F479604

General Info

Members Datasets Scaffolds Average Seq Length
761 616 1522 352

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2960584000|2960586386
Length 394
Sequence AEKDRQNVTQANGHKELNFYAKARKSGLPIFAVAPMIDWTDRHYRFFARQLSSHALLYTEMIVADAILRGDREKLLGHDTSEHPFALQLGGSDPAKMAEAARIAEGFGYDEINMNVGCPSDRVQSGTFGACLMQEPALVADCIAAMKAAVKIPVTVKCRIGVDDQDPEVALRDLVQRVKDAGTDAVWVHARKAWLKGLSPRENREIPPLDYGLVHRLKAENANLFIGLNGGLQRLDQALSHLDPLSLPTGGTTGTAAEPACGAPLDGVMLGRAAYHDSGLLTAADGYFVHPLTGAEPMPVDRDGFSDHDHKLSLDFWSGIRDAMADYAAAHIENGGRLIHVTRHMVGLFQGWPGARRYRQILSTEATRKDAGPQVIHAAFDAVFEAVTARQAAE

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
59 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
102 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
103 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
174 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
175 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
176 2509276019 Ensifer aridi TW10 Isolate Nodule
177 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
178 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
179 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
180 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
181 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
182 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
183 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
184 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
185 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
186 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
187 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
188 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
189 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
190 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
191 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
192 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
193 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
194 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
195 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
196 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
197 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
198 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
199 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
200 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
201 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
202 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
203 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
204 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
205 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
206 2516143018 Ensifer sp. BR816 Isolate Nodule
207 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
208 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
209 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
210 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
211 2519899620 Rhizobium sp. Pop5 Isolate Nodule
212 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
213 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
214 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
215 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
216 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
217 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
218 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
219 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
220 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
221 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
222 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
223 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
224 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
225 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
226 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
227 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
228 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
229 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
230 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
231 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
232 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
233 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
234 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
235 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
236 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
237 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
238 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
239 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
240 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
241 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
242 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
243 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
244 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
245 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
246 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
247 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
248 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
249 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
250 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
251 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
252 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
253 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
254 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
255 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
256 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
257 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
258 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
259 2643221557 Ensifer sp. Root558 Isolate Unclassified
260 2643221568 Rhizobium sp. Root564 Isolate Unclassified
261 2643221582 Rhizobium sp. Root651 Isolate Unclassified
262 2643221599 Rhizobium sp. Root708 Isolate Unclassified
263 2643221607 Rhizobium sp. Root73 Isolate Unclassified
264 2643221610 Ensifer sp. Root74 Isolate Unclassified
265 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
266 2643221626 Ensifer sp. Root31 Isolate Unclassified
267 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
268 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
269 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
270 2643221668 Ensifer sp. Root423 Isolate Unclassified
271 2643221675 Ensifer sp. Root1298 Isolate Unclassified
272 2643221680 Ensifer sp. Root1312 Isolate Unclassified
273 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
274 2643221688 Rhizobium sp. Root482 Isolate Unclassified
275 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
276 2643221693 Rhizobium sp. Root491 Isolate Unclassified
277 2643221718 Rhizobium sp. Root268 Isolate Unclassified
278 2643221723 Ensifer sp. Root278 Isolate Unclassified
279 2643221726 Ensifer sp. Root954 Isolate Unclassified
280 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
281 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
282 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
283 2718217927 Rhizobium sp. N324 Isolate Nodule
284 2718218423 Rhizobium sp. N941 Isolate Nodule
285 2721755809 Rhizobium sp. N541 Isolate Nodule
286 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
287 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
288 2738541293 Rhizobium sp. GV031 Isolate Unclassified
289 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
290 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
291 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
292 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
293 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
294 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
295 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
296 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
297 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
298 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
299 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
300 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
301 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
302 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
303 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
304 2791355262 Rhizobium sp. M1 Isolate Nodule
305 2791355263 Rhizobium chutanense C5 Isolate Nodule
306 2791355265 Rhizobium sp. H4 Isolate Nodule
307 2791355266 Rhizobium sp. L43 Isolate Nodule
308 2791355267 Rhizobium sp. L18 Isolate Nodule
309 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
310 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
311 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
312 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
313 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
314 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
315 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
316 2802429633 Rhizobium anhuiense J3 Isolate Nodule
317 2802429634 Rhizobium anhuiense S10 Isolate Nodule
318 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
319 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
320 2802429637 Rhizobium anhuiense C15 Isolate Nodule
321 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
322 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
323 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
324 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
325 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
326 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
327 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
328 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
329 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
330 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
331 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
332 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
333 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
334 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
335 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
336 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
337 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
338 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
339 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
340 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
341 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
342 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
343 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
344 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
345 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
346 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
347 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
348 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
349 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
350 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
351 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
352 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
353 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
354 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
355 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
356 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
357 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
358 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
359 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
360 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
361 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
362 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
363 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
364 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
365 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
366 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
367 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
368 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
369 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
370 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
371 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
372 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
373 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
374 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
375 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
376 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
377 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
378 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
379 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
380 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
381 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
382 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
383 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
384 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
385 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
386 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
387 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
388 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
389 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
390 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
391 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
392 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
393 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
394 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
395 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
396 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
397 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
398 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
399 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
400 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
401 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
402 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
403 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
404 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
405 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
406 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
407 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
408 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
409 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
410 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
411 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
412 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
413 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
414 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
415 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
416 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
417 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
418 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
419 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
420 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
421 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
422 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
423 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
424 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
425 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
426 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
427 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
428 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
429 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
430 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
431 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
432 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
433 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
434 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
435 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
436 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
437 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
438 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
439 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
440 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
441 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
442 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
443 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
444 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
445 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
446 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
447 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
448 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
449 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
450 2936381700 Rhizobium chutanense C16 Isolate Unclassified
451 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
452 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
453 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
454 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
455 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
456 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
457 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
458 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
459 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
460 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
461 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
462 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
463 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
464 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
465 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
466 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
467 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
468 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
469 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
470 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
471 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
472 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
473 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
474 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
475 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
476 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
477 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
478 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
479 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
480 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
481 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
482 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
483 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
484 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
485 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
486 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
487 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
488 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
489 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
490 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
491 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
492 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
493 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
494 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
495 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
496 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
497 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
498 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
499 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
500 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
501 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
502 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
503 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
504 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
505 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
506 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
507 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
508 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
509 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
510 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
511 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
512 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
513 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
514 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
515 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
516 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
517 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
518 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
519 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
520 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
521 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
522 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
523 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
524 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
525 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
526 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
527 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
528 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
529 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
530 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
531 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
532 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
533 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
534 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
535 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
536 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
537 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
538 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
539 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
540 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
541 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
542 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
543 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
544 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
545 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
546 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
547 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
548 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
549 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
550 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
551 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
552 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
553 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
554 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
555 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
556 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
557 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
558 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
559 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
560 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
561 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
562 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
563 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
564 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
565 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
566 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
567 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
568 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
569 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
570 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
571 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
572 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
573 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
574 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
575 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
576 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
577 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
578 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
579 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
580 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
581 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
582 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
583 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
584 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
585 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
586 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
587 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
588 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
589 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
590 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
591 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
592 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
593 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
594 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
595 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
596 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
597 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
598 8005275841 Rhizobium sp. N4311 Isolate Nodule
599 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
600 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
601 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
602 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
603 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
604 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
605 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
606 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
607 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
608 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
609 8018176218 Rhizobium sp. N122 Isolate Nodule
610 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
611 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
612 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
613 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
614 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
615 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
616 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.39
Metatranscriptomes 0
Isolates 58.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 17.08
Nodule 43.5
Rhizoplane 1.97
Rhizosphere 14.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000001 3300002704 Bacteria 354543
2 JGI25156J39149_1000001 3300002705 Bacteria 354557
3 JGI25162J39368_1000209 3300002737 Bacteria 61889
4 JGI25162J39368_1000245 3300002737 Bacteria 54142
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25157J39369_1000030 3300002741 Bacteria 146112
7 JGI25152J39213_1000570 3300002773 Bacteria 20104
8 JGI25152J39213_1003955 3300002773 Bacteria 4841
9 JGI25150J39212_1000326 3300002774 Bacteria 23479
10 JGI25159J45721_1000078 3300002987 Bacteria 46708
11 JGI25151J46595_10000083 3300003187 Bacteria 130658
12 JGI25151J46595_10002582 3300003187 Bacteria 10692
13 JGI25151J46595_10007593 3300003187 Bacteria 5293
14 JGI25151J46595_10010545 3300003187 Bacteria 4284
15 JGI25151J46595_10010647 3300003187 Bacteria 4259
16 JGI25165J46597_1000302 3300003214 Bacteria 61889
17 JGI25165J46597_1000682 3300003214 Bacteria 27253
18 JGI25165J46597_1003085 3300003214 Bacteria 4487
19 JGI25153J46596_10000377 3300003215 Bacteria 30499
20 JGI25153J46596_10013638 3300003215 Bacteria 3423
21 rootH2_10034311 3300003320 Bacteria 4946
22 rootH1_10103562 3300003323 Bacteria 1528
23 JGI25160J50197_1000087 3300003354 Bacteria 93379
24 JGI25160J50197_1000216 3300003354 Bacteria 46708
25 JGI25160J50197_1005579 3300003354 Bacteria 5214
26 JGI25161J50226_1000066 3300003374 Bacteria 94505
27 JGI25161J50226_1001830 3300003374 Bacteria 5952
28 JGI25161J50226_1009054 3300003374 Bacteria 1461
29 Ga0055542_1000709 3300003762 Bacteria 26239
30 Ga0055526_1000117 3300003771 Bacteria 69620
31 Ga0055526_1003426 3300003771 Bacteria 10069
32 Ga0055526_1004404 3300003771 Bacteria 8475
33 Ga0055524_1001754 3300003775 Bacteria 11976
34 Ga0055524_1014729 3300003775 Bacteria 2883
35 Ga0055536_1017185 3300003781 Bacteria 2379
36 Ga0055536_1028050 3300003781 Bacteria 1542
37 Ga0055528_1000114 3300003790 Bacteria 64549
38 Ga0055528_1000167 3300003790 Bacteria 55317
39 Ga0055528_1007679 3300003790 Bacteria 4730
40 Ga0055540_1000169 3300003792 Bacteria 64875
41 Ga0055531_10027964 3300003794 Bacteria 1958
42 Ga0058692_1000350 3300003856 Bacteria 22460
43 JGI25405J52794_10003103 3300003911 Bacteria 2892
44 Ga0055543_1000068 3300004625 Bacteria 94795
45 Ga0055543_1000301 3300004625 Bacteria 35189
46 Ga0055543_1001221 3300004625 Bacteria 10779
47 Ga0065165_1000717 3300005262 Bacteria 46746
48 Ga0065165_1000839 3300005262 Bacteria 40355
49 Ga0081455_10077993 3300005937 Bacteria 2723
50 Ga0075365_10050411 3300006038 Bacteria 2746
51 Ga0075365_10064624 3300006038 Bacteria 2452
52 Ga0075365_10104227 3300006038 Bacteria 1945
53 Ga0075365_10124940 3300006038 Bacteria 1777
54 Ga0075368_10000570 3300006042 Bacteria 11059
55 Ga0075363_100015974 3300006048 Bacteria 3701
56 Ga0075364_10000320 3300006051 Bacteria 23654
57 Ga0075364_10019878 3300006051 Bacteria 4221
58 Ga0075364_10164949 3300006051 Bacteria 1496
59 Ga0075432_10004763 3300006058 Bacteria 4618
60 Ga0075362_10002333 3300006177 Bacteria 6349
61 Ga0075362_10063851 3300006177 Bacteria 1670
62 Ga0075367_10003748 3300006178 Bacteria 7317
63 Ga0075367_10005658 3300006178 Bacteria 6236
64 Ga0075367_10077484 3300006178 Bacteria 2007
65 Ga0075369_10114473 3300006186 Bacteria 1217
66 Ga0075427_10000354 3300006194 Bacteria 5065
67 Ga0075366_10017393 3300006195 Bacteria 4137
68 Ga0075370_10040876 3300006353 Bacteria 2617
69 Ga0079104_1000610 3300006946 Bacteria 35237
70 Ga0099826_10000091 3300006948 Bacteria 44824
71 Ga0099826_10012587 3300006948 Bacteria 6373
72 Ga0105240_10000005 3300009093 Bacteria 702630
73 Ga0114129_10157162 3300009147 Bacteria 3108
74 Ga0105237_10000766 3300009545 Bacteria 44044
75 Ga0123341_1000013 3300009765 Bacteria 97696
76 Ga0105239_10001069 3300010375 Bacteria 38061
77 Ga0157322_1000008 3300012490 Bacteria 3456
78 Ga0157373_10029403 3300013100 Bacteria 3958
79 Ga0157371_10000015 3300013102 Bacteria 339838
80 Ga0157370_10000046 3300013104 Bacteria 125612
81 Ga0157370_10000402 3300013104 Bacteria 54601
82 Ga0157369_10577541 3300013105 Bacteria 1161
83 Ga0171463_1003 3300013249 Bacteria 695693
84 Ga0182007_10010646 3300015262 Bacteria 3622
85 Ga0182005_1008709 3300015265 Bacteria 2979
86 Ga0183363_1199 3300015690 Bacteria 12353
87 Ga0214544_1001682 3300021320 Bacteria 46508
88 Ga0214542_1001614 3300021321 Bacteria 46380
89 Ga0214542_1033805 3300021321 Bacteria 1699
90 Ga0214543_1000011 3300021327 Bacteria 344093
91 Ga0214543_1001395 3300021327 Bacteria 46435
92 Ga0228711_1003475 3300022739 Bacteria 24453
93 Ga0228710_1003691 3300022740 Bacteria 24269
94 Ga0209435_100012 3300025206 Bacteria 401621
95 Ga0209436_101634 3300025208 Bacteria 7491
96 Ga0209437_100047 3300025233 Bacteria 405163
97 Ga0209437_100165 3300025233 Bacteria 145009
98 Ga0207425_1000024 3300025245 Bacteria 328978
99 Ga0207425_1002291 3300025245 Bacteria 6876
100 Ga0209646_1000026 3300025246 Bacteria 401621
101 Ga0209026_1000014 3300025250 Bacteria 401621
102 Ga0209677_100656 3300025253 Bacteria 18202
103 Ga0209148_1000072 3300025254 Bacteria 325292
104 Ga0209148_1003612 3300025254 Bacteria 4153
105 Ga0209759_1000012 3300025256 Bacteria 401621
106 Ga0209129_1000184 3300025258 Bacteria 87102
107 Ga0209129_1002082 3300025258 Bacteria 10276
108 Ga0209233_1000048 3300025261 Bacteria 453669
109 Ga0209233_1000069 3300025261 Bacteria 367639
110 Ga0209233_1000195 3300025261 Bacteria 125863
111 Ga0209455_1000153 3300025272 Bacteria 124411
112 Ga0209673_1000013 3300025273 Bacteria 571633
113 Ga0209673_1000522 3300025273 Bacteria 62876
114 Ga0209130_1000021 3300025284 Bacteria 374278
115 Ga0209130_1000029 3300025284 Bacteria 323399
116 Ga0209676_1009103 3300025292 Bacteria 4332
117 Ga0209676_1016785 3300025292 Bacteria 2625
118 Ga0209025_1000050 3300025294 Bacteria 331531
119 Ga0209025_1000119 3300025294 Bacteria 210606
120 Ga0209025_1000959 3300025294 Bacteria 43491
121 Ga0209025_1001166 3300025294 Bacteria 37252
122 Ga0209564_1000118 3300025295 Bacteria 205431
123 Ga0209564_1000264 3300025295 Bacteria 111404
124 Ga0209564_1000278 3300025295 Bacteria 105405
125 Ga0209758_1000083 3300025297 Bacteria 257283
126 Ga0209758_1003856 3300025297 Bacteria 13150
127 Ga0209758_1006383 3300025297 Bacteria 8513
128 Ga0209050_1002815 3300025298 Bacteria 13889
129 Ga0209050_1008064 3300025298 Bacteria 5724
130 Ga0209256_1000042 3300025299 Bacteria 341821
131 Ga0209256_1000160 3300025299 Bacteria 138781
132 Ga0209256_1000369 3300025299 Bacteria 72557
133 Ga0209256_1003234 3300025299 Bacteria 11741
134 Ga0207426_1000010 3300025302 Bacteria 796003
135 Ga0207426_1000039 3300025302 Bacteria 439937
136 Ga0207426_1000074 3300025302 Bacteria 323399
137 Ga0207426_1000952 3300025302 Bacteria 28571
138 Ga0209051_1000418 3300025303 Bacteria 58817
139 Ga0209051_1000602 3300025303 Bacteria 42068
140 Ga0209051_1001051 3300025303 Bacteria 25929
141 Ga0209257_1002124 3300025304 Bacteria 20695
142 Ga0207695_10000011 3300025913 Bacteria 910221
143 Ga0207671_10000241 3300025914 Bacteria 81847
144 Ga0207660_10210256 3300025917 Bacteria 1523
145 Ga0207652_10089898 3300025921 Bacteria 2697
146 Ga0207669_10243497 3300025937 Bacteria 1334
147 Ga0207678_10166477 3300026067 Bacteria 1882
148 Ga0207698_10293486 3300026142 Bacteria 1510
149 Ga0209281_1000036 3300027111 Bacteria 369415
150 Ga0209281_1000047 3300027111 Bacteria 326514
151 Ga0209281_1000663 3300027111 Bacteria 36448
152 Ga0209371_1000021 3300027312 Bacteria 555864
153 Ga0209371_1000229 3300027312 Bacteria 71827
154 Ga0209371_1004936 3300027312 Bacteria 5543
155 Ga0209282_1000189 3300027666 Bacteria 32962
156 Ga0209282_1000251 3300027666 Bacteria 26915
157 Ga0209282_1010352 3300027666 Bacteria 5900
158 Ga0209813_10000886 3300027866 Bacteria 6746
159 Ga0307515_10000023 3300028794 Bacteria 400846
160 Ga0307515_10013391 3300028794 Bacteria 15338
161 Ga0307515_10021119 3300028794 Bacteria 11562
162 Ga0268256_1000020 3300030500 Bacteria 557873
163 Ga0268256_1000373 3300030500 Bacteria 42542
164 Ga0265316_10066476 3300031344 Bacteria 2790
165 Ga0307513_10024206 3300031456 Bacteria 7069
166 Ga0307408_100294249 3300031548 Bacteria 1357
167 Ga0307405_10000348 3300031731 Bacteria 17330
168 Ga0307412_10028524 3300031911 Bacteria 3493
169 Ga0315914_1003371 3300031967 Bacteria 24290
170 Ga0315913_1001807 3300033430 Bacteria 24300
171 Ga0315915_1000701 3300033464 Bacteria 36541
172 Ga0373957_0016309 3300035120 Bacteria 2569
173 Ga0373955_0098879 3300035172 Bacteria 1672
174 Ga0373937_0090041 3300036401 Bacteria 2841
175 Ga0439436_0001137 3300041404 Bacteria 7543
176 Ga0439453_0005142 3300041408 Bacteria 1980
177 Ga0439465_0004861 3300041413 Bacteria 4319
178 Ga0451833_0218675 3300041491 Bacteria 4345
179 Ga0451837_1842558 3300041494 Bacteria 1724
180 Ga0451839_0147971 3300041496 Bacteria 3881
181 Ga0451841_1335495 3300041498 Bacteria 1109
182 Ga0451845_0289917 3300041501 Bacteria 1440
183 Ga0451843_0219396 3300041509 Bacteria 2617
184 Ga0451853_0630583 3300041512 Bacteria 5151
185 Ga0439449_0002497 3300042007 Bacteria 7192
186 Ga0439434_0004762 3300042435 Bacteria 3976
187 Ga0466963_0020042 3300044694 Bacteria 4203
188 Ga0466970_0000517 3300044765 Bacteria 19001
189 Ga0466958_0147918 3300045836 Bacteria 1481
190 Ga0495638_0048096 3300046460 Bacteria 2671
191 Ga0495585_0018099 3300046492 Bacteria 4065
192 Ga0495585_0088403 3300046492 Bacteria 1671
193 Ga0495583_0019846 3300046506 Bacteria 3498
194 Ga0495606_0074020 3300046507 Bacteria 2135
195 Ga0495610_0002852 3300046512 Bacteria 14064
196 Ga0495610_0158384 3300046512 Bacteria 959
197 Ga0495632_0003230 3300046519 Bacteria 11699
198 Ga0495648_0091983 3300046524 Bacteria 1695
199 Ga0495654_0000090 3300046530 Bacteria 101947
200 Ga0495668_0022829 3300046616 Bacteria 3574
201 Ga0495668_0197732 3300046616 Bacteria 1101
202 Ga0495625_0049063 3300046660 Bacteria 3035
203 Ga0495588_0004086 3300046674 Bacteria 6424
204 Ga0495623_0072290 3300046679 Bacteria 2145
205 Ga0495669_0026128 3300046684 Bacteria 2551
206 Ga0495680_0034245 3300047322 Bacteria 4105
207 Ga0495686_0003897 3300047472 Bacteria 12591
208 Ga0496102_0002015 3300048905 Bacteria 17545
209 Ga0496102_0312402 3300048905 Bacteria 1481
210 Ga0496103_0006503 3300048906 Bacteria 6970
211 Ga0496111_0001186 3300048914 Bacteria 14513
212 Ga0496116_0000232 3300048919 Bacteria 103015
213 Ga0496116_0003963 3300048919 Bacteria 14378
214 Ga0496116_0020582 3300048919 Bacteria 5007
215 Ga0496116_0047118 3300048919 Bacteria 2904
216 Ga0496116_0060552 3300048919 Bacteria 2455
217 Ga0496116_0075121 3300048919 Bacteria 2122
218 Ga0496116_0110360 3300048919 Bacteria 1618
219 Ga0496116_0213203 3300048919 Bacteria 998
220 Ga0496117_0000002 3300048920 Bacteria 2483758
221 Ga0496117_0000353 3300048920 Bacteria 81061
222 Ga0496117_0006313 3300048920 Bacteria 12058
223 Ga0496117_0022734 3300048920 Bacteria 5022
224 Ga0496117_0047515 3300048920 Bacteria 3076
225 Ga0496117_0080269 3300048920 Bacteria 2146
226 Ga0496118_0000204 3300048921 Bacteria 104260
227 Ga0496118_0004322 3300048921 Bacteria 16944
228 Ga0496118_0029743 3300048921 Bacteria 4575
229 Ga0496118_0251778 3300048921 Bacteria 1003
230 Ga0496119_0004804 3300048922 Bacteria 13257
231 Ga0496119_0027046 3300048922 Bacteria 3957
232 Ga0496119_0085433 3300048922 Bacteria 1806
233 Ga0496120_0000941 3300048923 Bacteria 40051
234 Ga0496120_0029811 3300048923 Bacteria 3326
235 Ga0496120_0041496 3300048923 Bacteria 2694
236 Ga0496120_0126071 3300048923 Bacteria 1317
237 Ga0496121_0000001 3300048924 Bacteria 1830318
238 Ga0496121_0000363 3300048924 Bacteria 93101
239 Ga0496121_0000378 3300048924 Bacteria 91381
240 Ga0496121_0005960 3300048924 Bacteria 15402
241 Ga0496121_0015433 3300048924 Bacteria 8006
242 Ga0496121_0023601 3300048924 Bacteria 5915
243 Ga0496121_0051243 3300048924 Bacteria 3478
244 Ga0496121_0140036 3300048924 Bacteria 1796
245 Ga0496121_0222826 3300048924 Bacteria 1327
246 Ga0496122_0000001 3300048925 Bacteria 1827766
247 Ga0496122_0000369 3300048925 Bacteria 96672
248 Ga0496122_0000525 3300048925 Bacteria 79294
249 Ga0496122_0004665 3300048925 Bacteria 16828
250 Ga0496122_0008819 3300048925 Bacteria 10769
251 Ga0496122_0065087 3300048925 Bacteria 2646
252 Ga0496122_0068927 3300048925 Bacteria 2536
253 Ga0496122_0076731 3300048925 Bacteria 2350
254 Ga0496122_0091404 3300048925 Bacteria 2072
255 Ga0496123_0000001 3300048926 Bacteria 1831497
256 Ga0496123_0000054 3300048926 Bacteria 234046
257 Ga0496123_0001014 3300048926 Bacteria 42878
258 Ga0496123_0002174 3300048926 Bacteria 25015
259 Ga0496123_0002482 3300048926 Bacteria 22770
260 Ga0496123_0008137 3300048926 Bacteria 9683
261 Ga0496123_0029313 3300048926 Bacteria 4055
262 Ga0496123_0029387 3300048926 Bacteria 4047
263 Ga0496123_0059809 3300048926 Bacteria 2460
264 Ga0496124_0001936 3300048927 Bacteria 28381
265 Ga0496124_0002257 3300048927 Bacteria 25595
266 Ga0496124_0008516 3300048927 Bacteria 10707
267 Ga0496124_0010848 3300048927 Bacteria 9175
268 Ga0496124_0035788 3300048927 Bacteria 4339
269 Ga0496124_0050923 3300048927 Bacteria 3525
270 Ga0496124_0074321 3300048927 Bacteria 2809
271 Ga0496124_0119928 3300048927 Bacteria 2103
272 Ga0496124_0130373 3300048927 Bacteria 1998
273 Ga0496124_0135766 3300048927 Bacteria 1948
274 Ga0496124_0210582 3300048927 Bacteria 1471
275 Ga0496125_0000001 3300048928 Bacteria 1766138
276 Ga0496125_0002081 3300048928 Bacteria 26974
277 Ga0496125_0002169 3300048928 Bacteria 26237
278 Ga0496125_0027952 3300048928 Bacteria 5101
279 Ga0496126_0000703 3300048929 Bacteria 61100
280 Ga0496126_0001019 3300048929 Bacteria 47578
281 Ga0496126_0112022 3300048929 Bacteria 2376
282 Ga0501031_0017765 3300049568 Bacteria 4626
283 Ga0501032_0038346 3300049569 Bacteria 3264
284 Ga0501035_0066035 3300049822 Bacteria 3211
285 nmdc:mga03683_10605_c1 3300050489 Bacteria 3310
286 nmdc:mga03n38_1786_c1 3300050490 Bacteria 6376
287 nmdc:mga00v17_17321_c1 3300050491 Bacteria 4077
288 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
289 nmdc:mga00v17_728_c1 3300050491 Bacteria 17963
290 nmdc:mga0yw44_46067_c1 3300050492 Bacteria 2617
291 nmdc:mga0yw44_6287_c1 3300050492 Bacteria 5723
292 nmdc:mga0yw44_7509_c1 3300050492 Bacteria 5369
293 nmdc:mga0k408_109317_c1 3300050493 Bacteria 1634
294 nmdc:mga0k408_2763_c1 3300050493 Bacteria 9330
295 nmdc:mga06z11_25776_c1 3300050494 Bacteria 2791
296 nmdc:mga06z11_71290_c1 3300050494 Bacteria 1839
297 nmdc:mga06z11_81340_c1 3300050494 Bacteria 1739
298 nmdc:mga07m45_57692_c1 3300050496 Bacteria 2196
299 nmdc:mga06r32_147_c1 3300050510 Bacteria 53171
300 nmdc:mga0sz30_215_c2 3300050516 Bacteria 16156
301 nmdc:mga0sz30_4761_c1 3300050516 Bacteria 4930
302 Ga0495601_0008944 3300053077 Bacteria 5912
303 Ga0495612_0038278 3300053078 Bacteria 1949
304 Ga0500560_060633 3300053107 Bacteria 1232
305 Ga0500572_002929 3300053111 Bacteria 3999
306 Ga0500618_000604 3300053125 Bacteria 22060
307 Ga0500618_000659 3300053125 Bacteria 20570
308 Ga0500573_0000259 3300053140 Bacteria 22228
309 Ga0500573_0027912 3300053140 Bacteria 3247
310 Ga0500616_0046898 3300053153 Bacteria 2296
311 Ga0500627_0121278 3300053158 Bacteria 1179
312 Ga0500627_0128901 3300053158 Bacteria 1142
313 Ga0500634_0054543 3300053161 Bacteria 2141
314 Ga0500636_0000153 3300053177 Bacteria 35853
315 Ga0500636_0001102 3300053177 Bacteria 14459
316 2960586386 2960584000 Bacteria 6864594
317 2509111849 2508501122 Bacteria 6292184
318 2509114284 2508501123 Bacteria 6283661
319 2509375770 2509276019 Bacteria 6802256
320 2509392384 2509276021 Bacteria 7634384
321 2509446680 2509276033 Bacteria 7180565
322 2510133612 2510065019 Bacteria 6903379
323 2510303309 2510065057 Bacteria 6649661
324 2510895015 2510461076 Bacteria 8618824
325 2511135214 2510917022 Bacteria 6504556
326 2511174765 2510917026 Bacteria 7046020
327 2511389645 2511231027 Bacteria 5013807
328 2511501879 2511231052 Bacteria 6974333
329 2512533310 2512047086 Bacteria 6850303
330 2512971194 2512875026 Bacteria 6861065
331 2513573874 2513237084 Bacteria 7231967
332 2513584734 2513237086 Bacteria 7265287
333 2513606164 2513237089 Bacteria 6553624
334 2513615443 2513237091 Bacteria 6900273
335 2513629769 2513237093 Bacteria 7545552
336 2513708408 2513237103 Bacteria 7647401
337 2513881231 2513237140 Bacteria 7076289
338 2513905627 2513237143 Bacteria 6664116
339 2513988204 2513237156 Bacteria 6402557
340 2513997087 2513237159 Bacteria 6810126
341 2514008766 2513237160 Bacteria 6650282
342 2514022455 2513237162 Bacteria 7468464
343 2514589812 2513237351 Bacteria 6968952
344 2515112605 2515075009 Bacteria 7288508
345 2515608737 2515154107 Bacteria 6795637
346 2515634229 2515154113 Bacteria 7807172
347 2515640099 2515154114 Bacteria 7848616
348 2515655706 2515154116 Bacteria 7552979
349 2516209670 2516143018 Bacteria 6951533
350 2516893174 2516653046 Bacteria 6989037
351 2517036339 2516653077 Bacteria 7555578
352 2517407055 2517287029 Bacteria 6905599
353 2517569925 2517487022 Bacteria 7227575
354 2520378545 2519899620 Bacteria 6499161
355 2524448855 2524023207 Bacteria 6813453
356 2524460174 2524023209 Bacteria 6679728
357 2530645787 2529292951 Bacteria 6916614
358 2537877732 2537561587 Bacteria 5425293
359 2551674923 2551306084 Bacteria 8942552
360 2551680177 2551306084 Bacteria 8942552
361 2551689088 2551306085 Bacteria 7347181
362 2551696284 2551306086 Bacteria 6843938
363 2551714285 2551306089 Bacteria 7162724
364 2551723684 2551306090 Bacteria 7953713
365 2551728316 2551306091 Bacteria 7086830
366 2551731859 2551306092 Bacteria 6992595
367 2551745132 2551306093 Bacteria 7064773
368 2554247604 2554235003 Bacteria 5877155
369 2558868038 2558860100 Bacteria 8458965
370 2559294735 2558860242 Bacteria 5568029
371 2561466432 2558860983 Bacteria 4133860
372 2585166113 2582581283 Bacteria 6030556
373 2585200275 2582581294 Bacteria 6626667
374 2585229905 2582581299 Bacteria 6518058
375 2585254861 2582581304 Bacteria 5831370
376 2585267686 2582581306 Bacteria 6450535
377 2585270954 2582581307 Bacteria 6597605
378 2585277303 2582581308 Bacteria 7413247
379 2585323687 2582581315 Bacteria 7318924
380 2585331660 2582581316 Bacteria 7774528
381 2585386745 2582581865 Bacteria 6644329
382 2585396651 2582581866 Bacteria 6859583
383 2585533962 2585427527 Bacteria 7273426
384 2585537842 2585427528 Bacteria 6842387
385 2585552187 2585427530 Bacteria 7383882
386 2585558678 2585427531 Bacteria 6992870
387 2585835791 2585427593 Bacteria 7141551
388 2585846820 2585427594 Bacteria 6180594
389 2585904352 2585427609 Bacteria 6667127
390 2585995976 2585427633 Bacteria 6413184
391 2586000544 2585427634 Bacteria 6455027
392 2587980531 2585428125 Bacteria 6662905
393 2599331565 2599185156 Bacteria 5403036
394 2599604003 2599185210 Bacteria 5624189
395 2599720965 2599185236 Bacteria 6875203
396 2600193113 2599185352 Bacteria 7228948
397 2600375717 2600254933 Bacteria 4750527
398 2601608269 2600255279 Bacteria 5605316
399 2601745043 2600255308 Bacteria 5611129
400 2616308680 2615840626 Bacteria 7921970
401 2616557014 2615840698 Bacteria 7319877
402 2617385778 2617270742 Bacteria 6808054
403 2643803611 2643221557 Bacteria 7184309
404 2643857655 2643221568 Bacteria 5187270
405 2643919226 2643221582 Bacteria 5804683
406 2644003862 2643221599 Bacteria 6292121
407 2644050755 2643221607 Bacteria 6314006
408 2644067579 2643221610 Bacteria 7480339
409 2644132279 2643221623 Bacteria 5239945
410 2644148604 2643221626 Bacteria 8069654
411 2644192682 2643221634 Bacteria 6705461
412 2644205229 2643221636 Bacteria 6583769
413 2644210243 2643221637 Bacteria 5345260
414 2644375258 2643221668 Bacteria 7306521
415 2644418632 2643221675 Bacteria 7473456
416 2644451999 2643221680 Bacteria 7473610
417 2644483673 2643221686 Bacteria 6310811
418 2644491784 2643221688 Bacteria 5260751
419 2644501741 2643221689 Bacteria 6042950
420 2644522130 2643221693 Bacteria 5513853
421 2644653795 2643221718 Bacteria 5345506
422 2644676599 2643221723 Bacteria 7095460
423 2644690761 2643221726 Bacteria 7455827
424 2657681169 2657244999 Bacteria 5946535
425 2671111621 2667528174 Bacteria 6435400
426 2692315866 2690316117 Bacteria 6800650
427 2719386024 2718217927 Bacteria 6972593
428 2721399806 2718218423 Bacteria 6438183
429 2724038619 2721755809 Bacteria 6438790
430 2724110446 2721755823 Bacteria 6752556
431 2725947983 2724679232 Bacteria 7646494
432 2738804218 2738541293 Bacteria 7065685
433 2738946031 2738541317 Bacteria 5340176
434 2739032498 2738541333 Bacteria 7106503
435 2753461844 2751185821 Bacteria 6189929
436 2765464842 2765235802 Bacteria 5618596
437 2766066825 2765235942 Bacteria 7445910
438 2770195233 2767802442 Bacteria 5747986
439 2776270866 2775506902 Bacteria 6208009
440 2776282756 2775506904 Bacteria 5954060
441 2776913515 2775507049 Bacteria 6284736
442 2778174114 2775507266 Bacteria 7392367
443 2792581781 2791355082 Bacteria 5973319
444 2792620145 2791355091 Bacteria 6135441
445 2792626437 2791355092 Bacteria 6248105
446 2792639379 2791355094 Bacteria 7011481
447 2793312505 2791355259 Bacteria 7254731
448 2793337251 2791355262 Bacteria 6774204
449 2793344072 2791355263 Bacteria 6872478
450 2793357069 2791355265 Bacteria 6539969
451 2793360660 2791355266 Bacteria 7116587
452 2793367032 2791355267 Bacteria 7222458
453 2802719422 2802428858 Bacteria 6636079
454 2802726981 2802428859 Bacteria 6667919
455 2802734470 2802428860 Bacteria 6525526
456 2802740727 2802428861 Bacteria 6534206
457 2802745265 2802428862 Bacteria 6633353
458 2802752721 2802428863 Bacteria 6410669
459 2804752368 2802429268 Bacteria 6094027
460 2806043473 2802429633 Bacteria 7341974
461 2806050595 2802429634 Bacteria 7083200
462 2806057412 2802429635 Bacteria 7650140
463 2806064791 2802429636 Bacteria 7597525
464 2806072058 2802429637 Bacteria 7067217
465 2808985492 2808606387 Bacteria 5697198
466 2819559967 2818991439 Bacteria 6907412
467 2819608963 2818991448 Bacteria 6772224
468 2819637809 2818991453 Bacteria 7181617
469 2819684739 2818991461 Bacteria 7026071
470 2821129493 2821123053 Bacteria 7836056
471 2837653534 2837651117 Bacteria 3772164
472 2837680023 2837678835 Bacteria 5252418
473 2838026174 2838022645 Bacteria 6494267
474 2838029992 2838029111 Bacteria 6603031
475 2838043679 2838042994 Bacteria 6046894
476 2838079610 2838074704 Bacteria 6785777
477 2838676340 2838675328 Bacteria 4909118
478 2838681929 2838680041 Bacteria 6545511
479 2838696499 2838694306 Bacteria 6853137
480 2838710260 2838707686 Bacteria 6619912
481 2838715223 2838714209 Bacteria 5525906
482 2838720977 2838719591 Bacteria 5523910
483 2838725981 2838724970 Bacteria 4908691
484 2838738475 2838736955 Bacteria 5760694
485 2839994763 2839993093 Bacteria 5512535
486 2840767629 2840764183 Bacteria 6358399
487 2841841156 2841840854 Bacteria 5761912
488 2841847935 2841846520 Bacteria 5345850
489 2841859513 2841859092 Bacteria 5436171
490 2842078435 2842077413 Bacteria 6508645
491 2842114093 2842110456 Bacteria 7656360
492 2842119056 2842118031 Bacteria 7033875
493 2842126035 2842124991 Bacteria 5346824
494 2842131234 2842130223 Bacteria 4909145
495 2842140934 2842140634 Bacteria 5759631
496 2842153596 2842152218 Bacteria 4908957
497 2842171466 2842170452 Bacteria 5525737
498 2842177216 2842175837 Bacteria 4908771
499 2842188331 2842187318 Bacteria 5524014
500 2842201893 2842198810 Bacteria 6608673
501 2842205789 2842205361 Bacteria 6340321
502 2842212642 2842211629 Bacteria 5523832
503 2842217563 2842217011 Bacteria 7497767
504 2842225739 2842224351 Bacteria 5524473
505 2842239672 2842237096 Bacteria 6620661
506 2842279246 2842278818 Bacteria 6340002
507 2842292097 2842291075 Bacteria 7076806
508 2842301934 2842298080 Bacteria 6123127
509 2842357600 2842357229 Bacteria 6485165
510 2842364828 2842363717 Bacteria 6844742
511 2842372494 2842370503 Bacteria 7038661
512 2842378493 2842377471 Bacteria 7140707
513 2842385566 2842384541 Bacteria 7057858
514 2842398942 2842395702 Bacteria 6780583
515 2842476723 2842475841 Bacteria 6603183
516 2842484737 2842482326 Bacteria 7212537
517 2842503520 2842502639 Bacteria 6604161
518 2842511326 2842509118 Bacteria 6850950
519 2842516298 2842515876 Bacteria 5436280
520 2842522670 2842521101 Bacteria 6569494
521 2842871740 2842871566 Bacteria 4827117
522 2842923963 2842922631 Bacteria 5824079
523 2847419069 2847417321 Bacteria 6913799
524 2848994100 2848992105 Bacteria 6810864
525 2850081102 2850079185 Bacteria 6848280
526 2854919299 2854916844 Bacteria 5725939
527 2855825972 2855825444 Bacteria 6785811
528 2855841318 2855839649 Bacteria 7135830
529 2855876745 2855872281 Bacteria 6964271
530 2857520086 2857516855 Bacteria 7787325
531 2857535105 2857531043 Bacteria 6754041
532 2858802299 2858800743 Bacteria 6603254
533 2871471037 2871466892 Bacteria 6923287
534 2891373148 2891373044 Bacteria 5202277
535 2894656199 2894652903 Bacteria 4587256
536 2896390847 2896384573 Bacteria 7700774
537 2899796310 2899792073 Bacteria 4926588
538 2899849478 2899845264 Bacteria 5672268
539 2904580832 2904578770 Bacteria 5302906
540 2906383453 2906378014 Bacteria 6911440
541 2913300854 2913295892 Bacteria 6333755
542 2913311386 2913308742 Bacteria 5350706
543 2915981921 2915980308 Bacteria 6624279
544 2915998875 2915993759 Bacteria 7016183
545 2916002210 2916000859 Bacteria 6865702
546 2916010312 2916007675 Bacteria 6898660
547 2916018278 2916014648 Bacteria 6946486
548 2916028167 2916021584 Bacteria 6854472
549 2916030050 2916028427 Bacteria 6748433
550 2916036462 2916035215 Bacteria 6755766
551 2916043126 2916041962 Bacteria 6820487
552 2916052261 2916048683 Bacteria 6543552
553 2916061463 2916055098 Bacteria 6758838
554 2916068527 2916061851 Bacteria 6737736
555 2916072976 2916068649 Bacteria 6943657
556 2916080848 2916076590 Bacteria 6596108
557 2919115315 2919114240 Bacteria 5700270
558 2919121454 2919119836 Bacteria 5208557
559 2919167835 2919166419 Bacteria 4952238
560 2919174985 2919171160 Bacteria 6499771
561 2920766110 2920760137 Bacteria 7427611
562 2920824702 2920822456 Bacteria 6897201
563 2921211555 2921208531 Bacteria 6745326
564 2921239995 2921237296 Bacteria 6876710
565 2921244577 2921244191 Bacteria 6568419
566 2921251275 2921250672 Bacteria 6677771
567 2921258643 2921257292 Bacteria 6808382
568 2921270807 2921263974 Bacteria 6864552
569 2921285461 2921282425 Bacteria 6826397
570 2921292680 2921289301 Bacteria 7316391
571 2921298483 2921296804 Bacteria 7176999
572 2924144898 2924144063 Bacteria 6883928
573 2924153322 2924150972 Bacteria 7169444
574 2924160748 2924158325 Bacteria 7188855
575 2924168730 2924165586 Bacteria 7260590
576 2924173622 2924172951 Bacteria 6749356
577 2924181183 2924179722 Bacteria 6843264
578 2924188461 2924186466 Bacteria 6876637
579 2924200444 2924193448 Bacteria 6955718
580 2924206879 2924200457 Bacteria 6757188
581 2924213956 2924207177 Bacteria 6917007
582 2924214970 2924214083 Bacteria 7080103
583 2924222970 2924221636 Bacteria 7113495
584 2924229989 2924228884 Bacteria 6633132
585 2926756361 2926754445 Bacteria 5964435
586 2926760583 2926760298 Bacteria 5505990
587 2928523677 2928521798 Bacteria 4960112
588 2929140303 2929138655 Bacteria 5810547
589 2933008239 2933006813 Bacteria 4912075
590 2933013060 2933011516 Bacteria 5439334
591 2933590189 2933586486 Bacteria 7667493
592 2933597745 2933594066 Bacteria 5594265
593 2935897644 2935894831 Bacteria 6620579
594 2936387557 2936381700 Bacteria 7006523
595 2937002080 2936996657 Bacteria 6298727
596 2937005948 2937002841 Bacteria 6934057
597 2937016337 2937009748 Bacteria 6746052
598 2937018617 2937016420 Bacteria 6782579
599 2937028951 2937023124 Bacteria 6815156
600 2937033504 2937029754 Bacteria 6424026
601 2937042721 2937036028 Bacteria 6846469
602 2937044361 2937042894 Bacteria 6741576
603 2937051081 2937049772 Bacteria 6757901
604 2937058535 2937056579 Bacteria 7107896
605 2937066424 2937063883 Bacteria 7199456
606 2937073745 2937071275 Bacteria 6984483
607 2937079704 2937078374 Bacteria 6610289
608 2937086827 2937084907 Bacteria 6618516
609 2937095921 2937091812 Bacteria 6979387
610 2937100609 2937098957 Bacteria 7249374
611 2937108157 2937106411 Bacteria 6947143
612 2937119009 2937113482 Bacteria 6505872
613 2937124171 2937119839 Bacteria 6597547
614 2937127373 2937126314 Bacteria 6771275
615 2941503567 2941499720 Bacteria 7599444
616 2954015960 2954011201 Bacteria 4762601
617 2957381320 2957375807 Bacteria 6425588
618 2957388464 2957382221 Bacteria 6737050
619 2957394768 2957388812 Bacteria 6778072
620 2957398291 2957395598 Bacteria 6822399
621 2957403041 2957402308 Bacteria 6741770
622 2957414730 2957408893 Bacteria 6558585
623 2957416003 2957415311 Bacteria 6991633
624 2957427766 2957422303 Bacteria 7172205
625 2957431810 2957430029 Bacteria 7022557
626 2957445739 2957443900 Bacteria 6869977
627 2957451412 2957450854 Bacteria 6765715
628 2957458662 2957457609 Bacteria 6967680
629 2957471093 2957464669 Bacteria 6568877
630 2957472060 2957471148 Bacteria 6797643
631 2957484445 2957478035 Bacteria 6756658
632 2957489096 2957484790 Bacteria 6703082
633 2957492011 2957491536 Bacteria 6695180
634 2957503706 2957498199 Bacteria 7126688
635 2957507105 2957505466 Bacteria 7253085
636 2960592749 2960591022 Bacteria 6622873
637 2960598516 2960597568 Bacteria 6550735
638 2960604766 2960603979 Bacteria 6898737
639 2960615138 2960610863 Bacteria 6691244
640 2960620029 2960617483 Bacteria 6727748
641 2960626900 2960624210 Bacteria 6875384
642 2960637033 2960631154 Bacteria 6732508
643 2960640841 2960637947 Bacteria 7296468
644 2960646274 2960645483 Bacteria 7211087
645 2960660240 2960652885 Bacteria 7083688
646 2960662143 2960660292 Bacteria 7041660
647 2960673773 2960667422 Bacteria 6763020
648 2960676998 2960674078 Bacteria 6609048
649 2960681828 2960680706 Bacteria 6624464
650 2960689046 2960687367 Bacteria 6535474
651 2960695868 2960693952 Bacteria 6749742
652 2964610421 2964607997 Bacteria 7101408
653 2964616964 2964615318 Bacteria 6809089
654 2964624702 2964621998 Bacteria 6834995
655 2964635509 2964628898 Bacteria 7083044
656 2964640930 2964636051 Bacteria 7091832
657 2964649023 2964643177 Bacteria 6820887
658 2964651802 2964649959 Bacteria 6675118
659 2964661026 2964656573 Bacteria 7100150
660 2964670797 2964663802 Bacteria 7019362
661 2964681102 2964678106 Bacteria 6792020
662 2964686277 2964685014 Bacteria 6839111
663 2964693698 2964691889 Bacteria 6802758
664 2964699840 2964698721 Bacteria 6765331
665 2964706101 2964705432 Bacteria 7114648
666 2964714767 2964712639 Bacteria 6695970
667 2964722349 2964719344 Bacteria 7286602
668 2967666561 2967664464 Bacteria 6948836
669 2967672344 2967671571 Bacteria 7021409
670 2967680677 2967678726 Bacteria 7264382
671 2967687771 2967686174 Bacteria 6678622
672 2967695270 2967693043 Bacteria 6804451
673 2967704207 2967699805 Bacteria 6854538
674 2967708222 2967706974 Bacteria 7186053
675 2967716646 2967714385 Bacteria 7000047
676 2967722689 2967721400 Bacteria 7073753
677 2967735133 2967728569 Bacteria 6641507
678 2967736845 2967735183 Bacteria 6827012
679 2967746377 2967742019 Bacteria 6794534
680 2967753245 2967748971 Bacteria 6733771
681 2967758728 2967755722 Bacteria 6814706
682 2967770956 2967769361 Bacteria 6587838
683 2967778376 2967775926 Bacteria 6738189
684 2970026534 2970019648 Bacteria 7072033
685 2970027840 2970026789 Bacteria 6785236
686 2970038179 2970033650 Bacteria 7118744
687 2970042727 2970040964 Bacteria 6731123
688 2970048130 2970047711 Bacteria 7088379
689 2970061201 2970054988 Bacteria 6611507
690 2970067328 2970061556 Bacteria 7099761
691 2970073085 2970068827 Bacteria 7123112
692 2970082713 2970076120 Bacteria 6697332
693 2970083725 2970082768 Bacteria 6183754
694 2970089281 2970088815 Bacteria 6933825
695 2970096777 2970095765 Bacteria 6936963
696 2970107478 2970102677 Bacteria 6812532
697 2970116086 2970109326 Bacteria 6863976
698 2970122181 2970116247 Bacteria 6501857
699 2970129205 2970122695 Bacteria 6625855
700 2970131668 2970129317 Bacteria 6806560
701 2970138881 2970136068 Bacteria 7207982
702 2970149657 2970143518 Bacteria 6446480
703 2970151419 2970149975 Bacteria 6779706
704 2970161585 2970156795 Bacteria 7168044
705 2970170377 2970164137 Bacteria 6861252
706 2970172853 2970170962 Bacteria 6876229
707 2970179005 2970177841 Bacteria 6768001
708 2970187357 2970184632 Bacteria 7054431
709 2970192263 2970191845 Bacteria 7032787
710 2977522418 2977516862 Bacteria 6940108
711 2977524365 2977523885 Bacteria 6960446
712 2977537114 2977530762 Bacteria 6951399
713 2977544342 2977537788 Bacteria 6929320
714 2977546309 2977544691 Bacteria 6875412
715 2977556415 2977551784 Bacteria 7125765
716 2977560902 2977558990 Bacteria 6863948
717 2977572646 2977565890 Bacteria 6901543
718 2977579602 2977572785 Bacteria 6763888
719 2977580158 2977579622 Bacteria 6772100
720 2978974285 2978969890 Bacteria 5400756
721 2979094137 2979089926 Bacteria 5670289
722 2979098482 2979095461 Bacteria 5669583
723 2979106099 2979100975 Bacteria 5423623
724 2984521527 2984518228 Bacteria 5277463
725 2984540821 2984537506 Bacteria 5277481
726 2984589627 2984587000 Bacteria 5263363
727 2984603089 2984601300 Bacteria 5455244
728 2989349400 2989349275 Bacteria 6349068
729 2989775812 2989771324 Bacteria 5605128
730 3002144482 3002141150 Bacteria 5254435
731 3003933767 3003930520 Bacteria 5667563
732 3005420004 3005416602 Bacteria 7064308
733 3005454316 3005452660 Bacteria 5889319
734 639648843 639633055 Bacteria 7751309
735 643825955 643692032 Bacteria 6891900
736 648740636 648276728 Bacteria 6968865
737 648742007 648276728 Bacteria 6968865
738 650739939 650716007 Bacteria 5573770
739 8002286315 8002285264 Bacteria 6717907
740 8003570988 8003570095 Bacteria 5747666
741 8003993827 8003992118 Bacteria 7266902
742 8004001290 8003999396 Bacteria 7063185
743 8005280811 8005275841 Bacteria 6929066
744 8005316955 8005314921 Bacteria 7072929
745 8005463279 8005460587 Bacteria 7157962
746 8005485247 8005484373 Bacteria 6297373
747 8005557396 8005556819 Bacteria 6908598
748 8005574555 8005570704 Bacteria 6957481
749 8005649768 8005645114 Bacteria 6950293
750 8005659479 8005658619 Bacteria 4500593
751 8005683085 8005682033 Bacteria 6726518
752 8005696593 8005695170 Bacteria 6912330
753 8018166480 8018163183 Bacteria 7277977
754 8018178770 8018176218 Bacteria 6896178
755 8024483237 8024479707 Bacteria 6954785
756 8046770432 8046767195 Bacteria 7547379
757 8049294943 8049293176 Bacteria 6128433
758 8054462320 8054460903 Bacteria 4872905
759 8055435059 8055431914 Bacteria 4551896
760 8056376869 8056375014 Bacteria 7006639
761 8057874729 8057874678 Bacteria 7494653
762 JGI25155J39150_1000001
763 JGI25156J39149_1000001
764 JGI25162J39368_1000209
765 JGI25162J39368_1000245
766 JGI25154J39366_1000011
767 JGI25157J39369_1000030
768 JGI25152J39213_1000570
769 JGI25152J39213_1003955
770 JGI25150J39212_1000326
771 JGI25159J45721_1000078
772 JGI25151J46595_10000083
773 JGI25151J46595_10002582
774 JGI25151J46595_10007593
775 JGI25151J46595_10010545
776 JGI25151J46595_10010647
777 JGI25165J46597_1000302
778 JGI25165J46597_1000682
779 JGI25165J46597_1003085
780 JGI25153J46596_10000377
781 JGI25153J46596_10013638
782 rootH2_10034311
783 rootH1_10103562
784 JGI25160J50197_1000087
785 JGI25160J50197_1000216
786 JGI25160J50197_1005579
787 JGI25161J50226_1000066
788 JGI25161J50226_1001830
789 JGI25161J50226_1009054
790 Ga0055542_1000709
791 Ga0055526_1000117
792 Ga0055526_1003426
793 Ga0055526_1004404
794 Ga0055524_1001754
795 Ga0055524_1014729
796 Ga0055536_1017185
797 Ga0055536_1028050
798 Ga0055528_1000114
799 Ga0055528_1000167
800 Ga0055528_1007679
801 Ga0055540_1000169
802 Ga0055531_10027964
803 Ga0058692_1000350
804 JGI25405J52794_10003103
805 Ga0055543_1000068
806 Ga0055543_1000301
807 Ga0055543_1001221
808 Ga0065165_1000717
809 Ga0065165_1000839
810 Ga0081455_10077993
811 Ga0075365_10050411
812 Ga0075365_10064624
813 Ga0075365_10104227
814 Ga0075365_10124940
815 Ga0075368_10000570
816 Ga0075363_100015974
817 Ga0075364_10000320
818 Ga0075364_10019878
819 Ga0075364_10164949
820 Ga0075432_10004763
821 Ga0075362_10002333
822 Ga0075362_10063851
823 Ga0075367_10003748
824 Ga0075367_10005658
825 Ga0075367_10077484
826 Ga0075369_10114473
827 Ga0075427_10000354
828 Ga0075366_10017393
829 Ga0075370_10040876
830 Ga0079104_1000610
831 Ga0099826_10000091
832 Ga0099826_10012587
833 Ga0105240_10000005
834 Ga0114129_10157162
835 Ga0105237_10000766
836 Ga0123341_1000013
837 Ga0105239_10001069
838 Ga0157322_1000008
839 Ga0157373_10029403
840 Ga0157371_10000015
841 Ga0157370_10000046
842 Ga0157370_10000402
843 Ga0157369_10577541
844 Ga0171463_1003
845 Ga0182007_10010646
846 Ga0182005_1008709
847 Ga0183363_1199
848 Ga0214544_1001682
849 Ga0214542_1001614
850 Ga0214542_1033805
851 Ga0214543_1000011
852 Ga0214543_1001395
853 Ga0228711_1003475
854 Ga0228710_1003691
855 Ga0209435_100012
856 Ga0209436_101634
857 Ga0209437_100047
858 Ga0209437_100165
859 Ga0207425_1000024
860 Ga0207425_1002291
861 Ga0209646_1000026
862 Ga0209026_1000014
863 Ga0209677_100656
864 Ga0209148_1000072
865 Ga0209148_1003612
866 Ga0209759_1000012
867 Ga0209129_1000184
868 Ga0209129_1002082
869 Ga0209233_1000048
870 Ga0209233_1000069
871 Ga0209233_1000195
872 Ga0209455_1000153
873 Ga0209673_1000013
874 Ga0209673_1000522
875 Ga0209130_1000021
876 Ga0209130_1000029
877 Ga0209676_1009103
878 Ga0209676_1016785
879 Ga0209025_1000050
880 Ga0209025_1000119
881 Ga0209025_1000959
882 Ga0209025_1001166
883 Ga0209564_1000118
884 Ga0209564_1000264
885 Ga0209564_1000278
886 Ga0209758_1000083
887 Ga0209758_1003856
888 Ga0209758_1006383
889 Ga0209050_1002815
890 Ga0209050_1008064
891 Ga0209256_1000042
892 Ga0209256_1000160
893 Ga0209256_1000369
894 Ga0209256_1003234
895 Ga0207426_1000010
896 Ga0207426_1000039
897 Ga0207426_1000074
898 Ga0207426_1000952
899 Ga0209051_1000418
900 Ga0209051_1000602
901 Ga0209051_1001051
902 Ga0209257_1002124
903 Ga0207695_10000011
904 Ga0207671_10000241
905 Ga0207660_10210256
906 Ga0207652_10089898
907 Ga0207669_10243497
908 Ga0207678_10166477
909 Ga0207698_10293486
910 Ga0209281_1000036
911 Ga0209281_1000047
912 Ga0209281_1000663
913 Ga0209371_1000021
914 Ga0209371_1000229
915 Ga0209371_1004936
916 Ga0209282_1000189
917 Ga0209282_1000251
918 Ga0209282_1010352
919 Ga0209813_10000886
920 Ga0307515_10000023
921 Ga0307515_10013391
922 Ga0307515_10021119
923 Ga0268256_1000020
924 Ga0268256_1000373
925 Ga0265316_10066476
926 Ga0307513_10024206
927 Ga0307408_100294249
928 Ga0307405_10000348
929 Ga0307412_10028524
930 Ga0315914_1003371
931 Ga0315913_1001807
932 Ga0315915_1000701
933 Ga0373957_0016309
934 Ga0373955_0098879
935 Ga0373937_0090041
936 Ga0439436_0001137
937 Ga0439453_0005142
938 Ga0439465_0004861
939 Ga0451833_0218675
940 Ga0451837_1842558
941 Ga0451839_0147971
942 Ga0451841_1335495
943 Ga0451845_0289917
944 Ga0451843_0219396
945 Ga0451853_0630583
946 Ga0439449_0002497
947 Ga0439434_0004762
948 Ga0466963_0020042
949 Ga0466970_0000517
950 Ga0466958_0147918
951 Ga0495638_0048096
952 Ga0495585_0018099
953 Ga0495585_0088403
954 Ga0495583_0019846
955 Ga0495606_0074020
956 Ga0495610_0002852
957 Ga0495610_0158384
958 Ga0495632_0003230
959 Ga0495648_0091983
960 Ga0495654_0000090
961 Ga0495668_0022829
962 Ga0495668_0197732
963 Ga0495625_0049063
964 Ga0495588_0004086
965 Ga0495623_0072290
966 Ga0495669_0026128
967 Ga0495680_0034245
968 Ga0495686_0003897
969 Ga0496102_0002015
970 Ga0496102_0312402
971 Ga0496103_0006503
972 Ga0496111_0001186
973 Ga0496116_0000232
974 Ga0496116_0003963
975 Ga0496116_0020582
976 Ga0496116_0047118
977 Ga0496116_0060552
978 Ga0496116_0075121
979 Ga0496116_0110360
980 Ga0496116_0213203
981 Ga0496117_0000002
982 Ga0496117_0000353
983 Ga0496117_0006313
984 Ga0496117_0022734
985 Ga0496117_0047515
986 Ga0496117_0080269
987 Ga0496118_0000204
988 Ga0496118_0004322
989 Ga0496118_0029743
990 Ga0496118_0251778
991 Ga0496119_0004804
992 Ga0496119_0027046
993 Ga0496119_0085433
994 Ga0496120_0000941
995 Ga0496120_0029811
996 Ga0496120_0041496
997 Ga0496120_0126071
998 Ga0496121_0000001
999 Ga0496121_0000363
1000 Ga0496121_0000378
1001 Ga0496121_0005960
1002 Ga0496121_0015433
1003 Ga0496121_0023601
1004 Ga0496121_0051243
1005 Ga0496121_0140036
1006 Ga0496121_0222826
1007 Ga0496122_0000001
1008 Ga0496122_0000369
1009 Ga0496122_0000525
1010 Ga0496122_0004665
1011 Ga0496122_0008819
1012 Ga0496122_0065087
1013 Ga0496122_0068927
1014 Ga0496122_0076731
1015 Ga0496122_0091404
1016 Ga0496123_0000001
1017 Ga0496123_0000054
1018 Ga0496123_0001014
1019 Ga0496123_0002174
1020 Ga0496123_0002482
1021 Ga0496123_0008137
1022 Ga0496123_0029313
1023 Ga0496123_0029387
1024 Ga0496123_0059809
1025 Ga0496124_0001936
1026 Ga0496124_0002257
1027 Ga0496124_0008516
1028 Ga0496124_0010848
1029 Ga0496124_0035788
1030 Ga0496124_0050923
1031 Ga0496124_0074321
1032 Ga0496124_0119928
1033 Ga0496124_0130373
1034 Ga0496124_0135766
1035 Ga0496124_0210582
1036 Ga0496125_0000001
1037 Ga0496125_0002081
1038 Ga0496125_0002169
1039 Ga0496125_0027952
1040 Ga0496126_0000703
1041 Ga0496126_0001019
1042 Ga0496126_0112022
1043 Ga0501031_0017765
1044 Ga0501032_0038346
1045 Ga0501035_0066035
1046 nmdc:mga03683_10605_c1
1047 nmdc:mga03n38_1786_c1
1048 nmdc:mga00v17_17321_c1
1049 nmdc:mga00v17_6_c1
1050 nmdc:mga00v17_728_c1
1051 nmdc:mga0yw44_46067_c1
1052 nmdc:mga0yw44_6287_c1
1053 nmdc:mga0yw44_7509_c1
1054 nmdc:mga0k408_109317_c1
1055 nmdc:mga0k408_2763_c1
1056 nmdc:mga06z11_25776_c1
1057 nmdc:mga06z11_71290_c1
1058 nmdc:mga06z11_81340_c1
1059 nmdc:mga07m45_57692_c1
1060 nmdc:mga06r32_147_c1
1061 nmdc:mga0sz30_215_c2
1062 nmdc:mga0sz30_4761_c1
1063 Ga0495601_0008944
1064 Ga0495612_0038278
1065 Ga0500560_060633
1066 Ga0500572_002929
1067 Ga0500618_000604
1068 Ga0500618_000659
1069 Ga0500573_0000259
1070 Ga0500573_0027912
1071 Ga0500616_0046898
1072 Ga0500627_0121278
1073 Ga0500627_0128901
1074 Ga0500634_0054543
1075 Ga0500636_0000153
1076 Ga0500636_0001102
1077 2960586386
1078 2509111849
1079 2509114284
1080 2509375770
1081 2509392384
1082 2509446680
1083 2510133612
1084 2510303309
1085 2510895015
1086 2511135214
1087 2511174765
1088 2511389645
1089 2511501879
1090 2512533310
1091 2512971194
1092 2513573874
1093 2513584734
1094 2513606164
1095 2513615443
1096 2513629769
1097 2513708408
1098 2513881231
1099 2513905627
1100 2513988204
1101 2513997087
1102 2514008766
1103 2514022455
1104 2514589812
1105 2515112605
1106 2515608737
1107 2515634229
1108 2515640099
1109 2515655706
1110 2516209670
1111 2516893174
1112 2517036339
1113 2517407055
1114 2517569925
1115 2520378545
1116 2524448855
1117 2524460174
1118 2530645787
1119 2537877732
1120 2551674923
1121 2551680177
1122 2551689088
1123 2551696284
1124 2551714285
1125 2551723684
1126 2551728316
1127 2551731859
1128 2551745132
1129 2554247604
1130 2558868038
1131 2559294735
1132 2561466432
1133 2585166113
1134 2585200275
1135 2585229905
1136 2585254861
1137 2585267686
1138 2585270954
1139 2585277303
1140 2585323687
1141 2585331660
1142 2585386745
1143 2585396651
1144 2585533962
1145 2585537842
1146 2585552187
1147 2585558678
1148 2585835791
1149 2585846820
1150 2585904352
1151 2585995976
1152 2586000544
1153 2587980531
1154 2599331565
1155 2599604003
1156 2599720965
1157 2600193113
1158 2600375717
1159 2601608269
1160 2601745043
1161 2616308680
1162 2616557014
1163 2617385778
1164 2643803611
1165 2643857655
1166 2643919226
1167 2644003862
1168 2644050755
1169 2644067579
1170 2644132279
1171 2644148604
1172 2644192682
1173 2644205229
1174 2644210243
1175 2644375258
1176 2644418632
1177 2644451999
1178 2644483673
1179 2644491784
1180 2644501741
1181 2644522130
1182 2644653795
1183 2644676599
1184 2644690761
1185 2657681169
1186 2671111621
1187 2692315866
1188 2719386024
1189 2721399806
1190 2724038619
1191 2724110446
1192 2725947983
1193 2738804218
1194 2738946031
1195 2739032498
1196 2753461844
1197 2765464842
1198 2766066825
1199 2770195233
1200 2776270866
1201 2776282756
1202 2776913515
1203 2778174114
1204 2792581781
1205 2792620145
1206 2792626437
1207 2792639379
1208 2793312505
1209 2793337251
1210 2793344072
1211 2793357069
1212 2793360660
1213 2793367032
1214 2802719422
1215 2802726981
1216 2802734470
1217 2802740727
1218 2802745265
1219 2802752721
1220 2804752368
1221 2806043473
1222 2806050595
1223 2806057412
1224 2806064791
1225 2806072058
1226 2808985492
1227 2819559967
1228 2819608963
1229 2819637809
1230 2819684739
1231 2821129493
1232 2837653534
1233 2837680023
1234 2838026174
1235 2838029992
1236 2838043679
1237 2838079610
1238 2838676340
1239 2838681929
1240 2838696499
1241 2838710260
1242 2838715223
1243 2838720977
1244 2838725981
1245 2838738475
1246 2839994763
1247 2840767629
1248 2841841156
1249 2841847935
1250 2841859513
1251 2842078435
1252 2842114093
1253 2842119056
1254 2842126035
1255 2842131234
1256 2842140934
1257 2842153596
1258 2842171466
1259 2842177216
1260 2842188331
1261 2842201893
1262 2842205789
1263 2842212642
1264 2842217563
1265 2842225739
1266 2842239672
1267 2842279246
1268 2842292097
1269 2842301934
1270 2842357600
1271 2842364828
1272 2842372494
1273 2842378493
1274 2842385566
1275 2842398942
1276 2842476723
1277 2842484737
1278 2842503520
1279 2842511326
1280 2842516298
1281 2842522670
1282 2842871740
1283 2842923963
1284 2847419069
1285 2848994100
1286 2850081102
1287 2854919299
1288 2855825972
1289 2855841318
1290 2855876745
1291 2857520086
1292 2857535105
1293 2858802299
1294 2871471037
1295 2891373148
1296 2894656199
1297 2896390847
1298 2899796310
1299 2899849478
1300 2904580832
1301 2906383453
1302 2913300854
1303 2913311386
1304 2915981921
1305 2915998875
1306 2916002210
1307 2916010312
1308 2916018278
1309 2916028167
1310 2916030050
1311 2916036462
1312 2916043126
1313 2916052261
1314 2916061463
1315 2916068527
1316 2916072976
1317 2916080848
1318 2919115315
1319 2919121454
1320 2919167835
1321 2919174985
1322 2920766110
1323 2920824702
1324 2921211555
1325 2921239995
1326 2921244577
1327 2921251275
1328 2921258643
1329 2921270807
1330 2921285461
1331 2921292680
1332 2921298483
1333 2924144898
1334 2924153322
1335 2924160748
1336 2924168730
1337 2924173622
1338 2924181183
1339 2924188461
1340 2924200444
1341 2924206879
1342 2924213956
1343 2924214970
1344 2924222970
1345 2924229989
1346 2926756361
1347 2926760583
1348 2928523677
1349 2929140303
1350 2933008239
1351 2933013060
1352 2933590189
1353 2933597745
1354 2935897644
1355 2936387557
1356 2937002080
1357 2937005948
1358 2937016337
1359 2937018617
1360 2937028951
1361 2937033504
1362 2937042721
1363 2937044361
1364 2937051081
1365 2937058535
1366 2937066424
1367 2937073745
1368 2937079704
1369 2937086827
1370 2937095921
1371 2937100609
1372 2937108157
1373 2937119009
1374 2937124171
1375 2937127373
1376 2941503567
1377 2954015960
1378 2957381320
1379 2957388464
1380 2957394768
1381 2957398291
1382 2957403041
1383 2957414730
1384 2957416003
1385 2957427766
1386 2957431810
1387 2957445739
1388 2957451412
1389 2957458662
1390 2957471093
1391 2957472060
1392 2957484445
1393 2957489096
1394 2957492011
1395 2957503706
1396 2957507105
1397 2960592749
1398 2960598516
1399 2960604766
1400 2960615138
1401 2960620029
1402 2960626900
1403 2960637033
1404 2960640841
1405 2960646274
1406 2960660240
1407 2960662143
1408 2960673773
1409 2960676998
1410 2960681828
1411 2960689046
1412 2960695868
1413 2964610421
1414 2964616964
1415 2964624702
1416 2964635509
1417 2964640930
1418 2964649023
1419 2964651802
1420 2964661026
1421 2964670797
1422 2964681102
1423 2964686277
1424 2964693698
1425 2964699840
1426 2964706101
1427 2964714767
1428 2964722349
1429 2967666561
1430 2967672344
1431 2967680677
1432 2967687771
1433 2967695270
1434 2967704207
1435 2967708222
1436 2967716646
1437 2967722689
1438 2967735133
1439 2967736845
1440 2967746377
1441 2967753245
1442 2967758728
1443 2967770956
1444 2967778376
1445 2970026534
1446 2970027840
1447 2970038179
1448 2970042727
1449 2970048130
1450 2970061201
1451 2970067328
1452 2970073085
1453 2970082713
1454 2970083725
1455 2970089281
1456 2970096777
1457 2970107478
1458 2970116086
1459 2970122181
1460 2970129205
1461 2970131668
1462 2970138881
1463 2970149657
1464 2970151419
1465 2970161585
1466 2970170377
1467 2970172853
1468 2970179005
1469 2970187357
1470 2970192263
1471 2977522418
1472 2977524365
1473 2977537114
1474 2977544342
1475 2977546309
1476 2977556415
1477 2977560902
1478 2977572646
1479 2977579602
1480 2977580158
1481 2978974285
1482 2979094137
1483 2979098482
1484 2979106099
1485 2984521527
1486 2984540821
1487 2984589627
1488 2984603089
1489 2989349400
1490 2989775812
1491 3002144482
1492 3003933767
1493 3005420004
1494 3005454316
1495 639648843
1496 643825955
1497 648740636
1498 648742007
1499 650739939
1500 8002286315
1501 8003570988
1502 8003993827
1503 8004001290
1504 8005280811
1505 8005316955
1506 8005463279
1507 8005485247
1508 8005557396
1509 8005574555
1510 8005649768
1511 8005659479
1512 8005683085
1513 8005696593
1514 8018166480
1515 8018178770
1516 8024483237
1517 8046770432
1518 8049294943
1519 8054462320
1520 8055435059
1521 8056376869
1522 8057874729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01207

Dus

Dihydrouridine synthase (Dus)

32

384

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b0u-assembly2.cif.gz_Y trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment 0.9681 11 322
3b0p-assembly1.cif.gz_A trna-dihydrouridine synthase from thermus thermophilus 0.9623 11 322
3b0u-assembly2.cif.gz_Y trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment 0.9438 11 322
3b0p-assembly1.cif.gz_A trna-dihydrouridine synthase from thermus thermophilus 0.9226 11 322
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.7752 13 323
ID Description Score Start End Superfamily
3b0uX01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9699 11 249 3.20.20.70
af_A0A1D6EEF2_139_379_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9669 11 240 3.20.20.70
af_Q8I2W5_196_470_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9537 11 251 3.20.20.70
3b0uX01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9503 11 249 3.20.20.70
af_A0A1D6EEF2_139_379_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9199 11 240 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3B8WBM6-F1-model_v4 tRNA dihydrouridine(20/20a) synthase DusA 0.9906 153 237 GO:0000049
GO:0017150
AF-A0A1R3TAF7-F1-model_v4 tRNA-dihydrouridine(20/20a) synthase (EC 1.3.1.91) (U20-specific dihydrouridine synthase) (U20-specific Dus) (tRNA-dihydrouridine synthase A) 0.9899 1 333 GO:0000049
GO:0010181
GO:0050660
GO:0102264
GO:0102266
AF-A0A528CVE7-F1-model_v4 tRNA dihydrouridine(20/20a) synthase DusA 0.989 147 247 GO:0000049
GO:0017150
AF-A0A529ZMS9-F1-model_v4 deleted 0.9828 219 334
AF-A0A531MII3-F1-model_v4 tRNA dihydrouridine(20/20a) synthase DusA (EC 1.3.1.-, EC 1.3.1.91) 0.9817 61 328 GO:0000049
GO:0050660
GO:0102264

Map