga0207655_1000110 3300025728 Bacteria 171137
187 Ga0207655_1000168 3300025728 Bacteria 119343
188 Ga0207655_1000343 3300025728 Bacteria 67627
189 Ga0207655_1002296 3300025728 Bacteria 15724
190 Ga0207655_1014946 3300025728 Bacteria 4347
191 Ga0207655_1015693 3300025728 Bacteria 4194
192 Ga0207655_1029534 3300025728 Bacteria 2564
193 Ga0207655_1035654 3300025728 Bacteria 2218
194 Ga0207655_1044564 3300025728 Bacteria 1862
195 Ga0207655_1139384 3300025728 Bacteria 780
196 Ga0207655_1208490 3300025728 Bacteria 578
197 Ga0207713_1000001 3300025735 Bacteria 2295391
198 Ga0207713_1000002 3300025735 Bacteria 1061749
199 Ga0207713_1000004 3300025735 Bacteria 702781
200 Ga0207713_1000008 3300025735 Bacteria 553952
201 Ga0207713_1000035 3300025735 Bacteria 263228
202 Ga0207713_1000039 3300025735 Bacteria 247140
203 Ga0207713_1005909 3300025735 Bacteria 7556
204 Ga0207713_1007390 3300025735 Bacteria 6491
205 Ga0207713_1015602 3300025735 Bacteria 3891
206 Ga0207713_1015874 3300025735 Bacteria 3847
207 Ga0207713_1016730 3300025735 Bacteria 3711
208 Ga0207713_1025399 3300025735 Bacteria 2737
209 Ga0207713_1039373 3300025735 Bacteria 1994
210 Ga0207713_1158221 3300025735 Bacteria 725
211 Ga0207713_1206429 3300025735 Bacteria 600
212 Ga0207710_10000354 3300025900 Bacteria 32964
213 Ga0207654_10000005 3300025911 Bacteria 869492
214 Ga0207671_10537097 3300025914 Bacteria 932
215 Ga0207668_10011064 3300025972 Bacteria 5471
216 Ga0207674_10281928 3300026116 Bacteria 1610
217 Ga0209281_1000001 3300027111 Bacteria 1933496
218 Ga0209281_1000003 3300027111 Bacteria 1260089
219 Ga0209281_1000004 3300027111 Bacteria 1253949
220 Ga0209281_1000006 3300027111 Bacteria 1170244
221 Ga0209281_1000012 3300027111 Bacteria 684886
222 Ga0209281_1000024 3300027111 Bacteria 499062
223 Ga0209281_1000050 3300027111 Bacteria 320102
224 Ga0209281_1000284 3300027111 Bacteria 95457
225 Ga0209281_1000616 3300027111 Bacteria 40110
226 Ga0209281_1001245 3300027111 Bacteria 16705
227 Ga0209281_1004256 3300027111 Bacteria 4347
228 Ga0209281_1004368 3300027111 Bacteria 4252
229 Ga0209281_1056386 3300027111 Bacteria 611
230 Ga0209371_1000001 3300027312 Bacteria 2771503
231 Ga0209371_1000002 3300027312 Bacteria 1551985
232 Ga0209371_1000005 3300027312 Bacteria 1061740
233 Ga0209371_1000039 3300027312 Bacteria 350081
234 Ga0209371_1000060 3300027312 Bacteria 235042
235 Ga0209371_1000110 3300027312 Bacteria 141059
236 Ga0209371_1000157 3300027312 Bacteria 106573
237 Ga0209371_1000391 3300027312 Bacteria 46092
238 Ga0209371_1000885 3300027312 Bacteria 23903
239 Ga0209371_1001545 3300027312 Bacteria 15215
240 Ga0209371_1002551 3300027312 Bacteria 10067
241 Ga0209371_1004389 3300027312 Bacteria 6179
242 Ga0209371_1008451 3300027312 Bacteria 3422
243 Ga0209371_1009310 3300027312 Bacteria 3134
244 Ga0209371_1014938 3300027312 Bacteria 2108
245 Ga0209371_1030918 3300027312 Bacteria 1168
246 Ga0209371_1042276 3300027312 Bacteria 918
247 Ga0268266_10003906 3300028379 Bacteria 14491
248 Ga0268256_1000001 3300030500 Bacteria 2771065
249 Ga0268256_1000002 3300030500 Bacteria 1535763
250 Ga0268256_1000006 3300030500 Bacteria 1063991
251 Ga0268256_1000033 3300030500 Bacteria 420973
252 Ga0268256_1000084 3300030500 Bacteria 164658
253 Ga0268256_1000334 3300030500 Bacteria 46092
254 Ga0268256_1000742 3300030500 Bacteria 23973
255 Ga0268256_1000814 3300030500 Bacteria 22350
256 Ga0268256_1001321 3300030500 Bacteria 15199
257 Ga0268256_1002417 3300030500 Bacteria 9546
258 Ga0268256_1004131 3300030500 Bacteria 6179
259 Ga0268256_1006215 3300030500 Bacteria 4488
260 Ga0268256_1007532 3300030500 Bacteria 3860
261 Ga0268256_1007659 3300030500 Bacteria 3815
262 Ga0268256_1009192 3300030500 Bacteria 3314
263 Ga0268256_1009843 3300030500 Bacteria 3134
264 Ga0268256_1019256 3300030500 Bacteria 1873
265 Ga0268256_1035082 3300030500 Bacteria 1169
266 Ga0268256_1041710 3300030500 Bacteria 1023
267 Ga0268256_1059107 3300030500 Bacteria 775
268 Ga0316183_1087108 3300030742 Bacteria 1078
269 Ga0436365_0368505 3300039437 Bacteria 454216
270 Ga0439438_000001 3300041405 Bacteria 1263568
271 Ga0439438_005486 3300041405 Bacteria 4653
272 Ga0439438_022500 3300041405 Bacteria 1747
273 Ga0439438_050303 3300041405 Bacteria 1061
274 Ga0439447_001353 3300041407 Bacteria 8935
275 Ga0439447_013432 3300041407 Bacteria 2322
276 Ga0439447_013939 3300041407 Bacteria 2268
277 Ga0439466_0000062 3300041411 Bacteria 43236
278 Ga0451853_0766941 3300041512 Bacteria 1492
279 Ga0439432_007783 3300042006 Bacteria 3779
280 Ga0439432_014189 3300042006 Bacteria 2698
281 Ga0439432_015408 3300042006 Bacteria 2580
282 Ga0439432_019714 3300042006 Bacteria 2245
283 Ga0439432_030994 3300042006 Bacteria 1731
284 Ga0439432_039349 3300042006 Bacteria 1503
285 Ga0439452_000001 3300042010 Bacteria 1725439
286 Ga0439452_000002 3300042010 Bacteria 1377577
287 Ga0439452_000016 3300042010 Bacteria 338131
288 Ga0439452_000589 3300042010 Bacteria 18786
289 Ga0439452_000630 3300042010 Bacteria 17774
290 Ga0439452_006391 3300042010 Bacteria 3692
291 Ga0439452_013286 3300042010 Bacteria 2316
292 Ga0439456_035385 3300042013 Bacteria 1076
293 Ga0439463_043421 3300042016 Bacteria 1144
294 Ga0450907_002353 3300042146 Bacteria 3648
295 Ga0439464_0002716 3300042439 Bacteria 4387
296 Ga0466981_0000007 3300044669 Bacteria 155983
297 Ga0453683_0000001 3300044673 Bacteria 1384965
298 Ga0453684_0011096 3300044712 Bacteria 15204
299 Ga0451576_0003834 3300045051 Bacteria 20207
300 Ga0495617_060513 3300046452 Bacteria 1253
301 Ga0495627_000122 3300046453 Bacteria 95389
302 Ga0495590_0000008 3300046457 Bacteria 330520
303 Ga0495591_000003 3300046458 Bacteria 449825
304 Ga0495591_000007 3300046458 Bacteria 366385
305 Ga0495591_012950 3300046458 Bacteria 3077
306 Ga0495591_126322 3300046458 Bacteria 622
307 Ga0495638_0003353 3300046460 Bacteria 12637
308 Ga0495638_0301172 3300046460 Bacteria 864
309 Ga0495650_0000005 3300046471 Bacteria 766553
310 Ga0495650_0000026 3300046471 Bacteria 476029
311 Ga0495650_0000126 3300046471 Bacteria 178143
312 Ga0495650_0014597 3300046471 Bacteria 4073
313 Ga0495650_0116124 3300046471 Bacteria 989
314 Ga0495605_0092322 3300046474 Bacteria 1401
315 Ga0495584_0014708 3300046491 Bacteria 3987
316 Ga0495584_0027500 3300046491 Bacteria 2882
317 Ga0495585_0025859 3300046492 Bacteria 3357
318 Ga0495585_0031708 3300046492 Bacteria 2999
319 Ga0495596_0003847 3300046500 Bacteria 7459
320 Ga0495596_0016665 3300046500 Bacteria 3050
321 Ga0495596_0031875 3300046500 Bacteria 2103
322 Ga0495596_0054386 3300046500 Bacteria 1565
323 Ga0495607_0010776 3300046501 Bacteria 6121
324 Ga0495583_0008098 3300046506 Bacteria 6477
325 Ga0495606_0027136 3300046507 Bacteria 4066
326 Ga0495606_0032303 3300046507 Bacteria 3628
327 Ga0495616_0027598 3300046513 Bacteria 3011
328 Ga0495616_0066086 3300046513 Bacteria 1760
329 Ga0495620_0042291 3300046515 Bacteria 1991
330 Ga0495631_0168177 3300046518 Bacteria 940
331 Ga0495631_0270902 3300046518 Bacteria 723
332 Ga0495632_0128013 3300046519 Bacteria 1183
333 Ga0495637_0049872 3300046520 Bacteria 1757
334 Ga0495643_0013954 3300046522 Bacteria 4789
335 Ga0495643_0037932 3300046522 Bacteria 2641
336 Ga0495643_0145935 3300046522 Bacteria 1176
337 Ga0495644_0005501 3300046523 Bacteria 4944
338 Ga0495644_0088424 3300046523 Bacteria 1168
339 Ga0495644_0090391 3300046523 Bacteria 1155
340 Ga0495644_0270359 3300046523 Bacteria 662
341 Ga0495648_0001135 3300046524 Bacteria 26942
342 Ga0495648_0003409 3300046524 Bacteria 13969
343 Ga0495648_0104201 3300046524 Bacteria 1558
344 Ga0495648_0465632 3300046524 Bacteria 549
345 Ga0495642_0316996 3300046528 Bacteria 684
346 Ga0495654_0000007 3300046530 Bacteria 403529
347 Ga0495654_0000029 3300046530 Bacteria 217918
348 Ga0495654_0001327 3300046530 Bacteria 17270
349 Ga0495654_0051231 3300046530 Bacteria 2015
350 Ga0495654_0062308 3300046530 Bacteria 1788
351 Ga0495654_0178933 3300046530 Bacteria 919
352 Ga0495654_0192110 3300046530 Bacteria 879
353 Ga0495654_0252313 3300046530 Bacteria 734
354 Ga0495609_0026013 3300046538 Bacteria 2679
355 Ga0495609_0119899 3300046538 Bacteria 1131
356 Ga0495597_0000391 3300046542 Bacteria 38068
357 Ga0495597_0000468 3300046542 Bacteria 34275
358 Ga0495668_0032436 3300046616 Bacteria 2939
359 Ga0495611_0032937 3300046648 Bacteria 2285
360 Ga0495611_0217285 3300046648 Bacteria 890
361 Ga0495625_0002066 3300046660 Bacteria 22506
362 Ga0495625_0397051 3300046660 Bacteria 862
363 Ga0495661_0019251 3300046665 Bacteria 4477
364 Ga0495661_0220610 3300046665 Bacteria 982
365 Ga0495661_0224880 3300046665 Bacteria 970
366 Ga0495588_0006516 3300046674 Bacteria 5264
367 Ga0495669_0025380 3300046684 Bacteria 2584
368 Ga0495670_0017478 3300046691 Bacteria 3529
369 Ga0495670_0025633 3300046691 Bacteria 2917
370 Ga0495671_0005918 3300046692 Bacteria 7110
371 Ga0495671_0645592 3300046692 Bacteria 503
372 Ga0495649_0001109 3300046694 Bacteria 20977
373 Ga0495649_0005810 3300046694 Bacteria 7770
374 Ga0495649_0006838 3300046694 Bacteria 7060
375 Ga0495649_0134134 3300046694 Bacteria 1306
376 Ga0495589_0000001 3300046794 Bacteria 888100
377 Ga0495589_0023205 3300046794 Bacteria 3162
378 Ga0495589_0038813 3300046794 Bacteria 2382
379 Ga0495589_0175052 3300046794 Bacteria 1019
380 Ga0495589_0255223 3300046794 Bacteria 818
381 Ga0495660_0000014 3300046810 Bacteria 337328
382 Ga0495660_0000016 3300046810 Bacteria 321859
383 Ga0495660_0057422 3300046810 Bacteria 2099
384 Ga0495660_0092683 3300046810 Bacteria 1567
385 Ga0495660_0169599 3300046810 Bacteria 1064
386 Ga0495660_0254419 3300046810 Bacteria 813
387 Ga0495672_0000001 3300047320 Bacteria 1458820
388 Ga0495672_0000015 3300047320 Bacteria 502855
389 Ga0495672_0000034 3300047320 Bacteria 290832
390 Ga0495672_0087642 3300047320 Bacteria 1718
391 Ga0495676_0474538 3300047321 Bacteria 823
392 Ga0495683_0037674 3300047323 Bacteria 2450
393 Ga0495683_0056245 3300047323 Bacteria 1957
394 Ga0495683_0110249 3300047323 Bacteria 1314
395 Ga0495683_0130547 3300047323 Bacteria 1185
396 Ga0495675_0845870 3300047444 Bacteria 504
397 Ga0495679_000005 3300047446 Bacteria 455007
398 Ga0495679_004954 3300047446 Bacteria 6005
399 Ga0495679_007848 3300047446 Bacteria 4399
400 Ga0495679_019632 3300047446 Bacteria 2370
401 Ga0495679_038019 3300047446 Bacteria 1510
402 Ga0495679_039852 3300047446 Bacteria 1463
403 Ga0495679_042103 3300047446 Bacteria 1410
404 Ga0495679_045950 3300047446 Bacteria 1331
405 Ga0495679_172312 3300047446 Bacteria 575
406 Ga0495673_0000007 3300047469 Bacteria 796722
407 Ga0495673_0000669 3300047469 Bacteria 33746
408 Ga0495681_0015510 3300047470 Bacteria 4306
409 Ga0495681_0157616 3300047470 Bacteria 947
410 Ga0495686_0000391 3300047472 Bacteria 69897
411 Ga0495615_0239832 3300048090 Bacteria 571
412 Ga0495626_0002901 3300048091 Bacteria 11419
413 Ga0495626_0056569 3300048091 Bacteria 1795
414 Ga0496100_0007867 3300048903 Bacteria 5918
415 Ga0496100_0079033 3300048903 Bacteria 2215
416 Ga0496100_0119495 3300048903 Bacteria 1842
417 Ga0496100_0624319 3300048903 Bacteria 838
418 Ga0496100_0759924 3300048903 Bacteria 758
419 Ga0496101_0000058 3300048904 Bacteria 131047
420 Ga0496101_0047858 3300048904 Bacteria 3071
421 Ga0496102_0004241 3300048905 Bacteria 12122
422 Ga0496102_0070821 3300048905 Bacteria 3202
423 Ga0496102_0301560 3300048905 Bacteria 1510
424 Ga0496103_0109077 3300048906 Bacteria 1757
425 Ga0496104_0000472 3300048907 Bacteria 34674
426 Ga0496104_0000944 3300048907 Bacteria 24982
427 Ga0496104_0110030 3300048907 Bacteria 2640
428 Ga0496104_0511132 3300048907 Bacteria 1112
429 Ga0496105_0012224 3300048908 Bacteria 6796
430 Ga0496105_0023520 3300048908 Bacteria 4998
431 Ga0496105_0068515 3300048908 Bacteria 2932
432 Ga0496105_0477494 3300048908 Bacteria 981
433 Ga0496106_0083326 3300048909 Bacteria 2459
434 Ga0496110_0554771 3300048913 Bacteria 1044
435 Ga0496116_0000001 3300048919 Bacteria 1501681
436 Ga0496116_0000048 3300048919 Bacteria 314562
437 Ga0496116_0000086 3300048919 Bacteria 217597
438 Ga0496116_0000087 3300048919 Bacteria 217284
439 Ga0496116_0001038 3300048919 Bacteria 33951
440 Ga0496116_0011046 3300048919 Bacteria 7510
441 Ga0496116_0022946 3300048919 Bacteria 4658
442 Ga0496116_0066577 3300048919 Bacteria 2304
443 Ga0496116_0102283 3300048919 Bacteria 1708
444 Ga0496116_0259008 3300048919 Bacteria 859
445 Ga0496116_0300349 3300048919 Bacteria 764
446 Ga0496116_0419001 3300048919 Bacteria 585
447 Ga0496117_0000022 3300048920 Bacteria 439512
448 Ga0496117_0000058 3300048920 Bacteria 264132
449 Ga0496117_0000402 3300048920 Bacteria 73339
450 Ga0496117_0000421 3300048920 Bacteria 71461
451 Ga0496117_0000920 3300048920 Bacteria 45030
452 Ga0496117_0002199 3300048920 Bacteria 25311
453 Ga0496117_0004197 3300048920 Bacteria 16093
454 Ga0496117_0004340 3300048920 Bacteria 15746
455 Ga0496117_0017266 3300048920 Bacteria 6035
456 Ga0496117_0025983 3300048920 Bacteria 4591
457 Ga0496117_0033948 3300048920 Bacteria 3852
458 Ga0496117_0054458 3300048920 Bacteria 2803
459 Ga0496117_0131793 3300048920 Bacteria 1513
460 Ga0496117_0271450 3300048920 Bacteria 913
461 Ga0496117_0275596 3300048920 Bacteria 903
462 Ga0496117_0338434 3300048920 Bacteria 781
463 Ga0496117_0338435 3300048920 Bacteria 781
464 Ga0496118_0000007 3300048921 Bacteria 650986
465 Ga0496118_0000181 3300048921 Bacteria 111019
466 Ga0496118_0000328 3300048921 Bacteria 81811
467 Ga0496118_0000527 3300048921 Bacteria 62722
468 Ga0496118_0003080 3300048921 Bacteria 21383
469 Ga0496118_0006331 3300048921 Bacteria 13073
470 Ga0496118_0019517 3300048921 Bacteria 6054
471 Ga0496118_0040751 3300048921 Bacteria 3688
472 Ga0496118_0079267 3300048921 Bacteria 2318
473 Ga0496118_0079268 3300048921 Bacteria 2318
474 Ga0496118_0109530 3300048921 Bacteria 1838
475 Ga0496118_0208090 3300048921 Bacteria 1151
476 Ga0496118_0444039 3300048921 Bacteria 660
477 Ga0496118_0477913 3300048921 Bacteria 625
478 Ga0496119_0000001 3300048922 Bacteria 789520
479 Ga0496119_0000018 3300048922 Bacteria 306476
480 Ga0496119_0000089 3300048922 Bacteria 134344
481 Ga0496119_0000802 3300048922 Bacteria 42063
482 Ga0496119_0001417 3300048922 Bacteria 29013
483 Ga0496119_0002420 3300048922 Bacteria 20486
484 Ga0496119_0002843 3300048922 Bacteria 18489
485 Ga0496119_0002854 3300048922 Bacteria 18442
486 Ga0496119_0003871 3300048922 Bacteria 15265
487 Ga0496119_0005005 3300048922 Bacteria 12923
488 Ga0496119_0010466 3300048922 Bacteria 7802
489 Ga0496119_0038420 3300048922 Bacteria 3093
490 Ga0496119_0055279 3300048922 Bacteria 2411
491 Ga0496119_0060228 3300048922 Bacteria 2274
492 Ga0496119_0198903 3300048922 Bacteria 1038
493 Ga0496119_0246525 3300048922 Bacteria 902
494 Ga0496120_0000002 3300048923 Bacteria 547999
495 Ga0496120_0000091 3300048923 Bacteria 149829
496 Ga0496120_0000117 3300048923 Bacteria 134343
497 Ga0496120_0000510 3300048923 Bacteria 60563
498 Ga0496120_0000601 3300048923 Bacteria 54492
499 Ga0496120_0001288 3300048923 Bacteria 31240
500 Ga0496120_0001634 3300048923 Bacteria 25989
501 Ga0496120_0002365 3300048923 Bacteria 19301
502 Ga0496120_0003638 3300048923 Bacteria 13826
503 Ga0496120_0008536 3300048923 Bacteria 7417
504 Ga0496120_0012388 3300048923 Bacteria 5808
505 Ga0496120_0017903 3300048923 Bacteria 4578
506 Ga0496120_0027046 3300048923 Bacteria 3534
507 Ga0496120_0054056 3300048923 Bacteria 2278
508 Ga0496120_0164540 3300048923 Bacteria 1102
509 Ga0496120_0201759 3300048923 Bacteria 962
510 Ga0496121_0000103 3300048924 Bacteria 194818
511 Ga0496121_0000834 3300048924 Bacteria 56001
512 Ga0496121_0002085 3300048924 Bacteria 31545
513 Ga0496121_0005969 3300048924 Bacteria 15394
514 Ga0496121_0008642 3300048924 Bacteria 11910
515 Ga0496121_0047334 3300048924 Bacteria 3670
516 Ga0496121_0063003 3300048924 Bacteria 3033
517 Ga0496121_0305139 3300048924 Bacteria 1078
518 Ga0496121_0357499 3300048924 Bacteria 970
519 Ga0496122_0000005 3300048925 Bacteria 630659
520 Ga0496122_0000086 3300048925 Bacteria 207993
521 Ga0496122_0000678 3300048925 Bacteria 68370
522 Ga0496122_0000794 3300048925 Bacteria 60621
523 Ga0496122_0005735 3300048925 Bacteria 14638
524 Ga0496122_0007911 3300048925 Bacteria 11659
525 Ga0496122_0013789 3300048925 Bacteria 7875
526 Ga0496122_0013834 3300048925 Bacteria 7857
527 Ga0496122_0048709 3300048925 Bacteria 3254
528 Ga0496122_0054717 3300048925 Bacteria 2993
529 Ga0496122_0065620 3300048925 Bacteria 2630
530 Ga0496122_0090137 3300048925 Bacteria 2093
531 Ga0496122_0105389 3300048925 Bacteria 1870
532 Ga0496122_0155093 3300048925 Bacteria 1406
533 Ga0496122_0244229 3300048925 Bacteria 1009
534 Ga0496122_0255440 3300048925 Bacteria 976
535 Ga0496122_0354317 3300048925 Bacteria 764
536 Ga0496122_0363090 3300048925 Bacteria 750
537 Ga0496122_0366764 3300048925 Bacteria 745
538 Ga0496122_0597551 3300048925 Bacteria 516
539 Ga0496123_0000008 3300048926 Bacteria 630628
540 Ga0496123_0000014 3300048926 Bacteria 433465
541 Ga0496123_0000021 3300048926 Bacteria 378760
542 Ga0496123_0000697 3300048926 Bacteria 55282
543 Ga0496123_0000986 3300048926 Bacteria 43900
544 Ga0496123_0002908 3300048926 Bacteria 20038
545 Ga0496123_0002966 3300048926 Bacteria 19755
546 Ga0496123_0005806 3300048926 Bacteria 12252
547 Ga0496123_0031774 3300048926 Bacteria 3833
548 Ga0496123_0033874 3300048926 Bacteria 3669
549 Ga0496123_0058063 3300048926 Bacteria 2513
550 Ga0496123_0091818 3300048926 Bacteria 1799
551 Ga0496123_0100396 3300048926 Bacteria 1686
552 Ga0496123_0301503 3300048926 Bacteria 764
553 Ga0496123_0301505 3300048926 Bacteria 764
554 Ga0496123_0315145 3300048926 Bacteria 740
555 Ga0496124_0000008 3300048927 Bacteria 864372
556 Ga0496124_0000059 3300048927 Bacteria 241949
557 Ga0496124_0000092 3300048927 Bacteria 189213
558 Ga0496124_0000159 3300048927 Bacteria 137330
559 Ga0496124_0000598 3300048927 Bacteria 60667
560 Ga0496124_0013136 3300048927 Bacteria 8106
561 Ga0496124_0013633 3300048927 Bacteria 7925
562 Ga0496124_0025533 3300048927 Bacteria 5350
563 Ga0496124_0040637 3300048927 Bacteria 4021
564 Ga0496124_0061856 3300048927 Bacteria 3136
565 Ga0496124_0067554 3300048927 Bacteria 2974
566 Ga0496124_0111778 3300048927 Bacteria 2197
567 Ga0496124_0128053 3300048927 Bacteria 2020
568 Ga0496124_0196254 3300048927 Bacteria 1539
569 Ga0496124_0380972 3300048927 Bacteria 986
570 Ga0496124_0383509 3300048927 Bacteria 982
571 Ga0496124_0550004 3300048927 Bacteria 762
572 Ga0496124_0610732 3300048927 Bacteria 707
573 Ga0496124_0661727 3300048927 Bacteria 668
574 Ga0496124_0699799 3300048927 Bacteria 642
575 Ga0496125_0000009 3300048928 Bacteria 677678
576 Ga0496125_0000064 3300048928 Bacteria 250104
577 Ga0496125_0003474 3300048928 Bacteria 19081
578 Ga0496125_0004948 3300048928 Bacteria 15075
579 Ga0496125_0014118 3300048928 Bacteria 7796
580 Ga0496125_0014493 3300048928 Bacteria 7675
581 Ga0496125_0042534 3300048928 Bacteria 3867
582 Ga0496125_0118000 3300048928 Bacteria 1901
583 Ga0496125_0156711 3300048928 Bacteria 1554
584 Ga0496125_0206470 3300048928 Bacteria 1280
585 Ga0496125_0343716 3300048928 Bacteria 894
586 Ga0496125_0350739 3300048928 Bacteria 881
587 Ga0496126_0000229 3300048929 Bacteria 120333
588 Ga0496126_0000740 3300048929 Bacteria 59164
589 Ga0496126_0013776 3300048929 Bacteria 8200
590 Ga0496126_0057224 3300048929 Bacteria 3521
591 Ga0496126_0092702 3300048929 Bacteria 2653
592 Ga0496126_0125417 3300048929 Bacteria 2222
593 Ga0496126_0166094 3300048929 Bacteria 1883
594 Ga0496126_0166392 3300048929 Bacteria 1881
595 Ga0496126_0283961 3300048929 Bacteria 1370
596 Ga0496126_0534467 3300048929 Bacteria 932
597 Ga0496126_0942637 3300048929 Bacteria 651
598 Ga0496126_1293392 3300048929 Bacteria 531
599 Ga0495678_000512 3300049459 Bacteria 37765
600 Ga0495678_001877 3300049459 Bacteria 15278
601 Ga0495678_028422 3300049459 Bacteria 2360
602 Ga0495682_0000001 3300049460 Bacteria 1559116
603 Ga0495682_0002513 3300049460 Bacteria 8662
604 Ga0495682_0044355 3300049460 Bacteria 1627
605 Ga0501249_048490 3300049679 Bacteria 972
606 Ga0501269_000023 3300049766 Bacteria 53029
607 nmdc:mga00v17_1081_c1 3300050491 Bacteria 14354
608 nmdc:mga00v17_153237_c1 3300050491 Bacteria 1481
609 nmdc:mga00v17_22833_c1 3300050491 Bacteria 3614
610 nmdc:mga00v17_997613_c1 3300050491 Bacteria 527
611 nmdc:mga0k408_11532_c1 3300050493 Bacteria 4817
612 Ga0500621_000002 3300053126 Bacteria 849473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0000008 Ga0495590_0000008_323821_324126 91
2 3300046471 Ga0495650_0116124 Ga0495650_0116124_529_834 91
3 3300046523 Ga0495644_0005501 Ga0495644_0005501_2629_2934 91
4 3300046692 Ga0495671_0645592 Ga0495671_0645592_105_410 91
5 3300046694 Ga0495649_0001109 Ga0495649_0001109_6171_6476 91
6 3300046458 Ga0495591_000007 Ga0495591_000007_168432_168755 92
7 3300046452 Ga0495617_060513 Ga0495617_060513_407_730 95
8 3300047444 Ga0495675_0845870 Ga0495675_0845870_37_399 99
9 3300049679 Ga0501249_048490 Ga0501249_048490_181_531 100
10 3300049766 Ga0501269_000023 Ga0501269_000023_36469_36819 100
11 iso_pu_bacteria 2511231025 2511380783 103
12 iso_pu_bacteria 2511231035 2511437043 103
13 iso_pu_bacteria 2599185299 2599925822 103
14 iso_pu_bacteria 2608642108 2608669602 103
15 iso_pu_bacteria 2648501693 2650899154 103
16 iso_pu_bacteria 2684622997 2686353540 103
17 iso_pu_bacteria 2808606414 2809123401 103
18 iso_pu_bacteria 2844528606 2844531077 103
19 iso_pu_bacteria 2847797336 2847799673 103
20 iso_pu_bacteria 2865014394 2865015449 103
21 iso_pu_bacteria 2876601092 2876604044 103
22 iso_pu_bacteria 2881609920 2881611976 103
23 iso_pu_bacteria 2939602548 2939603177 103
24 iso_pu_bacteria 2945951305 2945952800 103
25 iso_pu_bacteria 2978975091 2978979375 103
26 iso_pu_bacteria 2984494565 2984496827 103
27 iso_pu_bacteria 2990261002 2990262244 103
28 iso_pu_bacteria 8016733728 8016735730 103
29 iso_pu_bacteria 8019499862 8019500872 103
30 3300046460 Ga0495638_0301172 Ga0495638_0301172_447_791 104
31 iso_pu_bacteria 2506520007 2506578711 104
32 iso_pu_bacteria 2506520008 2506583850 104
33 iso_pu_bacteria 2508501071 2508852677 104
34 iso_pu_bacteria 2547132416 2548650166 104
35 iso_pu_bacteria 2561511199 2562462527 104
36 iso_pu_bacteria 2599185169 2599410832 104
37 iso_pu_bacteria 2600255254 2601521653 104
38 iso_pu_bacteria 2600255255 2601526678 104
39 iso_pu_bacteria 2600255256 2601533712 104
40 iso_pu_bacteria 2600255257 2601539636 104
41 iso_pu_bacteria 2600255280 2601613508 104
42 iso_pu_bacteria 2600255281 2601622411 104
43 iso_pu_bacteria 2600255287 2601643078 104
44 iso_pu_bacteria 2600255288 2601650447 104
45 iso_pu_bacteria 2600255289 2601655736 104
46 iso_pu_bacteria 2600255290 2601656983 104
47 iso_pu_bacteria 2600255291 2601662899 104
48 iso_pu_bacteria 2600255298 2601695858 104
49 iso_pu_bacteria 2600255299 2601700532 104
50 iso_pu_bacteria 2600255300 2601704780 104
51 iso_pu_bacteria 2600255301 2601709809 104
52 iso_pu_bacteria 2600255302 2601714821 104
53 iso_pu_bacteria 2600255303 2601720883 104
54 iso_pu_bacteria 2600255304 2601725227 104
55 iso_pu_bacteria 2600255305 2601729769 104
56 iso_pu_bacteria 2600255306 2601734786 104
57 iso_pu_bacteria 2600255307 2601743782 104
58 iso_pu_bacteria 2600255309 2601754300 104
59 iso_pu_bacteria 2600255310 2601757986 104
60 iso_pu_bacteria 2600255311 2601763763 104
61 iso_pu_bacteria 2600255392 2602021701 104
62 iso_pu_bacteria 2602042046 2603637641 104
63 iso_pu_bacteria 2602042047 2603642061 104
64 iso_pu_bacteria 2602042052 2603660274 104
65 iso_pu_bacteria 2602042053 2603665549 104
66 iso_pu_bacteria 2602042066 2603698755 104
67 iso_pu_bacteria 2602042067 2603702674 104
68 iso_pu_bacteria 2602042103 2603837141 104
69 iso_pu_bacteria 2602042104 2603842217 104
70 iso_pu_bacteria 2602042105 2603847290 104
71 iso_pu_bacteria 2602042106 2603852361 104
72 iso_pu_bacteria 2602042109 2603864437 104
73 iso_pu_bacteria 2602042110 2603870414 104
74 iso_pu_bacteria 2602042111 2603875424 104
75 iso_pu_bacteria 2603880178 2606047605 104
76 iso_pu_bacteria 2603880184 2606069980 104
77 iso_pu_bacteria 2603880202 2606145892 104
78 iso_pu_bacteria 2603880211 2606175006 104
79 iso_pu_bacteria 2609459761 2609912404 104
80 iso_pu_bacteria 2636415599 2637225726 104
81 iso_pu_bacteria 2654587920 2656279687 104
82 iso_pu_bacteria 2667528172 2671101837 104
83 iso_pu_bacteria 2671180115 2671584697 104
84 iso_pu_bacteria 2675903046 2676408063 104
85 iso_pu_bacteria 2681812866 2681998453 104
86 iso_pu_bacteria 2681812869 2682005697 104
87 iso_pu_bacteria 2687453601 2689445266 104
88 iso_pu_bacteria 2706794495 2707100442 104
89 iso_pu_bacteria 2711768156 2712469669 104
90 iso_pu_bacteria 2751185917 2753856287 104
91 iso_pu_bacteria 2765235842 2765589277 104
92 iso_pu_bacteria 2775506706 2775539358 104
93 iso_pu_bacteria 2775507074 2777023575 104
94 iso_pu_bacteria 2791355010 2792313191 104
95 iso_pu_bacteria 2791355275 2793405399 104
96 iso_pu_bacteria 2806310673 2807176626 104
97 iso_pu_bacteria 2811995292 2813728684 104
98 iso_pu_bacteria 2814123068 2814696205 104
99 iso_pu_bacteria 2821118458 2821122668 104
100 iso_pu_bacteria 2823373977 2823375017 104
101 iso_pu_bacteria 2844425489 2844427804 104
102 iso_pu_bacteria 2846540461 2846545097 104
103 iso_pu_bacteria 2847085930 2847087474 104
104 iso_pu_bacteria 2854601825 2854604519 104
105 iso_pu_bacteria 2869551831 2869554701 104
106 iso_pu_bacteria 2884086401 2884089157 104
107 iso_pu_bacteria 2888366609 2888369277 104
108 iso_pu_bacteria 2888373701 2888378059 104
109 iso_pu_bacteria 2904513164 2904513420 104
110 iso_pu_bacteria 2908669403 2908669571 104
111 iso_pu_bacteria 2919108558 2919112174 104
112 iso_pu_bacteria 2923634449 2923635218 104
113 iso_pu_bacteria 2927833300 2927833787 104
114 iso_pu_bacteria 2932406140 2932407717 104
115 iso_pu_bacteria 2935625433 2935626502 104
116 iso_pu_bacteria 2937539931 2937541373 104
117 iso_pu_bacteria 2939568625 2939569370 104
118 iso_pu_bacteria 2939573065 2939573464 104
119 iso_pu_bacteria 2939577877 2939581315 104
120 iso_pu_bacteria 2939607340 2939609250 104
121 iso_pu_bacteria 2939617950 2939621278 104
122 iso_pu_bacteria 2939642701 2939643586 104
123 iso_pu_bacteria 2945874760 2945877752 104
124 iso_pu_bacteria 2969079654 2969082722 104
125 iso_pu_bacteria 2974310843 2974311825 104
126 iso_pu_bacteria 2974435778 2974438590 104
127 iso_pu_bacteria 2984559226 2984559787 104
128 iso_pu_bacteria 2984595703 2984597868 104
129 iso_pu_bacteria 3000376612 3000379285 104
130 iso_pu_bacteria 640753048 640938185 104
131 iso_pu_bacteria 8018221730 8018221752 104
132 iso_pu_bacteria 8018405270 8018407511 104
133 iso_pu_bacteria 8019504834 8019507983 104
134 iso_pu_bacteria 8054844752 8054846053 104
135 iso_pu_bacteria 8054849141 8054850696 104
136 iso_pu_bacteria 8055087960 8055090667 104
137 iso_pu_bacteria 8055092621 8055096679 104
138 iso_pu_bacteria 8055097453 8055098788 104
139 iso_pu_bacteria 8055693939 8055696538 104
140 iso_pu_bacteria 8057304971 8057308853 104
141 3300046522 Ga0495643_0013954 Ga0495643_0013954_4362_4712 105
142 3300046542 Ga0495597_0000468 Ga0495597_0000468_29417_29767 105
143 3300048927 Ga0496124_0380972 Ga0496124_0380972_304_657 105
144 iso_pu_bacteria 2537561728 2538426717 105
145 iso_pu_bacteria 2554235234 2555260173 105
146 iso_pu_bacteria 2585427591 2585828273 105
147 iso_pu_bacteria 2585427592 2585833960 105
148 iso_pu_bacteria 2667528173 2671110134 105
149 iso_pu_bacteria 2772190666 2772439229 105
150 iso_pu_bacteria 2852103415 2852105800 105
151 iso_pu_bacteria 2855195626 2855196074 105
152 iso_pu_bacteria 2871282230 2871284768 105
153 iso_pu_bacteria 2891670763 2891670938 105
154 iso_pu_bacteria 2900051742 2900052599 105
155 iso_pu_bacteria 2904474040 2904478999 105
156 iso_pu_bacteria 2904504865 2904507336 105
157 iso_pu_bacteria 2919150387 2919155107 105
158 iso_pu_bacteria 2927143783 2927148690 105
159 iso_pu_bacteria 2937967321 2937967858 105
160 iso_pu_bacteria 2971820967 2971824060 105
161 iso_pu_bacteria 8004592986 8004597132 105
162 iso_pu_bacteria 8015394850 8015396383 105
163 3300001989 JGI24739J22299_10000362 JGI24739J22299_1000036214 107
164 3300002737 JGI25162J39368_1002511 JGI25162J39368_10025113 107
165 3300002771 JGI25163J39215_1006699 JGI25163J39215_10066992 107
166 3300003856 Ga0058692_1000084 Ga0058692_100008413 107
167 3300003856 Ga0058692_1000137 Ga0058692_100013713 107
168 3300003856 Ga0058692_1000315 Ga0058692_100031517 107
169 3300003856 Ga0058692_1000507 Ga0058692_100050711 107
170 3300003856 Ga0058692_1002057 Ga0058692_10020578 107
171 3300003856 Ga0058692_1004462 Ga0058692_10044622 107
172 3300003856 Ga0058692_1047434 Ga0058692_10474342 107
173 3300003856 Ga0058692_1047459 Ga0058692_10474592 107
174 3300005347 Ga0070668_100071006 Ga0070668_1000710063 107
175 3300005548 Ga0070665_101003917 Ga0070665_1010039172 107
176 3300006051 Ga0075364_10022833 Ga0075364_100228336 107
177 3300009011 Ga0105251_10002470 Ga0105251_100024706 107
178 3300009011 Ga0105251_10011069 Ga0105251_100110693 107
179 3300009011 Ga0105251_10160839 Ga0105251_101608392 107
180 3300009011 Ga0105251_10306060 Ga0105251_103060602 107
181 3300009036 Ga0105244_10001933 Ga0105244_100019331 107
182 3300009036 Ga0105244_10060520 Ga0105244_100605203 107
183 3300009036 Ga0105244_10112842 Ga0105244_101128421 107
184 3300009036 Ga0105244_10229432 Ga0105244_102294322 107
185 3300009036 Ga0105244_10270200 Ga0105244_102702002 107
186 3300009036 Ga0105244_10312534 Ga0105244_103125341 107
187 3300009092 Ga0105250_10002354 Ga0105250_100023542 107
188 3300009092 Ga0105250_10015630 Ga0105250_100156302 107
189 3300009092 Ga0105250_10160079 Ga0105250_101600792 107
190 3300010375 Ga0105239_11280796 Ga0105239_112807963 107
191 3300011119 Ga0105246_10088591 Ga0105246_100885911 107
192 3300011119 Ga0105246_10649781 Ga0105246_106497811 107
193 3300013100 Ga0157373_10000504 Ga0157373_1000050422 107
194 3300013100 Ga0157373_10000664 Ga0157373_100006647 107
195 3300013102 Ga0157371_10000424 Ga0157371_1000042418 107
196 3300013102 Ga0157371_10001362 Ga0157371_100013626 107
197 3300013102 Ga0157371_10002445 Ga0157371_100024455 107
198 3300013102 Ga0157371_10077588 Ga0157371_100775882 107
199 3300013104 Ga0157370_10000254 Ga0157370_1000025447 107
200 3300013105 Ga0157369_10023314 Ga0157369_100233146 107
201 3300013105 Ga0157369_10572805 Ga0157369_105728052 107
202 3300013306 Ga0163162_10061488 Ga0163162_100614885 107
203 3300013307 Ga0157372_10019270 Ga0157372_100192702 107
204 3300013307 Ga0157372_10055712 Ga0157372_100557122 107
205 3300013307 Ga0157372_10319343 Ga0157372_103193432 107
206 3300013307 Ga0157372_11517516 Ga0157372_115175162 107
207 3300014497 Ga0182008_10063183 Ga0182008_100631832 107
208 3300015261 Ga0182006_1010456 Ga0182006_10104562 107
209 3300015261 Ga0182006_1042313 Ga0182006_10423133 107
210 3300015262 Ga0182007_10025120 Ga0182007_100251203 107
211 3300017792 Ga0163161_10135677 Ga0163161_101356772 107
212 3300025207 Ga0209760_110207 Ga0209760_1102071 107
213 3300025233 Ga0209437_100073 Ga0209437_10007359 107
214 3300025711 Ga0207696_1000280 Ga0207696_10002805 107
215 3300025711 Ga0207696_1005298 Ga0207696_10052983 107
216 3300025728 Ga0207655_1014946 Ga0207655_10149465 107
217 3300025728 Ga0207655_1029534 Ga0207655_10295343 107
218 3300025728 Ga0207655_1035654 Ga0207655_10356542 107
219 3300025728 Ga0207655_1208490 Ga0207655_12084902 107
220 3300025735 Ga0207713_1000001 Ga0207713_10000011249 107
221 3300025735 Ga0207713_1007390 Ga0207713_10073902 107
222 3300025735 Ga0207713_1158221 Ga0207713_11582212 107
223 3300025914 Ga0207671_10537097 Ga0207671_105370972 107
224 3300025972 Ga0207668_10011064 Ga0207668_100110642 107
225 3300027312 Ga0209371_1000005 Ga0209371_1000005315 107
226 3300027312 Ga0209371_1000039 Ga0209371_100003988 107
227 3300027312 Ga0209371_1000110 Ga0209371_100011052 107
228 3300027312 Ga0209371_1000157 Ga0209371_100015785 107
229 3300027312 Ga0209371_1001545 Ga0209371_100154510 107
230 3300027312 Ga0209371_1008451 Ga0209371_10084513 107
231 3300030500 Ga0268256_1000006 Ga0268256_1000006742 107
232 3300030500 Ga0268256_1000033 Ga0268256_1000033274 107
233 3300030500 Ga0268256_1000742 Ga0268256_100074217 107
234 3300030500 Ga0268256_1001321 Ga0268256_10013214 107
235 3300030500 Ga0268256_1002417 Ga0268256_10024179 107
236 3300030500 Ga0268256_1007532 Ga0268256_10075323 107
237 3300030500 Ga0268256_1009192 Ga0268256_10091924 107
238 3300030500 Ga0268256_1019256 Ga0268256_10192562 107
239 3300030500 Ga0268256_1059107 Ga0268256_10591072 107
240 3300030742 Ga0316183_1087108 Ga0316183_10871081 107
241 3300041405 Ga0439438_000001 Ga0439438_000001_1028395_1028718 107
242 3300041405 Ga0439438_022500 Ga0439438_022500_935_1258 107
243 3300041407 Ga0439447_001353 Ga0439447_001353_8506_8829 107
244 3300041407 Ga0439447_013939 Ga0439447_013939_1607_1930 107
245 3300041411 Ga0439466_0000062 Ga0439466_0000062_29292_29615 107
246 3300042006 Ga0439432_007783 Ga0439432_007783_1703_2026 107
247 3300042006 Ga0439432_015408 Ga0439432_015408_635_958 107
248 3300042006 Ga0439432_030994 Ga0439432_030994_598_921 107
249 3300042010 Ga0439452_000001 Ga0439452_000001_1066935_1067258 107
250 3300042010 Ga0439452_013286 Ga0439452_013286_268_591 107
251 3300042016 Ga0439463_043421 Ga0439463_043421_782_1105 107
252 3300042146 Ga0450907_002353 Ga0450907_002353_1516_1839 107
253 3300042439 Ga0439464_0002716 Ga0439464_0002716_172_495 107
254 3300046458 Ga0495591_126322 Ga0495591_126322_44_400 107
255 3300046491 Ga0495584_0014708 Ga0495584_0014708_764_1120 107
256 3300046492 Ga0495585_0025859 Ga0495585_0025859_571_894 107
257 3300046492 Ga0495585_0031708 Ga0495585_0031708_347_703 107
258 3300046500 Ga0495596_0003847 Ga0495596_0003847_259_582 107
259 3300046500 Ga0495596_0016665 Ga0495596_0016665_2325_2681 107
260 3300046500 Ga0495596_0031875 Ga0495596_0031875_455_811 107
261 3300046500 Ga0495596_0054386 Ga0495596_0054386_224_580 107
262 3300046506 Ga0495583_0008098 Ga0495583_0008098_5740_6096 107
263 3300046507 Ga0495606_0032303 Ga0495606_0032303_3085_3441 107
264 3300046513 Ga0495616_0027598 Ga0495616_0027598_1178_1534 107
265 3300046518 Ga0495631_0168177 Ga0495631_0168177_224_580 107
266 3300046518 Ga0495631_0270902 Ga0495631_0270902_253_609 107
267 3300046522 Ga0495643_0037932 Ga0495643_0037932_1132_1455 107
268 3300046523 Ga0495644_0090391 Ga0495644_0090391_439_795 107
269 3300046523 Ga0495644_0270359 Ga0495644_0270359_154_510 107
270 3300046524 Ga0495648_0001135 Ga0495648_0001135_19823_20146 107
271 3300046524 Ga0495648_0104201 Ga0495648_0104201_28_384 107
272 3300046524 Ga0495648_0465632 Ga0495648_0465632_125_481 107
273 3300046528 Ga0495642_0316996 Ga0495642_0316996_38_394 107
274 3300046530 Ga0495654_0000007 Ga0495654_0000007_205574_205897 107
275 3300046530 Ga0495654_0252313 Ga0495654_0252313_191_547 107
276 3300046538 Ga0495609_0026013 Ga0495609_0026013_151_507 107
277 3300046616 Ga0495668_0032436 Ga0495668_0032436_1972_2295 107
278 3300046648 Ga0495611_0032937 Ga0495611_0032937_377_733 107
279 3300046660 Ga0495625_0397051 Ga0495625_0397051_492_848 107
280 3300046665 Ga0495661_0019251 Ga0495661_0019251_3165_3521 107
281 3300046665 Ga0495661_0220610 Ga0495661_0220610_504_860 107
282 3300046665 Ga0495661_0224880 Ga0495661_0224880_152_508 107
283 3300046684 Ga0495669_0025380 Ga0495669_0025380_1904_2260 107
284 3300046691 Ga0495670_0017478 Ga0495670_0017478_1573_1929 107
285 3300046691 Ga0495670_0025633 Ga0495670_0025633_2415_2771 107
286 3300046694 Ga0495649_0134134 Ga0495649_0134134_107_463 107
287 3300046794 Ga0495589_0023205 Ga0495589_0023205_418_774 107
288 3300046794 Ga0495589_0175052 Ga0495589_0175052_348_704 107
289 3300046794 Ga0495589_0255223 Ga0495589_0255223_203_559 107
290 3300046810 Ga0495660_0057422 Ga0495660_0057422_1591_1914 107
291 3300046810 Ga0495660_0092683 Ga0495660_0092683_1188_1544 107
292 3300046810 Ga0495660_0169599 Ga0495660_0169599_32_388 107
293 3300046810 Ga0495660_0254419 Ga0495660_0254419_36_392 107
294 3300047320 Ga0495672_0000015 Ga0495672_0000015_23488_23811 107
295 3300047320 Ga0495672_0087642 Ga0495672_0087642_1154_1510 107
296 3300047323 Ga0495683_0110249 Ga0495683_0110249_363_719 107
297 3300047323 Ga0495683_0130547 Ga0495683_0130547_349_705 107
298 3300047446 Ga0495679_004954 Ga0495679_004954_2928_3251 107
299 3300047446 Ga0495679_019632 Ga0495679_019632_1724_2080 107
300 3300047446 Ga0495679_038019 Ga0495679_038019_545_901 107
301 3300047472 Ga0495686_0000391 Ga0495686_0000391_10252_10608 107
302 3300048090 Ga0495615_0239832 Ga0495615_0239832_86_442 107
303 3300048091 Ga0495626_0002901 Ga0495626_0002901_4267_4623 107
304 3300048091 Ga0495626_0056569 Ga0495626_0056569_501_857 107
305 3300048903 Ga0496100_0007867 Ga0496100_0007867_4631_4954 107
306 3300048903 Ga0496100_0119495 Ga0496100_0119495_615_938 107
307 3300048903 Ga0496100_0759924 Ga0496100_0759924_321_644 107
308 3300048904 Ga0496101_0000058 Ga0496101_0000058_35748_36071 107
309 3300048905 Ga0496102_0004241 Ga0496102_0004241_11484_11807 107
310 3300048905 Ga0496102_0070821 Ga0496102_0070821_1895_2251 107
311 3300048905 Ga0496102_0301560 Ga0496102_0301560_550_873 107
312 3300048908 Ga0496105_0012224 Ga0496105_0012224_1685_2008 107
313 3300048909 Ga0496106_0083326 Ga0496106_0083326_1286_1609 107
314 3300048913 Ga0496110_0554771 Ga0496110_0554771_622_945 107
315 3300048919 Ga0496116_0000087 Ga0496116_0000087_172633_172956 107
316 3300048919 Ga0496116_0102283 Ga0496116_0102283_1100_1423 107
317 3300048919 Ga0496116_0259008 Ga0496116_0259008_160_483 107
318 3300048919 Ga0496116_0300349 Ga0496116_0300349_422_745 107
319 3300048920 Ga0496117_0000022 Ga0496117_0000022_139638_139961 107
320 3300048920 Ga0496117_0000058 Ga0496117_0000058_242030_242353 107
321 3300048920 Ga0496117_0000920 Ga0496117_0000920_12471_12794 107
322 3300048920 Ga0496117_0271450 Ga0496117_0271450_388_711 107
323 3300048921 Ga0496118_0000007 Ga0496118_0000007_436437_436760 107
324 3300048921 Ga0496118_0000328 Ga0496118_0000328_21876_22199 107
325 3300048921 Ga0496118_0019517 Ga0496118_0019517_4059_4382 107
326 3300048921 Ga0496118_0109530 Ga0496118_0109530_114_437 107
327 3300048922 Ga0496119_0000089 Ga0496119_0000089_19592_19915 107
328 3300048922 Ga0496119_0001417 Ga0496119_0001417_18692_19015 107
329 3300048922 Ga0496119_0002420 Ga0496119_0002420_9253_9576 107
330 3300048923 Ga0496120_0000117 Ga0496120_0000117_114429_114752 107
331 3300048923 Ga0496120_0000601 Ga0496120_0000601_12681_13004 107
332 3300048923 Ga0496120_0001634 Ga0496120_0001634_7967_8290 107
333 3300048923 Ga0496120_0164540 Ga0496120_0164540_556_879 107
334 3300048924 Ga0496121_0000103 Ga0496121_0000103_55744_56067 107
335 3300048925 Ga0496122_0000678 Ga0496122_0000678_67555_67878 107
336 3300048925 Ga0496122_0013789 Ga0496122_0013789_3232_3555 107
337 3300048925 Ga0496122_0090137 Ga0496122_0090137_1730_2053 107
338 3300048926 Ga0496123_0000697 Ga0496123_0000697_44121_44444 107
339 3300048926 Ga0496123_0000986 Ga0496123_0000986_7637_7960 107
340 3300048927 Ga0496124_0013136 Ga0496124_0013136_7652_7975 107
341 3300048927 Ga0496124_0013633 Ga0496124_0013633_5038_5361 107
342 3300048927 Ga0496124_0040637 Ga0496124_0040637_21_344 107
343 3300048927 Ga0496124_0111778 Ga0496124_0111778_728_1051 107
344 3300048927 Ga0496124_0196254 Ga0496124_0196254_828_1151 107
345 3300048927 Ga0496124_0550004 Ga0496124_0550004_169_525 107
346 3300048929 Ga0496126_0166392 Ga0496126_0166392_754_1077 107
347 3300049459 Ga0495678_001877 Ga0495678_001877_586_942 107
348 3300049459 Ga0495678_028422 Ga0495678_028422_560_883 107
349 3300049460 Ga0495682_0002513 Ga0495682_0002513_2885_3241 107
350 3300049460 Ga0495682_0044355 Ga0495682_0044355_218_574 107
351 3300050491 nmdc:mga00v17_153237_c1 nmdc:mga00v17_153237_c1_275_598 107
352 3300050491 nmdc:mga00v17_22833_c1 nmdc:mga00v17_22833_c1_2945_3268 107
353 3300050491 nmdc:mga00v17_997613_c1 nmdc:mga00v17_997613_c1_138_461 107
354 iso_pu_bacteria 2858466076 2858468843 107
355 iso_pu_bacteria 2871272651 2871272653 107
356 2162886007 SwRhRL2b_contig_1380939 SwRhRL2b_0547.00002130 108
357 2162886007 SwRhRL2b_contig_570928 SwRhRL2b_0648.00003110 108
358 3300002737 JGI25162J39368_1000033 JGI25162J39368_100003359 108
359 3300002771 JGI25163J39215_1000004 JGI25163J39215_100000441 108
360 3300002772 JGI25164J39214_1000017 JGI25164J39214_100001759 108
361 3300002773 JGI25152J39213_1000368 JGI25152J39213_100036814 108
362 3300003320 rootH2_10034177 rootH2_100341772 108
363 3300003751 Ga0055538_1000035 Ga0055538_1000035135 108
364 3300003752 Ga0055539_1000046 Ga0055539_100004659 108
365 3300003756 Ga0055533_1000056 Ga0055533_1000056135 108
366 3300003759 Ga0055525_1000067 Ga0055525_1000067135 108
367 3300003841 Ga0055541_1000033 Ga0055541_100003359 108
368 3300003856 Ga0058692_1000195 Ga0058692_100019531 108
369 3300003856 Ga0058692_1001165 Ga0058692_10011657 108
370 3300003856 Ga0058692_1013233 Ga0058692_10132333 108
371 3300003856 Ga0058692_1020137 Ga0058692_10201373 108
372 3300003856 Ga0058692_1023493 Ga0058692_10234931 108
373 3300003856 Ga0058692_1028935 Ga0058692_10289352 108
374 3300005272 Ga0065703_1022688 Ga0065703_10226882 108
375 3300005289 Ga0065704_10000015 Ga0065704_1000001534 108
376 3300005289 Ga0065704_10000612 Ga0065704_100006127 108
377 3300005289 Ga0065704_10000781 Ga0065704_100007815 108
378 3300005289 Ga0065704_10001396 Ga0065704_100013964 108
379 3300005289 Ga0065704_10011231 Ga0065704_100112312 108
380 3300005289 Ga0065704_10070889 Ga0065704_100708893 108
381 3300005289 Ga0065704_10091395 Ga0065704_100913952 108
382 3300005289 Ga0065704_10586022 Ga0065704_105860221 108
383 3300005289 Ga0065704_10691244 Ga0065704_106912441 108
384 3300005548 Ga0070665_100000600 Ga0070665_1000006003 108
385 3300005548 Ga0070665_100399528 Ga0070665_1003995282 108
386 3300005577 Ga0068857_100170289 Ga0068857_1001702894 108
387 3300006051 Ga0075364_10000385 Ga0075364_1000038511 108
388 3300006051 Ga0075364_10094630 Ga0075364_100946301 108
389 3300006195 Ga0075366_10012395 Ga0075366_100123953 108
390 3300006946 Ga0079104_1000021 Ga0079104_1000021193 108
391 3300006946 Ga0079104_1000030 Ga0079104_1000030178 108
392 3300006946 Ga0079104_1000065 Ga0079104_1000065135 108
393 3300006946 Ga0079104_1000462 Ga0079104_10004629 108
394 3300006946 Ga0079104_1000800 Ga0079104_100080011 108
395 3300006946 Ga0079104_1001605 Ga0079104_100160510 108
396 3300006946 Ga0079104_1001609 Ga0079104_10016098 108
397 3300006946 Ga0079104_1001617 Ga0079104_10016179 108
398 3300006946 Ga0079104_1001853 Ga0079104_100185311 108
399 3300006946 Ga0079104_1002430 Ga0079104_10024305 108
400 3300006946 Ga0079104_1009841 Ga0079104_10098412 108
401 3300006946 Ga0079104_1011303 Ga0079104_10113033 108
402 3300009011 Ga0105251_10000251 Ga0105251_1000025142 108
403 3300009011 Ga0105251_10000863 Ga0105251_100008636 108
404 3300009011 Ga0105251_10001028 Ga0105251_1000102812 108
405 3300009011 Ga0105251_10002099 Ga0105251_100020999 108
406 3300009011 Ga0105251_10002478 Ga0105251_100024787 108
407 3300009011 Ga0105251_10002724 Ga0105251_100027246 108
408 3300009011 Ga0105251_10017940 Ga0105251_100179404 108
409 3300009011 Ga0105251_10119033 Ga0105251_101190332 108
410 3300009011 Ga0105251_10133140 Ga0105251_101331402 108
411 3300009011 Ga0105251_10137453 Ga0105251_101374533 108
412 3300009011 Ga0105251_10475966 Ga0105251_104759661 108
413 3300009011 Ga0105251_10508837 Ga0105251_105088371 108
414 3300009011 Ga0105251_10623714 Ga0105251_106237141 108
415 3300009036 Ga0105244_10000015 Ga0105244_1000001533 108
416 3300009036 Ga0105244_10000028 Ga0105244_10000028130 108
417 3300009036 Ga0105244_10000070 Ga0105244_100000708 108
418 3300009036 Ga0105244_10000173 Ga0105244_1000017335 108
419 3300009036 Ga0105244_10000321 Ga0105244_1000032131 108
420 3300009036 Ga0105244_10004691 Ga0105244_100046917 108
421 3300009036 Ga0105244_10006078 Ga0105244_100060785 108
422 3300009036 Ga0105244_10058682 Ga0105244_100586822 108
423 3300009036 Ga0105244_10062069 Ga0105244_100620693 108
424 3300009036 Ga0105244_10125569 Ga0105244_101255691 108
425 3300009036 Ga0105244_10125686 Ga0105244_101256861 108
426 3300009036 Ga0105244_10143735 Ga0105244_101437352 108
427 3300009036 Ga0105244_10259131 Ga0105244_102591312 108
428 3300009092 Ga0105250_10000001 Ga0105250_10000001429 108
429 3300009092 Ga0105250_10000060 Ga0105250_1000006055 108
430 3300009092 Ga0105250_10000070 Ga0105250_1000007036 108
431 3300009092 Ga0105250_10000455 Ga0105250_1000045511 108
432 3300009092 Ga0105250_10001103 Ga0105250_100011037 108
433 3300009092 Ga0105250_10002351 Ga0105250_100023512 108
434 3300009092 Ga0105250_10005578 Ga0105250_100055787 108
435 3300009092 Ga0105250_10031851 Ga0105250_100318512 108
436 3300009092 Ga0105250_10035373 Ga0105250_100353733 108
437 3300009092 Ga0105250_10209218 Ga0105250_102092182 108
438 3300009092 Ga0105250_10242512 Ga0105250_102425121 108
439 3300009101 Ga0105247_10000012 Ga0105247_1000001211 108
440 3300009148 Ga0105243_10247975 Ga0105243_102479751 108
441 3300009174 Ga0105241_10000002 Ga0105241_1000000253 108
442 3300013100 Ga0157373_10003718 Ga0157373_100037189 108
443 3300013100 Ga0157373_10362482 Ga0157373_103624822 108
444 3300013102 Ga0157371_10000061 Ga0157371_1000006157 108
445 3300013102 Ga0157371_10014596 Ga0157371_100145963 108
446 3300013102 Ga0157371_10083322 Ga0157371_100833222 108
447 3300013104 Ga0157370_10001904 Ga0157370_1000190419 108
448 3300013104 Ga0157370_10006276 Ga0157370_1000627610 108
449 3300013105 Ga0157369_10021355 Ga0157369_100213557 108
450 3300013306 Ga0163162_11548978 Ga0163162_115489782 108
451 3300013307 Ga0157372_10001114 Ga0157372_100011142 108
452 3300013307 Ga0157372_10055145 Ga0157372_100551453 108
453 3300013307 Ga0157372_10564785 Ga0157372_105647853 108
454 3300013308 Ga0157375_11633956 Ga0157375_116339562 108
455 3300014497 Ga0182008_10017622 Ga0182008_100176223 108
456 3300015261 Ga0182006_1000051 Ga0182006_100005148 108
457 3300015679 Ga0183366_1001 Ga0183366_10011731 108
458 3300015680 Ga0183370_1001 Ga0183370_10011731 108
459 3300015685 Ga0183369_1001 Ga0183369_10011731 108
460 3300015687 Ga0183368_1001 Ga0183368_10011731 108
461 3300017792 Ga0163161_10000001 Ga0163161_100000011480 108
462 3300017792 Ga0163161_10159263 Ga0163161_101592632 108
463 3300021384 Ga0213876_10000069 Ga0213876_1000006959 108
464 3300025207 Ga0209760_100260 Ga0209760_10026013 108
465 3300025224 Ga0209784_100001 Ga0209784_1000011581 108
466 3300025225 Ga0209566_100001 Ga0209566_1000011581 108
467 3300025226 Ga0209674_100002 Ga0209674_1000021581 108
468 3300025230 Ga0209563_100002 Ga0209563_100002116 108
469 3300025231 Ga0207427_100032 Ga0207427_100032116 108
470 3300025233 Ga0209437_100001 Ga0209437_100001116 108
471 3300025245 Ga0207425_1006998 Ga0207425_10069982 108
472 3300025253 Ga0209677_100002 Ga0209677_100002116 108
473 3300025258 Ga0209129_1000004 Ga0209129_1000004416 108
474 3300025711 Ga0207696_1000001 Ga0207696_10000011550 108
475 3300025711 Ga0207696_1000028 Ga0207696_1000028255 108
476 3300025711 Ga0207696_1000038 Ga0207696_1000038121 108
477 3300025711 Ga0207696_1000190 Ga0207696_100019070 108
478 3300025711 Ga0207696_1000350 Ga0207696_100035039 108
479 3300025711 Ga0207696_1000579 Ga0207696_100057911 108
480 3300025711 Ga0207696_1001236 Ga0207696_10012365 108
481 3300025711 Ga0207696_1005020 Ga0207696_10050203 108
482 3300025711 Ga0207696_1047476 Ga0207696_10474762 108
483 3300025711 Ga0207696_1207519 Ga0207696_12075191 108
484 3300025728 Ga0207655_1000001 Ga0207655_10000011608 108
485 3300025728 Ga0207655_1000002 Ga0207655_1000002851 108
486 3300025728 Ga0207655_1000061 Ga0207655_100006134 108
487 3300025728 Ga0207655_1000091 Ga0207655_1000091131 108
488 3300025728 Ga0207655_1000110 Ga0207655_1000110158 108
489 3300025728 Ga0207655_1000168 Ga0207655_10001688 108
490 3300025728 Ga0207655_1000343 Ga0207655_10003437 108
491 3300025728 Ga0207655_1002296 Ga0207655_100229610 108
492 3300025728 Ga0207655_1015693 Ga0207655_10156932 108
493 3300025728 Ga0207655_1044564 Ga0207655_10445643 108
494 3300025728 Ga0207655_1139384 Ga0207655_11393842 108
495 3300025735 Ga0207713_1000002 Ga0207713_1000002167 108
496 3300025735 Ga0207713_1000004 Ga0207713_1000004521 108
497 3300025735 Ga0207713_1000008 Ga0207713_1000008477 108
498 3300025735 Ga0207713_1000035 Ga0207713_100003571 108
499 3300025735 Ga0207713_1000039 Ga0207713_1000039124 108
500 3300025735 Ga0207713_1005909 Ga0207713_10059096 108
501 3300025735 Ga0207713_1015602 Ga0207713_10156026 108
502 3300025735 Ga0207713_1015874 Ga0207713_10158741 108
503 3300025735 Ga0207713_1016730 Ga0207713_10167304 108
504 3300025735 Ga0207713_1025399 Ga0207713_10253995 108
505 3300025735 Ga0207713_1039373 Ga0207713_10393731 108
506 3300025735 Ga0207713_1206429 Ga0207713_12064292 108
507 3300025900 Ga0207710_10000354 Ga0207710_1000035419 108
508 3300025911 Ga0207654_10000005 Ga0207654_1000000553 108
509 3300026116 Ga0207674_10281928 Ga0207674_102819282 108
510 3300027111 Ga0209281_1000001 Ga0209281_1000001497 108
511 3300027111 Ga0209281_1000003 Ga0209281_1000003648 108
512 3300027111 Ga0209281_1000004 Ga0209281_1000004856 108
513 3300027111 Ga0209281_1000006 Ga0209281_1000006609 108
514 3300027111 Ga0209281_1000012 Ga0209281_1000012354 108
515 3300027111 Ga0209281_1000024 Ga0209281_100002440 108
516 3300027111 Ga0209281_1000050 Ga0209281_10000506 108
517 3300027111 Ga0209281_1000284 Ga0209281_100028479 108
518 3300027111 Ga0209281_1000616 Ga0209281_10006166 108
519 3300027111 Ga0209281_1001245 Ga0209281_100124511 108
520 3300027111 Ga0209281_1004256 Ga0209281_10042565 108
521 3300027111 Ga0209281_1004368 Ga0209281_10043685 108
522 3300027111 Ga0209281_1056386 Ga0209281_10563862 108
523 3300027312 Ga0209371_1000001 Ga0209371_10000011751 108
524 3300027312 Ga0209371_1000002 Ga0209371_1000002708 108
525 3300027312 Ga0209371_1000060 Ga0209371_1000060140 108
526 3300027312 Ga0209371_1000391 Ga0209371_100039144 108
527 3300027312 Ga0209371_1000885 Ga0209371_100088512 108
528 3300027312 Ga0209371_1002551 Ga0209371_10025517 108
529 3300027312 Ga0209371_1004389 Ga0209371_10043895 108
530 3300027312 Ga0209371_1009310 Ga0209371_10093102 108
531 3300027312 Ga0209371_1014938 Ga0209371_10149382 108
532 3300027312 Ga0209371_1030918 Ga0209371_10309182 108
533 3300027312 Ga0209371_1042276 Ga0209371_10422762 108
534 3300028379 Ga0268266_10003906 Ga0268266_100039063 108
535 3300030500 Ga0268256_1000001 Ga0268256_1000001891 108
536 3300030500 Ga0268256_1000002 Ga0268256_1000002756 108
537 3300030500 Ga0268256_1000084 Ga0268256_100008489 108
538 3300030500 Ga0268256_1000334 Ga0268256_10003342 108
539 3300030500 Ga0268256_1000814 Ga0268256_100081412 108
540 3300030500 Ga0268256_1004131 Ga0268256_10041316 108
541 3300030500 Ga0268256_1006215 Ga0268256_10062156 108
542 3300030500 Ga0268256_1007659 Ga0268256_10076593 108
543 3300030500 Ga0268256_1009843 Ga0268256_10098432 108
544 3300030500 Ga0268256_1035082 Ga0268256_10350821 108
545 3300030500 Ga0268256_1041710 Ga0268256_10417102 108
546 3300039437 Ga0436365_0368505 Ga0436365_0368505_98590_98916 108
547 3300041405 Ga0439438_005486 Ga0439438_005486_4290_4616 108
548 3300041405 Ga0439438_050303 Ga0439438_050303_716_1042 108
549 3300041407 Ga0439447_013432 Ga0439447_013432_1422_1748 108
550 3300041512 Ga0451853_0766941 Ga0451853_0766941_806_1132 108
551 3300042006 Ga0439432_014189 Ga0439432_014189_1316_1642 108
552 3300042006 Ga0439432_019714 Ga0439432_019714_17_343 108
553 3300042006 Ga0439432_039349 Ga0439432_039349_138_464 108
554 3300042010 Ga0439452_000002 Ga0439452_000002_912140_912466 108
555 3300042010 Ga0439452_000016 Ga0439452_000016_171030_171356 108
556 3300042010 Ga0439452_000589 Ga0439452_000589_6917_7243 108
557 3300042010 Ga0439452_000630 Ga0439452_000630_10742_11068 108
558 3300042010 Ga0439452_006391 Ga0439452_006391_1523_1849 108
559 3300042013 Ga0439456_035385 Ga0439456_035385_50_379 108
560 3300044669 Ga0466981_0000007 Ga0466981_0000007_57392_57718 108
561 3300044673 Ga0453683_0000001 Ga0453683_0000001_1128742_1129104 108
562 3300044712 Ga0453684_0011096 Ga0453684_0011096_9347_9709 108
563 3300045051 Ga0451576_0003834 Ga0451576_0003834_12968_13330 108
564 3300046453 Ga0495627_000122 Ga0495627_000122_53129_53455 108
565 3300046458 Ga0495591_000003 Ga0495591_000003_43562_43888 108
566 3300046458 Ga0495591_012950 Ga0495591_012950_950_1276 108
567 3300046460 Ga0495638_0003353 Ga0495638_0003353_11075_11401 108
568 3300046471 Ga0495650_0000005 Ga0495650_0000005_158125_158451 108
569 3300046471 Ga0495650_0000026 Ga0495650_0000026_276395_276721 108
570 3300046471 Ga0495650_0000126 Ga0495650_0000126_70421_70750 108
571 3300046471 Ga0495650_0014597 Ga0495650_0014597_1780_2106 108
572 3300046474 Ga0495605_0092322 Ga0495605_0092322_170_496 108
573 3300046491 Ga0495584_0027500 Ga0495584_0027500_2082_2408 108
574 3300046501 Ga0495607_0010776 Ga0495607_0010776_5590_5916 108
575 3300046507 Ga0495606_0027136 Ga0495606_0027136_1044_1370 108
576 3300046513 Ga0495616_0066086 Ga0495616_0066086_851_1177 108
577 3300046515 Ga0495620_0042291 Ga0495620_0042291_52_378 108
578 3300046519 Ga0495632_0128013 Ga0495632_0128013_241_570 108
579 3300046520 Ga0495637_0049872 Ga0495637_0049872_319_645 108
580 3300046522 Ga0495643_0145935 Ga0495643_0145935_769_1095 108
581 3300046523 Ga0495644_0088424 Ga0495644_0088424_483_809 108
582 3300046524 Ga0495648_0003409 Ga0495648_0003409_7527_7853 108
583 3300046530 Ga0495654_0000029 Ga0495654_0000029_6413_6739 108
584 3300046530 Ga0495654_0001327 Ga0495654_0001327_14458_14784 108
585 3300046530 Ga0495654_0051231 Ga0495654_0051231_1287_1613 108
586 3300046530 Ga0495654_0062308 Ga0495654_0062308_68_397 108
587 3300046530 Ga0495654_0178933 Ga0495654_0178933_450_779 108
588 3300046530 Ga0495654_0192110 Ga0495654_0192110_47_373 108
589 3300046538 Ga0495609_0119899 Ga0495609_0119899_629_958 108
590 3300046542 Ga0495597_0000391 Ga0495597_0000391_24400_24726 108
591 3300046648 Ga0495611_0217285 Ga0495611_0217285_516_842 108
592 3300046660 Ga0495625_0002066 Ga0495625_0002066_7873_8202 108
593 3300046674 Ga0495588_0006516 Ga0495588_0006516_2426_2752 108
594 3300046692 Ga0495671_0005918 Ga0495671_0005918_5174_5500 108
595 3300046694 Ga0495649_0005810 Ga0495649_0005810_5108_5434 108
596 3300046694 Ga0495649_0006838 Ga0495649_0006838_5132_5458 108
597 3300046794 Ga0495589_0000001 Ga0495589_0000001_410027_410353 108
598 3300046794 Ga0495589_0038813 Ga0495589_0038813_1118_1444 108
599 3300046810 Ga0495660_0000014 Ga0495660_0000014_32655_32984 108
600 3300046810 Ga0495660_0000016 Ga0495660_0000016_49207_49533 108
601 3300047320 Ga0495672_0000001 Ga0495672_0000001_321736_322062 108
602 3300047320 Ga0495672_0000034 Ga0495672_0000034_182687_183016 108
603 3300047321 Ga0495676_0474538 Ga0495676_0474538_328_654 108
604 3300047323 Ga0495683_0037674 Ga0495683_0037674_281_607 108
605 3300047323 Ga0495683_0056245 Ga0495683_0056245_1013_1339 108
606 3300047446 Ga0495679_000005 Ga0495679_000005_80889_81218 108
607 3300047446 Ga0495679_007848 Ga0495679_007848_3540_3866 108
608 3300047446 Ga0495679_039852 Ga0495679_039852_723_1049 108
609 3300047446 Ga0495679_042103 Ga0495679_042103_22_348 108
610 3300047446 Ga0495679_045950 Ga0495679_045950_885_1211 108
611 3300047446 Ga0495679_172312 Ga0495679_172312_67_393 108
612 3300047469 Ga0495673_0000007 Ga0495673_0000007_545995_546321 108
613 3300047469 Ga0495673_0000669 Ga0495673_0000669_24477_24803 108
614 3300047470 Ga0495681_0015510 Ga0495681_0015510_1631_1957 108
615 3300047470 Ga0495681_0157616 Ga0495681_0157616_564_893 108
616 3300048903 Ga0496100_0079033 Ga0496100_0079033_265_591 108
617 3300048903 Ga0496100_0624319 Ga0496100_0624319_321_647 108
618 3300048904 Ga0496101_0047858 Ga0496101_0047858_224_550 108
619 3300048906 Ga0496103_0109077 Ga0496103_0109077_995_1321 108
620 3300048907 Ga0496104_0000472 Ga0496104_0000472_12632_12961 108
621 3300048907 Ga0496104_0000944 Ga0496104_0000944_8824_9150 108
622 3300048907 Ga0496104_0110030 Ga0496104_0110030_26_352 108
623 3300048907 Ga0496104_0511132 Ga0496104_0511132_65_391 108
624 3300048908 Ga0496105_0023520 Ga0496105_0023520_1741_2067 108
625 3300048908 Ga0496105_0068515 Ga0496105_0068515_1578_1904 108
626 3300048908 Ga0496105_0477494 Ga0496105_0477494_68_394 108
627 3300048919 Ga0496116_0000001 Ga0496116_0000001_997791_998117 108
628 3300048919 Ga0496116_0000048 Ga0496116_0000048_89057_89386 108
629 3300048919 Ga0496116_0000086 Ga0496116_0000086_189949_190275 108
630 3300048919 Ga0496116_0001038 Ga0496116_0001038_22085_22411 108
631 3300048919 Ga0496116_0011046 Ga0496116_0011046_5055_5381 108
632 3300048919 Ga0496116_0022946 Ga0496116_0022946_1882_2208 108
633 3300048919 Ga0496116_0066577 Ga0496116_0066577_152_478 108
634 3300048919 Ga0496116_0419001 Ga0496116_0419001_104_430 108
635 3300048920 Ga0496117_0000402 Ga0496117_0000402_9425_9751 108
636 3300048920 Ga0496117_0000421 Ga0496117_0000421_941_1267 108
637 3300048920 Ga0496117_0002199 Ga0496117_0002199_1946_2272 108
638 3300048920 Ga0496117_0004197 Ga0496117_0004197_13770_14099 108
639 3300048920 Ga0496117_0004340 Ga0496117_0004340_5632_5958 108
640 3300048920 Ga0496117_0017266 Ga0496117_0017266_26_352 108
641 3300048920 Ga0496117_0025983 Ga0496117_0025983_765_1094 108
642 3300048920 Ga0496117_0033948 Ga0496117_0033948_1902_2228 108
643 3300048920 Ga0496117_0054458 Ga0496117_0054458_820_1146 108
644 3300048920 Ga0496117_0131793 Ga0496117_0131793_170_496 108
645 3300048920 Ga0496117_0275596 Ga0496117_0275596_552_878 108
646 3300048920 Ga0496117_0338434 Ga0496117_0338434_68_394 108
647 3300048920 Ga0496117_0338435 Ga0496117_0338435_68_394 108
648 3300048921 Ga0496118_0000181 Ga0496118_0000181_4147_4476 108
649 3300048921 Ga0496118_0000527 Ga0496118_0000527_7586_7912 108
650 3300048921 Ga0496118_0003080 Ga0496118_0003080_18167_18493 108
651 3300048921 Ga0496118_0006331 Ga0496118_0006331_4229_4558 108
652 3300048921 Ga0496118_0040751 Ga0496118_0040751_1944_2270 108
653 3300048921 Ga0496118_0079267 Ga0496118_0079267_26_352 108
654 3300048921 Ga0496118_0079268 Ga0496118_0079268_26_352 108
655 3300048921 Ga0496118_0208090 Ga0496118_0208090_496_822 108
656 3300048921 Ga0496118_0444039 Ga0496118_0444039_209_535 108
657 3300048921 Ga0496118_0477913 Ga0496118_0477913_89_415 108
658 3300048922 Ga0496119_0000001 Ga0496119_0000001_416522_416848 108
659 3300048922 Ga0496119_0000018 Ga0496119_0000018_82995_83321 108
660 3300048922 Ga0496119_0000802 Ga0496119_0000802_30168_30494 108
661 3300048922 Ga0496119_0002843 Ga0496119_0002843_11282_11608 108
662 3300048922 Ga0496119_0002854 Ga0496119_0002854_2150_2476 108
663 3300048922 Ga0496119_0003871 Ga0496119_0003871_13356_13682 108
664 3300048922 Ga0496119_0005005 Ga0496119_0005005_11117_11443 108
665 3300048922 Ga0496119_0010466 Ga0496119_0010466_6919_7245 108
666 3300048922 Ga0496119_0038420 Ga0496119_0038420_208_534 108
667 3300048922 Ga0496119_0055279 Ga0496119_0055279_1890_2216 108
668 3300048922 Ga0496119_0060228 Ga0496119_0060228_1236_1562 108
669 3300048922 Ga0496119_0198903 Ga0496119_0198903_616_942 108
670 3300048922 Ga0496119_0246525 Ga0496119_0246525_417_746 108
671 3300048923 Ga0496120_0000002 Ga0496120_0000002_252855_253181 108
672 3300048923 Ga0496120_0000091 Ga0496120_0000091_137539_137865 108
673 3300048923 Ga0496120_0000510 Ga0496120_0000510_45223_45549 108
674 3300048923 Ga0496120_0001288 Ga0496120_0001288_4691_5017 108
675 3300048923 Ga0496120_0002365 Ga0496120_0002365_2361_2687 108
676 3300048923 Ga0496120_0003638 Ga0496120_0003638_3636_3962 108
677 3300048923 Ga0496120_0008536 Ga0496120_0008536_6403_6729 108
678 3300048923 Ga0496120_0012388 Ga0496120_0012388_782_1108 108
679 3300048923 Ga0496120_0017903 Ga0496120_0017903_348_674 108
680 3300048923 Ga0496120_0027046 Ga0496120_0027046_3193_3522 108
681 3300048923 Ga0496120_0054056 Ga0496120_0054056_10_339 108
682 3300048923 Ga0496120_0201759 Ga0496120_0201759_151_477 108
683 3300048924 Ga0496121_0000834 Ga0496121_0000834_42355_42681 108
684 3300048924 Ga0496121_0002085 Ga0496121_0002085_11317_11643 108
685 3300048924 Ga0496121_0005969 Ga0496121_0005969_3752_4078 108
686 3300048924 Ga0496121_0008642 Ga0496121_0008642_8034_8360 108
687 3300048924 Ga0496121_0047334 Ga0496121_0047334_3328_3654 108
688 3300048924 Ga0496121_0063003 Ga0496121_0063003_2466_2792 108
689 3300048924 Ga0496121_0305139 Ga0496121_0305139_100_426 108
690 3300048924 Ga0496121_0357499 Ga0496121_0357499_518_844 108
691 3300048925 Ga0496122_0000005 Ga0496122_0000005_544654_544980 108
692 3300048925 Ga0496122_0000086 Ga0496122_0000086_135612_135941 108
693 3300048925 Ga0496122_0000794 Ga0496122_0000794_48959_49285 108
694 3300048925 Ga0496122_0005735 Ga0496122_0005735_7527_7853 108
695 3300048925 Ga0496122_0007911 Ga0496122_0007911_11317_11643 108
696 3300048925 Ga0496122_0013834 Ga0496122_0013834_6840_7166 108
697 3300048925 Ga0496122_0048709 Ga0496122_0048709_859_1185 108
698 3300048925 Ga0496122_0054717 Ga0496122_0054717_89_415 108
699 3300048925 Ga0496122_0065620 Ga0496122_0065620_214_540 108
700 3300048925 Ga0496122_0105389 Ga0496122_0105389_359_685 108
701 3300048925 Ga0496122_0155093 Ga0496122_0155093_1033_1359 108
702 3300048925 Ga0496122_0244229 Ga0496122_0244229_619_945 108
703 3300048925 Ga0496122_0255440 Ga0496122_0255440_503_829 108
704 3300048925 Ga0496122_0354317 Ga0496122_0354317_422_748 108
705 3300048925 Ga0496122_0363090 Ga0496122_0363090_89_415 108
706 3300048925 Ga0496122_0366764 Ga0496122_0366764_122_448 108
707 3300048925 Ga0496122_0597551 Ga0496122_0597551_66_392 108
708 3300048926 Ga0496123_0000008 Ga0496123_0000008_85649_85975 108
709 3300048926 Ga0496123_0000014 Ga0496123_0000014_166040_166366 108
710 3300048926 Ga0496123_0000021 Ga0496123_0000021_135758_136087 108
711 3300048926 Ga0496123_0002908 Ga0496123_0002908_8357_8683 108
712 3300048926 Ga0496123_0002966 Ga0496123_0002966_11014_11340 108
713 3300048926 Ga0496123_0005806 Ga0496123_0005806_5046_5372 108
714 3300048926 Ga0496123_0031774 Ga0496123_0031774_3419_3745 108
715 3300048926 Ga0496123_0033874 Ga0496123_0033874_1572_1898 108
716 3300048926 Ga0496123_0058063 Ga0496123_0058063_2040_2366 108
717 3300048926 Ga0496123_0091818 Ga0496123_0091818_1361_1687 108
718 3300048926 Ga0496123_0100396 Ga0496123_0100396_896_1222 108
719 3300048926 Ga0496123_0301503 Ga0496123_0301503_422_748 108
720 3300048926 Ga0496123_0301505 Ga0496123_0301505_422_748 108
721 3300048926 Ga0496123_0315145 Ga0496123_0315145_326_652 108
722 3300048927 Ga0496124_0000008 Ga0496124_0000008_322295_322621 108
723 3300048927 Ga0496124_0000059 Ga0496124_0000059_189909_190235 108
724 3300048927 Ga0496124_0000092 Ga0496124_0000092_38310_38639 108
725 3300048927 Ga0496124_0000159 Ga0496124_0000159_126277_126603 108
726 3300048927 Ga0496124_0000598 Ga0496124_0000598_7522_7848 108
727 3300048927 Ga0496124_0025533 Ga0496124_0025533_2224_2550 108
728 3300048927 Ga0496124_0061856 Ga0496124_0061856_1603_1929 108
729 3300048927 Ga0496124_0067554 Ga0496124_0067554_1968_2294 108
730 3300048927 Ga0496124_0128053 Ga0496124_0128053_125_451 108
731 3300048927 Ga0496124_0383509 Ga0496124_0383509_558_884 108
732 3300048927 Ga0496124_0610732 Ga0496124_0610732_56_382 108
733 3300048927 Ga0496124_0661727 Ga0496124_0661727_266_592 108
734 3300048927 Ga0496124_0699799 Ga0496124_0699799_87_413 108
735 3300048928 Ga0496125_0000009 Ga0496125_0000009_167054_167380 108
736 3300048928 Ga0496125_0000064 Ga0496125_0000064_32665_32994 108
737 3300048928 Ga0496125_0003474 Ga0496125_0003474_8195_8521 108
738 3300048928 Ga0496125_0004948 Ga0496125_0004948_6741_7067 108
739 3300048928 Ga0496125_0014118 Ga0496125_0014118_3167_3493 108
740 3300048928 Ga0496125_0014493 Ga0496125_0014493_782_1108 108
741 3300048928 Ga0496125_0042534 Ga0496125_0042534_3474_3800 108
742 3300048928 Ga0496125_0118000 Ga0496125_0118000_125_451 108
743 3300048928 Ga0496125_0156711 Ga0496125_0156711_678_1004 108
744 3300048928 Ga0496125_0206470 Ga0496125_0206470_277_603 108
745 3300048928 Ga0496125_0343716 Ga0496125_0343716_116_442 108
746 3300048928 Ga0496125_0350739 Ga0496125_0350739_71_397 108
747 3300048929 Ga0496126_0000229 Ga0496126_0000229_81708_82037 108
748 3300048929 Ga0496126_0000740 Ga0496126_0000740_51281_51607 108
749 3300048929 Ga0496126_0013776 Ga0496126_0013776_5639_5965 108
750 3300048929 Ga0496126_0057224 Ga0496126_0057224_2948_3274 108
751 3300048929 Ga0496126_0092702 Ga0496126_0092702_1628_1954 108
752 3300048929 Ga0496126_0125417 Ga0496126_0125417_614_940 108
753 3300048929 Ga0496126_0166094 Ga0496126_0166094_1175_1501 108
754 3300048929 Ga0496126_0283961 Ga0496126_0283961_676_1002 108
755 3300048929 Ga0496126_0534467 Ga0496126_0534467_479_805 108
756 3300048929 Ga0496126_0942637 Ga0496126_0942637_164_490 108
757 3300048929 Ga0496126_1293392 Ga0496126_1293392_155_481 108
758 3300049459 Ga0495678_000512 Ga0495678_000512_20460_20786 108
759 3300049460 Ga0495682_0000001 Ga0495682_0000001_780475_780801 108
760 3300050491 nmdc:mga00v17_1081_c1 nmdc:mga00v17_1081_c1_9119_9445 108
761 3300050493 nmdc:mga0k408_11532_c1 nmdc:mga0k408_11532_c1_644_970 108
762 3300053126 Ga0500621_000002 Ga0500621_000002_791913_792239 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

41

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.8426 29 108
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8125 32 105
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.8068 29 108
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.8012 32 105
5zcy-assembly1.cif.gz_A crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution 0.7925 31 105
ID Description Score Start End Superfamily
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.9691 29 108 3.30.780.10
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.946 29 108 3.30.780.10
af_A0A5K1K9F4_35_107_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8517 35 96 3.30.780.10
1d1rA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8426 29 108 3.30.780.10
af_Q54WG0_122_207_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8364 33 99 3.30.780.10
ID Description Score Start End GO Terms
AF-J9H2K9-F1-model_v4 Protein containing Translation initiation factor SUI1 domain protein 0.9928 47 100 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A381H2V8-F1-model_v4 deleted 0.98 48 108
AF-A0A381WQ30-F1-model_v4 SUI1 domain-containing protein 0.9694 47 108 GO:0003743
AF-A0A7X7SE84-F1-model_v4 Translation initiation factor 0.9634 36 108 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A3L7X8X7-F1-model_v4 Translation initiation factor 0.9554 31 108 GO:0003743

Feature Viewer

pLDDT pTM Quality
71.7 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map