F479551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 225 | 760 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0032271|Ga0496110_0032271_1483_1752 |
| Length | 80 |
| Sequence | MNAPFQPGTVSLDQLELGTKARVASIDWNGLDEGEACRLQHFPLHLGPFGRDPIAIRVGRMTVAIRRKHASAIRVVPLSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 176 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 177 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 225 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0 |
| Rhizoplane | 6.32 |
| Rhizosphere | 92.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004116 | 3300001915 | Bacteria | 3293 |
| 2 | JGI24740J21852_10006636 | 3300001979 | Bacteria | 4771 |
| 3 | JGI24740J21852_10044450 | 3300001979 | Bacteria | 1318 |
| 4 | JGI24740J21852_10111174 | 3300001979 | Bacteria | 691 |
| 5 | JGI24737J22298_10178200 | 3300001990 | Bacteria | 627 |
| 6 | JGI24735J21928_10024566 | 3300002067 | Bacteria | 1822 |
| 7 | JGI24738J21930_10069572 | 3300002075 | Bacteria | 728 |
| 8 | JGI24034J26672_10051999 | 3300002239 | Bacteria | 706 |
| 9 | Ga0065712_10305370 | 3300005290 | Bacteria | 853 |
| 10 | Ga0065715_10412033 | 3300005293 | Bacteria | 868 |
| 11 | Ga0070658_10001056 | 3300005327 | Bacteria | 23556 |
| 12 | Ga0070658_10064186 | 3300005327 | Bacteria | 2995 |
| 13 | Ga0070658_10092954 | 3300005327 | Bacteria | 2488 |
| 14 | Ga0070658_10234519 | 3300005327 | Bacteria | 1554 |
| 15 | Ga0070658_10659939 | 3300005327 | Bacteria | 907 |
| 16 | Ga0070658_11051967 | 3300005327 | Bacteria | 708 |
| 17 | Ga0070676_10014314 | 3300005328 | Bacteria | 4360 |
| 18 | Ga0070676_10021737 | 3300005328 | Bacteria | 3593 |
| 19 | Ga0070683_100001823 | 3300005329 | Bacteria | 16621 |
| 20 | Ga0070690_100624028 | 3300005330 | Bacteria | 821 |
| 21 | Ga0070670_100022194 | 3300005331 | Bacteria | 5463 |
| 22 | Ga0070670_100029461 | 3300005331 | Bacteria | 4726 |
| 23 | Ga0070670_100041338 | 3300005331 | Bacteria | 3963 |
| 24 | Ga0070670_100140812 | 3300005331 | Bacteria | 2086 |
| 25 | Ga0070670_100670829 | 3300005331 | Bacteria | 931 |
| 26 | Ga0070670_101920709 | 3300005331 | Bacteria | 545 |
| 27 | Ga0070670_102024131 | 3300005331 | Bacteria | 531 |
| 28 | Ga0070670_102098580 | 3300005331 | Bacteria | 521 |
| 29 | Ga0070677_10518799 | 3300005333 | Bacteria | 648 |
| 30 | Ga0068869_100043873 | 3300005334 | Bacteria | 3214 |
| 31 | Ga0068869_100215651 | 3300005334 | Bacteria | 1519 |
| 32 | Ga0068869_100291638 | 3300005334 | Bacteria | 1315 |
| 33 | Ga0068869_100853130 | 3300005334 | Bacteria | 786 |
| 34 | Ga0070666_10003456 | 3300005335 | Bacteria | 9571 |
| 35 | Ga0070666_10043454 | 3300005335 | Bacteria | 3009 |
| 36 | Ga0070666_10051321 | 3300005335 | Bacteria | 2777 |
| 37 | Ga0070666_10528712 | 3300005335 | Unclassified | 857 |
| 38 | Ga0070680_100001306 | 3300005336 | Bacteria | 18035 |
| 39 | Ga0070680_100154756 | 3300005336 | Bacteria | 1926 |
| 40 | Ga0070680_101076432 | 3300005336 | Bacteria | 695 |
| 41 | Ga0070680_101181277 | 3300005336 | Bacteria | 662 |
| 42 | Ga0070680_101710288 | 3300005336 | Bacteria | 545 |
| 43 | Ga0070682_100019091 | 3300005337 | Bacteria | 4017 |
| 44 | Ga0070682_100078258 | 3300005337 | Bacteria | 2132 |
| 45 | Ga0068868_100149441 | 3300005338 | Bacteria | 1923 |
| 46 | Ga0068868_100358143 | 3300005338 | Bacteria | 1251 |
| 47 | Ga0068868_100567498 | 3300005338 | Bacteria | 1002 |
| 48 | Ga0068868_100989463 | 3300005338 | Bacteria | 769 |
| 49 | Ga0068868_101148399 | 3300005338 | Bacteria | 716 |
| 50 | Ga0070660_100002280 | 3300005339 | Bacteria | 13171 |
| 51 | Ga0070660_100072622 | 3300005339 | Bacteria | 2689 |
| 52 | Ga0070660_100114199 | 3300005339 | Bacteria | 2151 |
| 53 | Ga0070660_100182022 | 3300005339 | Bacteria | 1701 |
| 54 | Ga0070660_100311592 | 3300005339 | Bacteria | 1291 |
| 55 | Ga0070660_100629583 | 3300005339 | Bacteria | 898 |
| 56 | Ga0070660_100824980 | 3300005339 | Bacteria | 780 |
| 57 | Ga0070660_101712182 | 3300005339 | Bacteria | 535 |
| 58 | Ga0070691_10407110 | 3300005341 | Bacteria | 768 |
| 59 | Ga0070661_100020291 | 3300005344 | Bacteria | 4737 |
| 60 | Ga0070661_100033255 | 3300005344 | Bacteria | 3734 |
| 61 | Ga0070661_100033786 | 3300005344 | Bacteria | 3707 |
| 62 | Ga0070661_100060678 | 3300005344 | Bacteria | 2774 |
| 63 | Ga0070661_100068490 | 3300005344 | Bacteria | 2608 |
| 64 | Ga0070661_100080352 | 3300005344 | Bacteria | 2407 |
| 65 | Ga0070661_100166055 | 3300005344 | Bacteria | 1674 |
| 66 | Ga0070661_100467755 | 3300005344 | Bacteria | 1005 |
| 67 | Ga0070661_100588032 | 3300005344 | Bacteria | 899 |
| 68 | Ga0070661_100731868 | 3300005344 | Bacteria | 808 |
| 69 | Ga0070661_101291722 | 3300005344 | Unclassified | 612 |
| 70 | Ga0070661_101864834 | 3300005344 | Bacteria | 511 |
| 71 | Ga0070692_10023376 | 3300005345 | Bacteria | 3029 |
| 72 | Ga0070692_10104582 | 3300005345 | Bacteria | 1557 |
| 73 | Ga0070668_100018998 | 3300005347 | Bacteria | 5165 |
| 74 | Ga0070668_100321102 | 3300005347 | Bacteria | 1304 |
| 75 | Ga0070668_100346955 | 3300005347 | Bacteria | 1255 |
| 76 | Ga0070668_100637813 | 3300005347 | Bacteria | 935 |
| 77 | Ga0070668_100883144 | 3300005347 | Bacteria | 798 |
| 78 | Ga0070668_101700548 | 3300005347 | Bacteria | 579 |
| 79 | Ga0070668_102280429 | 3300005347 | Bacteria | 500 |
| 80 | Ga0070669_101110824 | 3300005353 | Bacteria | 681 |
| 81 | Ga0070669_101344153 | 3300005353 | Bacteria | 619 |
| 82 | Ga0070669_101881252 | 3300005353 | Bacteria | 522 |
| 83 | Ga0070669_101915434 | 3300005353 | Bacteria | 518 |
| 84 | Ga0070675_100026302 | 3300005354 | Bacteria | 4670 |
| 85 | Ga0070675_100109167 | 3300005354 | Bacteria | 2338 |
| 86 | Ga0070675_100460169 | 3300005354 | Bacteria | 1142 |
| 87 | Ga0070675_101070983 | 3300005354 | Bacteria | 741 |
| 88 | Ga0070671_100010695 | 3300005355 | Bacteria | 7367 |
| 89 | Ga0070671_100115166 | 3300005355 | Bacteria | 2260 |
| 90 | Ga0070671_100143086 | 3300005355 | Bacteria | 2018 |
| 91 | Ga0070671_100149951 | 3300005355 | Bacteria | 1969 |
| 92 | Ga0070671_100161403 | 3300005355 | Bacteria | 1894 |
| 93 | Ga0070671_100195176 | 3300005355 | Bacteria | 1716 |
| 94 | Ga0070671_100854568 | 3300005355 | Bacteria | 794 |
| 95 | Ga0070671_101991096 | 3300005355 | Unclassified | 517 |
| 96 | Ga0070674_100007740 | 3300005356 | Bacteria | 6346 |
| 97 | Ga0070674_100772644 | 3300005356 | Bacteria | 827 |
| 98 | Ga0070674_101154814 | 3300005356 | Bacteria | 686 |
| 99 | Ga0070673_100005116 | 3300005364 | Bacteria | 8366 |
| 100 | Ga0070673_100032534 | 3300005364 | Bacteria | 3928 |
| 101 | Ga0070673_100118869 | 3300005364 | Bacteria | 2201 |
| 102 | Ga0070673_100237403 | 3300005364 | Bacteria | 1584 |
| 103 | Ga0070673_100256536 | 3300005364 | Bacteria | 1526 |
| 104 | Ga0070673_101705671 | 3300005364 | Bacteria | 596 |
| 105 | Ga0070659_100009647 | 3300005366 | Bacteria | 7096 |
| 106 | Ga0070659_100034514 | 3300005366 | Bacteria | 3935 |
| 107 | Ga0070659_100163543 | 3300005366 | Bacteria | 1820 |
| 108 | Ga0070659_101065561 | 3300005366 | Bacteria | 711 |
| 109 | Ga0070659_101162179 | 3300005366 | Bacteria | 682 |
| 110 | Ga0070659_101196792 | 3300005366 | Bacteria | 672 |
| 111 | Ga0070659_101385352 | 3300005366 | Bacteria | 625 |
| 112 | Ga0070659_101712431 | 3300005366 | Unclassified | 562 |
| 113 | Ga0070667_100002393 | 3300005367 | Bacteria | 16426 |
| 114 | Ga0070667_100036352 | 3300005367 | Bacteria | 4129 |
| 115 | Ga0070667_100037369 | 3300005367 | Bacteria | 4070 |
| 116 | Ga0070667_100075329 | 3300005367 | Bacteria | 2881 |
| 117 | Ga0070667_100496086 | 3300005367 | Bacteria | 1119 |
| 118 | Ga0070667_100506945 | 3300005367 | Bacteria | 1106 |
| 119 | Ga0070667_100647498 | 3300005367 | Bacteria | 975 |
| 120 | Ga0070667_100674901 | 3300005367 | Bacteria | 955 |
| 121 | Ga0070667_100708424 | 3300005367 | Bacteria | 932 |
| 122 | Ga0070667_100712488 | 3300005367 | Unclassified | 929 |
| 123 | Ga0070667_100740857 | 3300005367 | Bacteria | 910 |
| 124 | Ga0070667_100763163 | 3300005367 | Bacteria | 897 |
| 125 | Ga0070667_100854720 | 3300005367 | Bacteria | 846 |
| 126 | Ga0070713_100942658 | 3300005436 | Bacteria | 831 |
| 127 | Ga0070710_10610693 | 3300005437 | Bacteria | 760 |
| 128 | Ga0070705_100515045 | 3300005440 | Bacteria | 911 |
| 129 | Ga0070705_101150988 | 3300005440 | Bacteria | 637 |
| 130 | Ga0070663_100000271 | 3300005455 | Bacteria | 26098 |
| 131 | Ga0070663_100057324 | 3300005455 | Bacteria | 2794 |
| 132 | Ga0070663_100097344 | 3300005455 | Bacteria | 2190 |
| 133 | Ga0070663_100307846 | 3300005455 | Bacteria | 1270 |
| 134 | Ga0070663_100391464 | 3300005455 | Bacteria | 1134 |
| 135 | Ga0070663_100482154 | 3300005455 | Bacteria | 1027 |
| 136 | Ga0070663_100731588 | 3300005455 | Unclassified | 843 |
| 137 | Ga0070678_100011061 | 3300005456 | Bacteria | 5548 |
| 138 | Ga0070678_100158426 | 3300005456 | Bacteria | 1831 |
| 139 | Ga0070678_102050242 | 3300005456 | Bacteria | 541 |
| 140 | Ga0070662_100001018 | 3300005457 | Bacteria | 17157 |
| 141 | Ga0070662_100074011 | 3300005457 | Bacteria | 2519 |
| 142 | Ga0070662_100161640 | 3300005457 | Bacteria | 1752 |
| 143 | Ga0070662_100664919 | 3300005457 | Bacteria | 879 |
| 144 | Ga0070681_10015737 | 3300005458 | Bacteria | 7540 |
| 145 | Ga0070681_10067960 | 3300005458 | Bacteria | 3531 |
| 146 | Ga0070681_10431034 | 3300005458 | Bacteria | 1230 |
| 147 | Ga0070681_11690843 | 3300005458 | Bacteria | 559 |
| 148 | Ga0068867_100003017 | 3300005459 | Bacteria | 11867 |
| 149 | Ga0068867_100227968 | 3300005459 | Bacteria | 1505 |
| 150 | Ga0070685_10057069 | 3300005466 | Bacteria | 2272 |
| 151 | Ga0070685_11059549 | 3300005466 | Bacteria | 611 |
| 152 | Ga0070679_100000346 | 3300005530 | Bacteria | 39334 |
| 153 | Ga0070679_100332434 | 3300005530 | Bacteria | 1468 |
| 154 | Ga0070679_100340672 | 3300005530 | Bacteria | 1447 |
| 155 | Ga0070679_101099751 | 3300005530 | Bacteria | 739 |
| 156 | Ga0070679_101568906 | 3300005530 | Bacteria | 606 |
| 157 | Ga0070684_101221319 | 3300005535 | Bacteria | 707 |
| 158 | Ga0070697_101176841 | 3300005536 | Bacteria | 683 |
| 159 | Ga0068853_100039150 | 3300005539 | Bacteria | 4042 |
| 160 | Ga0068853_100107496 | 3300005539 | Bacteria | 2474 |
| 161 | Ga0068853_100345817 | 3300005539 | Bacteria | 1382 |
| 162 | Ga0068853_100428474 | 3300005539 | Bacteria | 1241 |
| 163 | Ga0068853_100923459 | 3300005539 | Bacteria | 839 |
| 164 | Ga0068853_100984180 | 3300005539 | Bacteria | 812 |
| 165 | Ga0068853_102073122 | 3300005539 | Bacteria | 551 |
| 166 | Ga0070672_100064580 | 3300005543 | Bacteria | 2893 |
| 167 | Ga0070672_100102934 | 3300005543 | Bacteria | 2318 |
| 168 | Ga0070672_100125287 | 3300005543 | Bacteria | 2106 |
| 169 | Ga0070672_100139318 | 3300005543 | Bacteria | 2000 |
| 170 | Ga0070672_100725664 | 3300005543 | Bacteria | 871 |
| 171 | Ga0070686_101439915 | 3300005544 | Bacteria | 579 |
| 172 | Ga0070695_100834250 | 3300005545 | Bacteria | 741 |
| 173 | Ga0070696_100344834 | 3300005546 | Bacteria | 1152 |
| 174 | Ga0070693_100723640 | 3300005547 | Bacteria | 731 |
| 175 | Ga0070693_100741077 | 3300005547 | Bacteria | 723 |
| 176 | Ga0070665_100047018 | 3300005548 | Bacteria | 4332 |
| 177 | Ga0070665_100724673 | 3300005548 | Bacteria | 1007 |
| 178 | Ga0070665_100944391 | 3300005548 | Bacteria | 875 |
| 179 | Ga0068855_100009125 | 3300005563 | Bacteria | 11978 |
| 180 | Ga0068855_100083160 | 3300005563 | Bacteria | 3708 |
| 181 | Ga0068855_100582068 | 3300005563 | Bacteria | 1209 |
| 182 | Ga0070664_100006576 | 3300005564 | Bacteria | 9375 |
| 183 | Ga0070664_100012615 | 3300005564 | Bacteria | 6878 |
| 184 | Ga0070664_100035259 | 3300005564 | Bacteria | 4200 |
| 185 | Ga0070664_100064886 | 3300005564 | Bacteria | 3114 |
| 186 | Ga0070664_100081576 | 3300005564 | Bacteria | 2788 |
| 187 | Ga0070664_100177496 | 3300005564 | Bacteria | 1892 |
| 188 | Ga0070664_100319834 | 3300005564 | Bacteria | 1406 |
| 189 | Ga0070664_100321986 | 3300005564 | Bacteria | 1401 |
| 190 | Ga0068857_100010349 | 3300005577 | Bacteria | 8103 |
| 191 | Ga0068857_100040473 | 3300005577 | Bacteria | 4132 |
| 192 | Ga0068857_100587708 | 3300005577 | Bacteria | 1052 |
| 193 | Ga0068857_101131274 | 3300005577 | Bacteria | 757 |
| 194 | Ga0068854_100043054 | 3300005578 | Bacteria | 3198 |
| 195 | Ga0068854_100110134 | 3300005578 | Bacteria | 2076 |
| 196 | Ga0068854_100117343 | 3300005578 | Bacteria | 2015 |
| 197 | Ga0068854_100507859 | 3300005578 | Bacteria | 1016 |
| 198 | Ga0068854_100732837 | 3300005578 | Unclassified | 856 |
| 199 | Ga0068854_101930246 | 3300005578 | Bacteria | 543 |
| 200 | Ga0068854_102276236 | 3300005578 | Bacteria | 502 |
| 201 | Ga0068856_100016476 | 3300005614 | Bacteria | 7154 |
| 202 | Ga0068856_100018394 | 3300005614 | Bacteria | 6772 |
| 203 | Ga0068856_100315111 | 3300005614 | Bacteria | 1582 |
| 204 | Ga0068856_100725498 | 3300005614 | Bacteria | 1014 |
| 205 | Ga0068856_100975793 | 3300005614 | Bacteria | 866 |
| 206 | Ga0068856_101285131 | 3300005614 | Bacteria | 747 |
| 207 | Ga0068856_101897954 | 3300005614 | Bacteria | 607 |
| 208 | Ga0070702_100145871 | 3300005615 | Bacteria | 1513 |
| 209 | Ga0068852_100005849 | 3300005616 | Bacteria | 8834 |
| 210 | Ga0068852_100035562 | 3300005616 | Bacteria | 4157 |
| 211 | Ga0068852_100083782 | 3300005616 | Bacteria | 2836 |
| 212 | Ga0068852_100144204 | 3300005616 | Bacteria | 2207 |
| 213 | Ga0068852_100179808 | 3300005616 | Bacteria | 1988 |
| 214 | Ga0068852_100236611 | 3300005616 | Bacteria | 1743 |
| 215 | Ga0068852_100331534 | 3300005616 | Bacteria | 1481 |
| 216 | Ga0068859_100051278 | 3300005617 | Bacteria | 4147 |
| 217 | Ga0068859_100335433 | 3300005617 | Bacteria | 1606 |
| 218 | Ga0068859_100434249 | 3300005617 | Bacteria | 1409 |
| 219 | Ga0068859_101256627 | 3300005617 | Bacteria | 816 |
| 220 | Ga0068859_102158555 | 3300005617 | Bacteria | 615 |
| 221 | Ga0068859_102831081 | 3300005617 | Bacteria | 532 |
| 222 | Ga0068864_100010864 | 3300005618 | Bacteria | 7525 |
| 223 | Ga0068864_100012608 | 3300005618 | Bacteria | 6988 |
| 224 | Ga0068864_100210534 | 3300005618 | Bacteria | 1790 |
| 225 | Ga0068864_100343428 | 3300005618 | Bacteria | 1407 |
| 226 | Ga0068864_100877709 | 3300005618 | Bacteria | 885 |
| 227 | Ga0068866_11044380 | 3300005718 | Bacteria | 583 |
| 228 | Ga0068861_101299803 | 3300005719 | Bacteria | 707 |
| 229 | Ga0068861_101748846 | 3300005719 | Bacteria | 616 |
| 230 | Ga0068851_10001758 | 3300005834 | Bacteria | 9463 |
| 231 | Ga0068851_10062144 | 3300005834 | Bacteria | 1916 |
| 232 | Ga0068851_10069537 | 3300005834 | Bacteria | 1819 |
| 233 | Ga0068851_10073656 | 3300005834 | Bacteria | 1772 |
| 234 | Ga0068851_10130077 | 3300005834 | Bacteria | 1361 |
| 235 | Ga0068870_10037294 | 3300005840 | Bacteria | 2505 |
| 236 | Ga0068870_10301164 | 3300005840 | Bacteria | 1012 |
| 237 | Ga0068863_100000607 | 3300005841 | Bacteria | 36378 |
| 238 | Ga0068863_100011565 | 3300005841 | Bacteria | 8537 |
| 239 | Ga0068863_100043854 | 3300005841 | Bacteria | 4246 |
| 240 | Ga0068863_100252699 | 3300005841 | Bacteria | 1703 |
| 241 | Ga0068858_100006875 | 3300005842 | Bacteria | 11055 |
| 242 | Ga0068858_100032216 | 3300005842 | Bacteria | 4869 |
| 243 | Ga0068858_100525312 | 3300005842 | Bacteria | 1145 |
| 244 | Ga0068858_101562566 | 3300005842 | Bacteria | 651 |
| 245 | Ga0068858_102090360 | 3300005842 | Bacteria | 560 |
| 246 | Ga0068858_102196719 | 3300005842 | Bacteria | 546 |
| 247 | Ga0068860_100063733 | 3300005843 | Bacteria | 3500 |
| 248 | Ga0068860_100160363 | 3300005843 | Bacteria | 2168 |
| 249 | Ga0068860_100180289 | 3300005843 | Bacteria | 2041 |
| 250 | Ga0068860_100197813 | 3300005843 | Bacteria | 1947 |
| 251 | Ga0068860_100962590 | 3300005843 | Bacteria | 871 |
| 252 | Ga0068860_102435410 | 3300005843 | Bacteria | 543 |
| 253 | Ga0068862_100223546 | 3300005844 | Bacteria | 1705 |
| 254 | Ga0068862_100620056 | 3300005844 | Bacteria | 1040 |
| 255 | Ga0068862_100624199 | 3300005844 | Bacteria | 1037 |
| 256 | Ga0068862_101363624 | 3300005844 | Bacteria | 712 |
| 257 | Ga0081539_10022959 | 3300005985 | Bacteria | 4103 |
| 258 | Ga0075365_11185979 | 3300006038 | Bacteria | 537 |
| 259 | Ga0075363_100911267 | 3300006048 | Bacteria | 539 |
| 260 | Ga0075364_10602526 | 3300006051 | Bacteria | 751 |
| 261 | Ga0097621_100034174 | 3300006237 | Bacteria | 4054 |
| 262 | Ga0097621_100049260 | 3300006237 | Bacteria | 3421 |
| 263 | Ga0097621_100083846 | 3300006237 | Bacteria | 2656 |
| 264 | Ga0068871_100030913 | 3300006358 | Bacteria | 4220 |
| 265 | Ga0068871_100088118 | 3300006358 | Bacteria | 2582 |
| 266 | Ga0068871_100109365 | 3300006358 | Bacteria | 2324 |
| 267 | Ga0068871_100125435 | 3300006358 | Bacteria | 2173 |
| 268 | Ga0068871_100502613 | 3300006358 | Bacteria | 1093 |
| 269 | Ga0068871_100660570 | 3300006358 | Bacteria | 955 |
| 270 | Ga0068865_100105243 | 3300006881 | Bacteria | 2072 |
| 271 | Ga0068865_100120487 | 3300006881 | Bacteria | 1950 |
| 272 | Ga0068865_100610670 | 3300006881 | Bacteria | 923 |
| 273 | Ga0068865_101765758 | 3300006881 | Bacteria | 558 |
| 274 | Ga0097620_100051278 | 3300006931 | Bacteria | 4147 |
| 275 | Ga0097620_100335428 | 3300006931 | Bacteria | 1606 |
| 276 | Ga0097620_100434237 | 3300006931 | Bacteria | 1409 |
| 277 | Ga0097620_101256489 | 3300006931 | Bacteria | 816 |
| 278 | Ga0097620_102158321 | 3300006931 | Bacteria | 615 |
| 279 | Ga0097620_102830879 | 3300006931 | Bacteria | 532 |
| 280 | Ga0075435_100135083 | 3300007076 | Bacteria | 2066 |
| 281 | Ga0111539_10188678 | 3300009094 | Bacteria | 2406 |
| 282 | Ga0111539_11832955 | 3300009094 | Bacteria | 703 |
| 283 | Ga0105245_11832706 | 3300009098 | Bacteria | 660 |
| 284 | Ga0105245_13235962 | 3300009098 | Bacteria | 505 |
| 285 | Ga0105247_10245877 | 3300009101 | Bacteria | 1221 |
| 286 | Ga0105243_10472642 | 3300009148 | Bacteria | 1181 |
| 287 | Ga0105241_10858151 | 3300009174 | Bacteria | 840 |
| 288 | Ga0105248_10003825 | 3300009177 | Bacteria | 16686 |
| 289 | Ga0105248_10003900 | 3300009177 | Bacteria | 16492 |
| 290 | Ga0105248_10028196 | 3300009177 | Bacteria | 6253 |
| 291 | Ga0105248_10031637 | 3300009177 | Bacteria | 5911 |
| 292 | Ga0105248_10050987 | 3300009177 | Bacteria | 4643 |
| 293 | Ga0105248_10369712 | 3300009177 | Bacteria | 1614 |
| 294 | Ga0105248_10856061 | 3300009177 | Bacteria | 1026 |
| 295 | Ga0105248_11878887 | 3300009177 | Bacteria | 679 |
| 296 | Ga0105248_12929703 | 3300009177 | Bacteria | 544 |
| 297 | Ga0105237_10008511 | 3300009545 | Bacteria | 11096 |
| 298 | Ga0105237_10026407 | 3300009545 | Bacteria | 5935 |
| 299 | Ga0105237_10106121 | 3300009545 | Bacteria | 2801 |
| 300 | Ga0105238_10163614 | 3300009551 | Bacteria | 2201 |
| 301 | Ga0105238_11631009 | 3300009551 | Bacteria | 675 |
| 302 | Ga0105238_12452109 | 3300009551 | Bacteria | 557 |
| 303 | Ga0105249_10119887 | 3300009553 | Bacteria | 2499 |
| 304 | Ga0105249_12162334 | 3300009553 | Bacteria | 629 |
| 305 | Ga0105239_10853917 | 3300010375 | Bacteria | 1044 |
| 306 | Ga0105246_10738399 | 3300011119 | Bacteria | 867 |
| 307 | Ga0105246_12107904 | 3300011119 | Bacteria | 547 |
| 308 | Ga0157373_10062376 | 3300013100 | Bacteria | 2640 |
| 309 | Ga0157373_10063721 | 3300013100 | Bacteria | 2610 |
| 310 | Ga0157373_10065815 | 3300013100 | Bacteria | 2565 |
| 311 | Ga0157373_10069494 | 3300013100 | Bacteria | 2490 |
| 312 | Ga0157373_10542954 | 3300013100 | Bacteria | 842 |
| 313 | Ga0157373_10614010 | 3300013100 | Bacteria | 792 |
| 314 | Ga0157371_10048437 | 3300013102 | Bacteria | 3020 |
| 315 | Ga0157371_10161022 | 3300013102 | Bacteria | 1603 |
| 316 | Ga0157371_10178891 | 3300013102 | Bacteria | 1517 |
| 317 | Ga0157370_10009490 | 3300013104 | Bacteria | 10384 |
| 318 | Ga0157370_10101505 | 3300013104 | Bacteria | 2695 |
| 319 | Ga0157370_10240149 | 3300013104 | Bacteria | 1676 |
| 320 | Ga0157370_10682368 | 3300013104 | Bacteria | 938 |
| 321 | Ga0157370_11276736 | 3300013104 | Bacteria | 662 |
| 322 | Ga0157369_10003984 | 3300013105 | Bacteria | 17513 |
| 323 | Ga0157369_10046645 | 3300013105 | Bacteria | 4709 |
| 324 | Ga0157369_10589237 | 3300013105 | Bacteria | 1148 |
| 325 | Ga0157369_11741992 | 3300013105 | Bacteria | 633 |
| 326 | Ga0157369_12212906 | 3300013105 | Bacteria | 557 |
| 327 | Ga0157374_10051565 | 3300013296 | Bacteria | 3829 |
| 328 | Ga0157374_10059163 | 3300013296 | Bacteria | 3582 |
| 329 | Ga0157374_10126976 | 3300013296 | Bacteria | 2466 |
| 330 | Ga0157374_10165252 | 3300013296 | Bacteria | 2157 |
| 331 | Ga0157374_10650187 | 3300013296 | Bacteria | 1066 |
| 332 | Ga0157378_10289604 | 3300013297 | Bacteria | 1581 |
| 333 | Ga0163162_10004976 | 3300013306 | Bacteria | 12799 |
| 334 | Ga0163162_10013507 | 3300013306 | Bacteria | 7973 |
| 335 | Ga0163162_10293129 | 3300013306 | Bacteria | 1759 |
| 336 | Ga0163162_10762260 | 3300013306 | Bacteria | 1087 |
| 337 | Ga0163162_11117790 | 3300013306 | Bacteria | 893 |
| 338 | Ga0163162_13371909 | 3300013306 | Unclassified | 510 |
| 339 | Ga0157372_10479603 | 3300013307 | Bacteria | 1450 |
| 340 | Ga0157372_10584450 | 3300013307 | Bacteria | 1302 |
| 341 | Ga0157372_10595510 | 3300013307 | Bacteria | 1289 |
| 342 | Ga0157372_11465684 | 3300013307 | Bacteria | 786 |
| 343 | Ga0157372_12432697 | 3300013307 | Bacteria | 601 |
| 344 | Ga0157375_10005040 | 3300013308 | Bacteria | 11472 |
| 345 | Ga0157375_10044879 | 3300013308 | Bacteria | 4299 |
| 346 | Ga0157375_10060068 | 3300013308 | Bacteria | 3768 |
| 347 | Ga0157375_10216451 | 3300013308 | Bacteria | 2073 |
| 348 | Ga0157375_10258090 | 3300013308 | Bacteria | 1904 |
| 349 | Ga0157375_10286423 | 3300013308 | Bacteria | 1810 |
| 350 | Ga0163163_10014443 | 3300014325 | Bacteria | 7259 |
| 351 | Ga0163163_10074586 | 3300014325 | Bacteria | 3385 |
| 352 | Ga0163163_10328718 | 3300014325 | Bacteria | 1583 |
| 353 | Ga0182008_10162231 | 3300014497 | Bacteria | 1125 |
| 354 | Ga0157379_10001583 | 3300014968 | Bacteria | 18752 |
| 355 | Ga0157379_10502426 | 3300014968 | Bacteria | 1124 |
| 356 | Ga0163161_10003295 | 3300017792 | Bacteria | 11341 |
| 357 | Ga0163161_10524637 | 3300017792 | Bacteria | 968 |
| 358 | Ga0163161_10687361 | 3300017792 | Bacteria | 851 |
| 359 | Ga0206354_11449613 | 3300020081 | Bacteria | 564 |
| 360 | Ga0206353_10096358 | 3300020082 | Bacteria | 507 |
| 361 | Ga0207697_10163476 | 3300025315 | Bacteria | 972 |
| 362 | Ga0207697_10202809 | 3300025315 | Bacteria | 873 |
| 363 | Ga0207697_10396360 | 3300025315 | Bacteria | 613 |
| 364 | Ga0207656_10051512 | 3300025321 | Bacteria | 1780 |
| 365 | Ga0207656_10054119 | 3300025321 | Bacteria | 1743 |
| 366 | Ga0207656_10065642 | 3300025321 | Bacteria | 1602 |
| 367 | Ga0207656_10212696 | 3300025321 | Bacteria | 938 |
| 368 | Ga0207688_10007813 | 3300025901 | Bacteria | 5820 |
| 369 | Ga0207688_10158879 | 3300025901 | Bacteria | 1339 |
| 370 | Ga0207688_10624526 | 3300025901 | Bacteria | 680 |
| 371 | Ga0207680_10035471 | 3300025903 | Bacteria | 2864 |
| 372 | Ga0207680_10038224 | 3300025903 | Bacteria | 2777 |
| 373 | Ga0207680_10327492 | 3300025903 | Bacteria | 1072 |
| 374 | Ga0207647_10016084 | 3300025904 | Bacteria | 5111 |
| 375 | Ga0207647_10360989 | 3300025904 | Bacteria | 822 |
| 376 | Ga0207647_10603305 | 3300025904 | Bacteria | 605 |
| 377 | Ga0207647_10816434 | 3300025904 | Bacteria | 501 |
| 378 | Ga0207685_10736048 | 3300025905 | Bacteria | 539 |
| 379 | Ga0207645_10001636 | 3300025907 | Bacteria | 18270 |
| 380 | Ga0207645_10005404 | 3300025907 | Bacteria | 9266 |
| 381 | Ga0207645_10932327 | 3300025907 | Unclassified | 589 |
| 382 | Ga0207643_10054640 | 3300025908 | Bacteria | 2270 |
| 383 | Ga0207705_10000270 | 3300025909 | Bacteria | 49639 |
| 384 | Ga0207705_10072190 | 3300025909 | Bacteria | 2503 |
| 385 | Ga0207705_10289762 | 3300025909 | Bacteria | 1254 |
| 386 | Ga0207705_10369909 | 3300025909 | Bacteria | 1106 |
| 387 | Ga0207705_10528072 | 3300025909 | Bacteria | 917 |
| 388 | Ga0207705_10708748 | 3300025909 | Bacteria | 782 |
| 389 | Ga0207705_10862427 | 3300025909 | Bacteria | 702 |
| 390 | Ga0207654_10335828 | 3300025911 | Bacteria | 1037 |
| 391 | Ga0207707_10015148 | 3300025912 | Bacteria | 6712 |
| 392 | Ga0207707_10049824 | 3300025912 | Bacteria | 3649 |
| 393 | Ga0207671_10020935 | 3300025914 | Bacteria | 4972 |
| 394 | Ga0207671_10076405 | 3300025914 | Bacteria | 2506 |
| 395 | Ga0207660_10002965 | 3300025917 | Bacteria | 11098 |
| 396 | Ga0207660_10005305 | 3300025917 | Bacteria | 8381 |
| 397 | Ga0207660_10096380 | 3300025917 | Bacteria | 2202 |
| 398 | Ga0207660_10721510 | 3300025917 | Bacteria | 813 |
| 399 | Ga0207660_11449314 | 3300025917 | Bacteria | 556 |
| 400 | Ga0207657_10001091 | 3300025919 | Bacteria | 28769 |
| 401 | Ga0207657_10003456 | 3300025919 | Bacteria | 16857 |
| 402 | Ga0207657_10005074 | 3300025919 | Bacteria | 13810 |
| 403 | Ga0207657_10012494 | 3300025919 | Bacteria | 8381 |
| 404 | Ga0207657_10020199 | 3300025919 | Bacteria | 6301 |
| 405 | Ga0207657_10024128 | 3300025919 | Bacteria | 5646 |
| 406 | Ga0207657_10054575 | 3300025919 | Bacteria | 3455 |
| 407 | Ga0207657_10130544 | 3300025919 | Bacteria | 2059 |
| 408 | Ga0207657_10162912 | 3300025919 | Bacteria | 1810 |
| 409 | Ga0207649_10034401 | 3300025920 | Bacteria | 3036 |
| 410 | Ga0207649_10056199 | 3300025920 | Bacteria | 2457 |
| 411 | Ga0207649_10082203 | 3300025920 | Bacteria | 2088 |
| 412 | Ga0207649_10085096 | 3300025920 | Bacteria | 2057 |
| 413 | Ga0207649_10144769 | 3300025920 | Bacteria | 1630 |
| 414 | Ga0207649_10147832 | 3300025920 | Bacteria | 1615 |
| 415 | Ga0207649_10248910 | 3300025920 | Bacteria | 1279 |
| 416 | Ga0207649_10438490 | 3300025920 | Bacteria | 984 |
| 417 | Ga0207649_10464386 | 3300025920 | Bacteria | 957 |
| 418 | Ga0207649_10486017 | 3300025920 | Bacteria | 937 |
| 419 | Ga0207652_10000058 | 3300025921 | Bacteria | 113620 |
| 420 | Ga0207652_10439743 | 3300025921 | Bacteria | 1176 |
| 421 | Ga0207681_10048589 | 3300025923 | Bacteria | 2864 |
| 422 | Ga0207681_10173070 | 3300025923 | Bacteria | 1638 |
| 423 | Ga0207694_10041515 | 3300025924 | Bacteria | 3545 |
| 424 | Ga0207650_10008323 | 3300025925 | Bacteria | 7081 |
| 425 | Ga0207650_10021388 | 3300025925 | Bacteria | 4571 |
| 426 | Ga0207650_10069382 | 3300025925 | Bacteria | 2648 |
| 427 | Ga0207650_10168879 | 3300025925 | Bacteria | 1738 |
| 428 | Ga0207650_10403309 | 3300025925 | Bacteria | 1132 |
| 429 | Ga0207650_10650052 | 3300025925 | Bacteria | 889 |
| 430 | Ga0207650_11121088 | 3300025925 | Bacteria | 670 |
| 431 | Ga0207650_11620018 | 3300025925 | Bacteria | 549 |
| 432 | Ga0207659_10007014 | 3300025926 | Bacteria | 6919 |
| 433 | Ga0207659_10187861 | 3300025926 | Bacteria | 1642 |
| 434 | Ga0207659_10393399 | 3300025926 | Bacteria | 1158 |
| 435 | Ga0207659_10621381 | 3300025926 | Bacteria | 922 |
| 436 | Ga0207700_10644479 | 3300025928 | Bacteria | 944 |
| 437 | Ga0207644_10043535 | 3300025931 | Bacteria | 3186 |
| 438 | Ga0207644_10069764 | 3300025931 | Bacteria | 2567 |
| 439 | Ga0207644_10081793 | 3300025931 | Bacteria | 2388 |
| 440 | Ga0207644_10099178 | 3300025931 | Bacteria | 2185 |
| 441 | Ga0207644_10155359 | 3300025931 | Bacteria | 1773 |
| 442 | Ga0207644_10336485 | 3300025931 | Bacteria | 1223 |
| 443 | Ga0207690_10016622 | 3300025932 | Bacteria | 4481 |
| 444 | Ga0207690_10039783 | 3300025932 | Bacteria | 3069 |
| 445 | Ga0207690_10466721 | 3300025932 | Bacteria | 1017 |
| 446 | Ga0207690_10488920 | 3300025932 | Bacteria | 994 |
| 447 | Ga0207690_10501046 | 3300025932 | Bacteria | 982 |
| 448 | Ga0207690_10698425 | 3300025932 | Unclassified | 834 |
| 449 | Ga0207706_10004209 | 3300025933 | Bacteria | 13551 |
| 450 | Ga0207706_10004893 | 3300025933 | Bacteria | 12526 |
| 451 | Ga0207706_10109683 | 3300025933 | Bacteria | 2429 |
| 452 | Ga0207706_10132115 | 3300025933 | Bacteria | 2196 |
| 453 | Ga0207706_10262444 | 3300025933 | Bacteria | 1508 |
| 454 | Ga0207706_10348575 | 3300025933 | Bacteria | 1288 |
| 455 | Ga0207706_11484006 | 3300025933 | Unclassified | 554 |
| 456 | Ga0207669_10004891 | 3300025937 | Bacteria | 5953 |
| 457 | Ga0207669_10119669 | 3300025937 | Bacteria | 1784 |
| 458 | Ga0207669_10240714 | 3300025937 | Bacteria | 1341 |
| 459 | Ga0207704_10459181 | 3300025938 | Bacteria | 1018 |
| 460 | Ga0207704_10805168 | 3300025938 | Bacteria | 785 |
| 461 | Ga0207704_11040238 | 3300025938 | Unclassified | 694 |
| 462 | Ga0207691_10010453 | 3300025940 | Bacteria | 8903 |
| 463 | Ga0207691_10028885 | 3300025940 | Bacteria | 5190 |
| 464 | Ga0207691_10054138 | 3300025940 | Bacteria | 3661 |
| 465 | Ga0207691_10113632 | 3300025940 | Bacteria | 2406 |
| 466 | Ga0207691_10845599 | 3300025940 | Bacteria | 768 |
| 467 | Ga0207711_10001131 | 3300025941 | Bacteria | 25459 |
| 468 | Ga0207711_10005984 | 3300025941 | Bacteria | 10279 |
| 469 | Ga0207711_10018447 | 3300025941 | Bacteria | 5801 |
| 470 | Ga0207711_10032438 | 3300025941 | Bacteria | 4416 |
| 471 | Ga0207711_10440992 | 3300025941 | Bacteria | 1212 |
| 472 | Ga0207711_10516009 | 3300025941 | Bacteria | 1114 |
| 473 | Ga0207689_10017153 | 3300025942 | Bacteria | 6129 |
| 474 | Ga0207689_10047270 | 3300025942 | Bacteria | 3555 |
| 475 | Ga0207689_10299012 | 3300025942 | Bacteria | 1334 |
| 476 | Ga0207689_10453176 | 3300025942 | Bacteria | 1072 |
| 477 | Ga0207661_10002950 | 3300025944 | Bacteria | 11762 |
| 478 | Ga0207661_10588457 | 3300025944 | Bacteria | 1021 |
| 479 | Ga0207679_10024262 | 3300025945 | Bacteria | 4158 |
| 480 | Ga0207679_10130236 | 3300025945 | Bacteria | 2017 |
| 481 | Ga0207679_10205059 | 3300025945 | Bacteria | 1650 |
| 482 | Ga0207679_10272052 | 3300025945 | Bacteria | 1449 |
| 483 | Ga0207679_10343395 | 3300025945 | Bacteria | 1299 |
| 484 | Ga0207679_10836822 | 3300025945 | Bacteria | 840 |
| 485 | Ga0207679_11003439 | 3300025945 | Bacteria | 765 |
| 486 | Ga0207667_10006485 | 3300025949 | Bacteria | 14155 |
| 487 | Ga0207667_10254582 | 3300025949 | Bacteria | 1796 |
| 488 | Ga0207667_11084303 | 3300025949 | Bacteria | 785 |
| 489 | Ga0207651_10002688 | 3300025960 | Bacteria | 8513 |
| 490 | Ga0207651_10014420 | 3300025960 | Bacteria | 4562 |
| 491 | Ga0207651_10238208 | 3300025960 | Bacteria | 1481 |
| 492 | Ga0207651_10262071 | 3300025960 | Bacteria | 1420 |
| 493 | Ga0207712_11266493 | 3300025961 | Bacteria | 659 |
| 494 | Ga0207712_11328481 | 3300025961 | Bacteria | 643 |
| 495 | Ga0207668_10000086 | 3300025972 | Bacteria | 69871 |
| 496 | Ga0207668_10178623 | 3300025972 | Bacteria | 1672 |
| 497 | Ga0207668_10184657 | 3300025972 | Bacteria | 1648 |
| 498 | Ga0207668_10186813 | 3300025972 | Bacteria | 1639 |
| 499 | Ga0207668_11548574 | 3300025972 | Bacteria | 598 |
| 500 | Ga0207668_11654106 | 3300025972 | Bacteria | 578 |
| 501 | Ga0207640_10029285 | 3300025981 | Bacteria | 3378 |
| 502 | Ga0207640_10280521 | 3300025981 | Bacteria | 1308 |
| 503 | Ga0207640_10464213 | 3300025981 | Bacteria | 1046 |
| 504 | Ga0207640_10665921 | 3300025981 | Unclassified | 888 |
| 505 | Ga0207658_10002031 | 3300025986 | Bacteria | 15107 |
| 506 | Ga0207658_10010473 | 3300025986 | Bacteria | 6297 |
| 507 | Ga0207658_10043070 | 3300025986 | Bacteria | 3279 |
| 508 | Ga0207658_10043350 | 3300025986 | Bacteria | 3270 |
| 509 | Ga0207658_10046411 | 3300025986 | Bacteria | 3173 |
| 510 | Ga0207658_10056646 | 3300025986 | Bacteria | 2910 |
| 511 | Ga0207658_10068404 | 3300025986 | Bacteria | 2679 |
| 512 | Ga0207658_10151755 | 3300025986 | Bacteria | 1888 |
| 513 | Ga0207658_10363907 | 3300025986 | Bacteria | 1263 |
| 514 | Ga0207658_10539332 | 3300025986 | Bacteria | 1043 |
| 515 | Ga0207658_10540619 | 3300025986 | Bacteria | 1042 |
| 516 | Ga0207658_11254773 | 3300025986 | Unclassified | 677 |
| 517 | Ga0207677_10022762 | 3300026023 | Bacteria | 3858 |
| 518 | Ga0207677_10307589 | 3300026023 | Bacteria | 1312 |
| 519 | Ga0207677_12177142 | 3300026023 | Bacteria | 516 |
| 520 | Ga0207703_10005582 | 3300026035 | Bacteria | 10098 |
| 521 | Ga0207703_10189486 | 3300026035 | Bacteria | 1820 |
| 522 | Ga0207703_10196246 | 3300026035 | Bacteria | 1791 |
| 523 | Ga0207703_10334072 | 3300026035 | Bacteria | 1391 |
| 524 | Ga0207703_11085353 | 3300026035 | Bacteria | 769 |
| 525 | Ga0207639_10047762 | 3300026041 | Bacteria | 3237 |
| 526 | Ga0207639_10085740 | 3300026041 | Bacteria | 2506 |
| 527 | Ga0207639_10500143 | 3300026041 | Bacteria | 1110 |
| 528 | Ga0207639_10543232 | 3300026041 | Bacteria | 1066 |
| 529 | Ga0207639_11404915 | 3300026041 | Bacteria | 655 |
| 530 | Ga0207678_10000217 | 3300026067 | Bacteria | 51179 |
| 531 | Ga0207678_10009864 | 3300026067 | Bacteria | 8388 |
| 532 | Ga0207678_10010463 | 3300026067 | Bacteria | 8146 |
| 533 | Ga0207678_10015277 | 3300026067 | Bacteria | 6752 |
| 534 | Ga0207678_10699810 | 3300026067 | Bacteria | 892 |
| 535 | Ga0207678_11831290 | 3300026067 | Bacteria | 531 |
| 536 | Ga0207702_10013141 | 3300026078 | Bacteria | 6883 |
| 537 | Ga0207702_10179768 | 3300026078 | Bacteria | 1947 |
| 538 | Ga0207702_10851144 | 3300026078 | Bacteria | 903 |
| 539 | Ga0207702_12403337 | 3300026078 | Bacteria | 514 |
| 540 | Ga0207702_12468894 | 3300026078 | Bacteria | 506 |
| 541 | Ga0207641_10004163 | 3300026088 | Bacteria | 12605 |
| 542 | Ga0207641_10019848 | 3300026088 | Bacteria | 5516 |
| 543 | Ga0207641_10101337 | 3300026088 | Bacteria | 2537 |
| 544 | Ga0207641_10115512 | 3300026088 | Bacteria | 2386 |
| 545 | Ga0207641_10232815 | 3300026088 | Bacteria | 1713 |
| 546 | Ga0207641_10778988 | 3300026088 | Bacteria | 945 |
| 547 | Ga0207648_10001535 | 3300026089 | Bacteria | 25421 |
| 548 | Ga0207648_10053565 | 3300026089 | Bacteria | 3526 |
| 549 | Ga0207676_10013696 | 3300026095 | Bacteria | 5822 |
| 550 | Ga0207676_10031084 | 3300026095 | Bacteria | 4013 |
| 551 | Ga0207676_10353231 | 3300026095 | Bacteria | 1360 |
| 552 | Ga0207676_10513954 | 3300026095 | Bacteria | 1139 |
| 553 | Ga0207676_12150258 | 3300026095 | Bacteria | 556 |
| 554 | Ga0207674_10003022 | 3300026116 | Bacteria | 20854 |
| 555 | Ga0207674_10024700 | 3300026116 | Bacteria | 6416 |
| 556 | Ga0207674_10065955 | 3300026116 | Bacteria | 3648 |
| 557 | Ga0207675_100460281 | 3300026118 | Bacteria | 1262 |
| 558 | Ga0207675_102163680 | 3300026118 | Bacteria | 572 |
| 559 | Ga0207683_10000541 | 3300026121 | Bacteria | 34994 |
| 560 | Ga0207683_10005768 | 3300026121 | Bacteria | 10613 |
| 561 | Ga0207683_10015641 | 3300026121 | Bacteria | 6458 |
| 562 | Ga0207683_10411449 | 3300026121 | Bacteria | 1245 |
| 563 | Ga0207683_11325955 | 3300026121 | Unclassified | 666 |
| 564 | Ga0207698_10001554 | 3300026142 | Bacteria | 13377 |
| 565 | Ga0207698_10021943 | 3300026142 | Bacteria | 4426 |
| 566 | Ga0207698_10083043 | 3300026142 | Bacteria | 2592 |
| 567 | Ga0207698_10112284 | 3300026142 | Bacteria | 2287 |
| 568 | Ga0207698_10118693 | 3300026142 | Bacteria | 2234 |
| 569 | Ga0207698_11053246 | 3300026142 | Bacteria | 825 |
| 570 | Ga0207698_11388778 | 3300026142 | Bacteria | 717 |
| 571 | Ga0268266_10034827 | 3300028379 | Bacteria | 4283 |
| 572 | Ga0268266_10122325 | 3300028379 | Bacteria | 2317 |
| 573 | Ga0268266_10731300 | 3300028379 | Bacteria | 954 |
| 574 | Ga0268265_10002511 | 3300028380 | Bacteria | 13738 |
| 575 | Ga0268265_10358783 | 3300028380 | Bacteria | 1333 |
| 576 | Ga0268265_12558909 | 3300028380 | Bacteria | 516 |
| 577 | Ga0268264_10005393 | 3300028381 | Bacteria | 10828 |
| 578 | Ga0268264_10011878 | 3300028381 | Bacteria | 7174 |
| 579 | Ga0268264_10053137 | 3300028381 | Bacteria | 3380 |
| 580 | Ga0268264_10395671 | 3300028381 | Bacteria | 1326 |
| 581 | Ga0268264_11037825 | 3300028381 | Bacteria | 827 |
| 582 | Ga0268264_11714972 | 3300028381 | Bacteria | 638 |
| 583 | Ga0268264_12197274 | 3300028381 | Bacteria | 560 |
| 584 | Ga0307410_11090771 | 3300031852 | Bacteria | 692 |
| 585 | Ga0307410_11829180 | 3300031852 | Bacteria | 540 |
| 586 | Ga0307409_102458471 | 3300031995 | Bacteria | 550 |
| 587 | Ga0307416_101589439 | 3300032002 | Bacteria | 759 |
| 588 | Ga0307416_102486880 | 3300032002 | Bacteria | 617 |
| 589 | Ga0307415_100029692 | 3300032126 | Bacteria | 3498 |
| 590 | Ga0307415_101212581 | 3300032126 | Bacteria | 711 |
| 591 | Ga0373959_0178094 | 3300034820 | Bacteria | 551 |
| 592 | Ga0373944_0121702 | 3300035089 | Bacteria | 900 |
| 593 | Ga0373941_0119906 | 3300035115 | Bacteria | 937 |
| 594 | Ga0373943_0037065 | 3300035170 | Bacteria | 2339 |
| 595 | Ga0373935_0112406 | 3300035692 | Bacteria | 1809 |
| 596 | Ga0373927_0096638 | 3300035695 | Bacteria | 1920 |
| 597 | Ga0373947_0028056 | 3300035725 | Bacteria | 3297 |
| 598 | Ga0373937_2084717 | 3300036401 | Bacteria | 513 |
| 599 | Ga0373925_0020969 | 3300037068 | Bacteria | 4762 |
| 600 | Ga0395899_0000270 | 3300037312 | Bacteria | 68004 |
| 601 | Ga0395899_0000998 | 3300037312 | Bacteria | 25996 |
| 602 | Ga0395899_0003175 | 3300037312 | Bacteria | 13042 |
| 603 | Ga0395899_0243334 | 3300037312 | Bacteria | 1237 |
| 604 | Ga0395899_0251923 | 3300037312 | Bacteria | 1211 |
| 605 | Ga0395899_0540977 | 3300037312 | Bacteria | 750 |
| 606 | Ga0395900_0000290 | 3300037418 | Bacteria | 75444 |
| 607 | Ga0395900_0004722 | 3300037418 | Bacteria | 14370 |
| 608 | Ga0395900_0034834 | 3300037418 | Bacteria | 5186 |
| 609 | Ga0395900_0035230 | 3300037418 | Bacteria | 5155 |
| 610 | Ga0395900_0051408 | 3300037418 | Bacteria | 4245 |
| 611 | Ga0395900_0107032 | 3300037418 | Bacteria | 2873 |
| 612 | Ga0395900_0173238 | 3300037418 | Bacteria | 2195 |
| 613 | Ga0395900_0384182 | 3300037418 | Bacteria | 1371 |
| 614 | Ga0395900_0560890 | 3300037418 | Bacteria | 1086 |
| 615 | Ga0395900_0609434 | 3300037418 | Bacteria | 1032 |
| 616 | Ga0395900_1937173 | 3300037418 | Bacteria | 500 |
| 617 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 618 | Ga0395898_0002537 | 3300037466 | Bacteria | 21412 |
| 619 | Ga0395898_0006151 | 3300037466 | Bacteria | 12854 |
| 620 | Ga0395898_0088531 | 3300037466 | Bacteria | 2980 |
| 621 | Ga0395898_0552001 | 3300037466 | Bacteria | 1094 |
| 622 | Ga0395898_1037030 | 3300037466 | Bacteria | 755 |
| 623 | Ga0395898_1053918 | 3300037466 | Bacteria | 748 |
| 624 | Ga0395898_1125464 | 3300037466 | Bacteria | 718 |
| 625 | Ga0395905_0000046 | 3300037471 | Bacteria | 240463 |
| 626 | Ga0395905_0001943 | 3300037471 | Bacteria | 23692 |
| 627 | Ga0395905_0004285 | 3300037471 | Bacteria | 14873 |
| 628 | Ga0395905_0022116 | 3300037471 | Bacteria | 6016 |
| 629 | Ga0395905_0028526 | 3300037471 | Bacteria | 5261 |
| 630 | Ga0395905_0035890 | 3300037471 | Bacteria | 4655 |
| 631 | Ga0395905_0061629 | 3300037471 | Bacteria | 3509 |
| 632 | Ga0395905_0145811 | 3300037471 | Bacteria | 2227 |
| 633 | Ga0395905_0179531 | 3300037471 | Bacteria | 1987 |
| 634 | Ga0395905_0205413 | 3300037471 | Bacteria | 1846 |
| 635 | Ga0395905_0279940 | 3300037471 | Bacteria | 1554 |
| 636 | Ga0395905_0298788 | 3300037471 | Bacteria | 1497 |
| 637 | Ga0395905_0405413 | 3300037471 | Bacteria | 1258 |
| 638 | Ga0395905_0530940 | 3300037471 | Bacteria | 1077 |
| 639 | Ga0395905_0622285 | 3300037471 | Bacteria | 981 |
| 640 | Ga0395905_0753200 | 3300037471 | Bacteria | 876 |
| 641 | Ga0395905_1627037 | 3300037471 | Bacteria | 551 |
| 642 | Ga0395901_0000102 | 3300038443 | Bacteria | 115611 |
| 643 | Ga0395901_0003921 | 3300038443 | Bacteria | 14966 |
| 644 | Ga0395901_0004019 | 3300038443 | Bacteria | 14813 |
| 645 | Ga0395901_0008199 | 3300038443 | Bacteria | 10557 |
| 646 | Ga0395901_0110381 | 3300038443 | Bacteria | 2887 |
| 647 | Ga0395901_0115681 | 3300038443 | Bacteria | 2817 |
| 648 | Ga0395901_0410998 | 3300038443 | Bacteria | 1389 |
| 649 | Ga0395901_1013823 | 3300038443 | Bacteria | 805 |
| 650 | Ga0395901_2079359 | 3300038443 | Bacteria | 513 |
| 651 | Ga0451843_0966362 | 3300041509 | Bacteria | 604 |
| 652 | Ga0451853_3358249 | 3300041512 | Bacteria | 756 |
| 653 | Ga0450898_047127 | 3300042134 | Bacteria | 826 |
| 654 | Ga0439458_0000409 | 3300042157 | Bacteria | 10769 |
| 655 | Ga0466969_0461202 | 3300044656 | Bacteria | 578 |
| 656 | Ga0466972_0227153 | 3300044658 | Bacteria | 874 |
| 657 | Ga0466965_0045498 | 3300044683 | Bacteria | 2171 |
| 658 | Ga0466965_0047113 | 3300044683 | Bacteria | 2134 |
| 659 | Ga0466966_0039692 | 3300044684 | Bacteria | 3031 |
| 660 | Ga0466966_0088750 | 3300044684 | Unclassified | 1921 |
| 661 | Ga0466966_0840913 | 3300044684 | Bacteria | 553 |
| 662 | Ga0466961_0011100 | 3300044693 | Bacteria | 5759 |
| 663 | Ga0466961_0021179 | 3300044693 | Bacteria | 4185 |
| 664 | Ga0466963_0001468 | 3300044694 | Bacteria | 12735 |
| 665 | Ga0466963_0002992 | 3300044694 | Bacteria | 9559 |
| 666 | Ga0466963_0419079 | 3300044694 | Bacteria | 944 |
| 667 | Ga0466963_0720165 | 3300044694 | Bacteria | 704 |
| 668 | Ga0466964_0017249 | 3300044706 | Bacteria | 2763 |
| 669 | Ga0466964_0099252 | 3300044706 | Bacteria | 1281 |
| 670 | Ga0466970_0946215 | 3300044765 | Unclassified | 507 |
| 671 | Ga0466957_0000630 | 3300044842 | Bacteria | 17878 |
| 672 | Ga0466957_0038452 | 3300044842 | Bacteria | 2883 |
| 673 | Ga0466957_1404196 | 3300044842 | Bacteria | 508 |
| 674 | Ga0466960_0017037 | 3300044901 | Bacteria | 3162 |
| 675 | Ga0466960_0409869 | 3300044901 | Bacteria | 782 |
| 676 | Ga0466959_0258420 | 3300045049 | Bacteria | 1199 |
| 677 | Ga0466959_0324220 | 3300045049 | Bacteria | 1053 |
| 678 | Ga0466959_0804483 | 3300045049 | Bacteria | 628 |
| 679 | Ga0466958_0089392 | 3300045836 | Bacteria | 1904 |
| 680 | Ga0466958_0113732 | 3300045836 | Unclassified | 1690 |
| 681 | Ga0466967_0012674 | 3300045976 | Bacteria | 6468 |
| 682 | Ga0466967_0020351 | 3300045976 | Bacteria | 5361 |
| 683 | Ga0466967_0043629 | 3300045976 | Bacteria | 3884 |
| 684 | Ga0466967_0064589 | 3300045976 | Bacteria | 3255 |
| 685 | Ga0466967_0603687 | 3300045976 | Bacteria | 1083 |
| 686 | Ga0466967_2133310 | 3300045976 | Bacteria | 556 |
| 687 | Ga0495629_0331764 | 3300046459 | Bacteria | 1039 |
| 688 | Ga0495598_0000426 | 3300046537 | Bacteria | 7621 |
| 689 | Ga0495621_0002280 | 3300046539 | Bacteria | 5136 |
| 690 | Ga0495621_0206481 | 3300046539 | Bacteria | 792 |
| 691 | Ga0495633_0212495 | 3300046558 | Bacteria | 886 |
| 692 | Ga0495625_0057447 | 3300046660 | Bacteria | 2767 |
| 693 | Ga0495669_0007270 | 3300046684 | Bacteria | 4637 |
| 694 | Ga0495669_0102942 | 3300046684 | Bacteria | 1327 |
| 695 | Ga0495669_0212838 | 3300046684 | Bacteria | 925 |
| 696 | Ga0495669_0358612 | 3300046684 | Bacteria | 705 |
| 697 | Ga0495670_0000148 | 3300046691 | Bacteria | 30968 |
| 698 | Ga0495672_0218644 | 3300047320 | Bacteria | 942 |
| 699 | Ga0496100_0060100 | 3300048903 | Bacteria | 2500 |
| 700 | Ga0496101_0100868 | 3300048904 | Bacteria | 2160 |
| 701 | Ga0496101_0195000 | 3300048904 | Bacteria | 1564 |
| 702 | Ga0496101_0222960 | 3300048904 | Bacteria | 1463 |
| 703 | Ga0496101_0254049 | 3300048904 | Bacteria | 1370 |
| 704 | Ga0496101_0393672 | 3300048904 | Bacteria | 1091 |
| 705 | Ga0496101_0701220 | 3300048904 | Bacteria | 799 |
| 706 | Ga0496101_0735712 | 3300048904 | Bacteria | 778 |
| 707 | Ga0496102_0012425 | 3300048905 | Bacteria | 7368 |
| 708 | Ga0496102_0281089 | 3300048905 | Bacteria | 1569 |
| 709 | Ga0496103_0011174 | 3300048906 | Bacteria | 5316 |
| 710 | Ga0496103_0407747 | 3300048906 | Bacteria | 873 |
| 711 | Ga0496103_0476165 | 3300048906 | Bacteria | 800 |
| 712 | Ga0496105_0191850 | 3300048908 | Bacteria | 1670 |
| 713 | Ga0496106_0066341 | 3300048909 | Bacteria | 2749 |
| 714 | Ga0496107_0010960 | 3300048910 | Bacteria | 6307 |
| 715 | Ga0496107_0036939 | 3300048910 | Bacteria | 3505 |
| 716 | Ga0496107_0127630 | 3300048910 | Bacteria | 1876 |
| 717 | Ga0496107_0159382 | 3300048910 | Bacteria | 1672 |
| 718 | Ga0496107_0163870 | 3300048910 | Bacteria | 1648 |
| 719 | Ga0496107_0340279 | 3300048910 | Bacteria | 1116 |
| 720 | Ga0496107_0384545 | 3300048910 | Bacteria | 1044 |
| 721 | Ga0496107_0670894 | 3300048910 | Bacteria | 763 |
| 722 | Ga0496107_1282638 | 3300048910 | Unclassified | 524 |
| 723 | Ga0496108_0005054 | 3300048911 | Bacteria | 10659 |
| 724 | Ga0496108_0410677 | 3300048911 | Unclassified | 1182 |
| 725 | Ga0496108_1134728 | 3300048911 | Bacteria | 663 |
| 726 | Ga0496109_0004047 | 3300048912 | Bacteria | 12245 |
| 727 | Ga0496109_0022851 | 3300048912 | Bacteria | 5542 |
| 728 | Ga0496109_0254243 | 3300048912 | Bacteria | 1655 |
| 729 | Ga0496109_0547314 | 3300048912 | Bacteria | 1092 |
| 730 | Ga0496109_1908533 | 3300048912 | Bacteria | 526 |
| 731 | Ga0496109_1971139 | 3300048912 | Bacteria | 516 |
| 732 | Ga0496110_0001649 | 3300048913 | Bacteria | 16372 |
| 733 | Ga0496110_0006018 | 3300048913 | Bacteria | 9554 |
| 734 | Ga0496110_0030168 | 3300048913 | Bacteria | 4673 |
| 735 | Ga0496110_0032271 | 3300048913 | Bacteria | 4522 |
| 736 | Ga0496111_0009769 | 3300048914 | Bacteria | 6413 |
| 737 | Ga0496111_0044116 | 3300048914 | Bacteria | 3205 |
| 738 | Ga0496112_0035398 | 3300048915 | Bacteria | 4863 |
| 739 | Ga0496112_0136820 | 3300048915 | Bacteria | 2419 |
| 740 | Ga0496112_0198989 | 3300048915 | Bacteria | 1963 |
| 741 | Ga0496113_0002738 | 3300048916 | Bacteria | 10360 |
| 742 | Ga0496113_0018235 | 3300048916 | Bacteria | 4887 |
| 743 | Ga0496113_0022120 | 3300048916 | Bacteria | 4492 |
| 744 | Ga0496114_0004676 | 3300048917 | Bacteria | 10644 |
| 745 | Ga0496114_0025026 | 3300048917 | Bacteria | 4876 |
| 746 | Ga0496115_0156435 | 3300048918 | Bacteria | 1883 |
| 747 | Ga0501034_0848369 | 3300049571 | Bacteria | 804 |
| 748 | Ga0501068_0692632 | 3300049584 | Bacteria | 666 |
| 749 | Ga0501069_0448426 | 3300049585 | Bacteria | 767 |
| 750 | Ga0501073_0627850 | 3300049589 | Bacteria | 742 |
| 751 | Ga0501074_0079494 | 3300049590 | Bacteria | 2353 |
| 752 | Ga0501080_0101660 | 3300049742 | Bacteria | 2667 |
| 753 | Ga0501035_1471447 | 3300049822 | Bacteria | 520 |
| 754 | nmdc:mga03n38_792830_c1 | 3300050490 | Bacteria | 551 |
| 755 | nmdc:mga00v17_946026_c1 | 3300050491 | Bacteria | 544 |
| 756 | nmdc:mga0yw44_1045453_c1 | 3300050492 | Bacteria | 552 |
| 757 | nmdc:mga08y16_1856858_c1 | 3300050511 | Bacteria | 554 |
| 758 | Ga0500587_000138 | 3300053739 | Bacteria | 6885 |
| 759 | Ga0466962_0220849 | 3300061719 | Bacteria | 928 |
| 760 | Ga0466962_0413344 | 3300061719 | Bacteria | 676 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10762260 | Ga0163162_107622603 | 69 |
| 2 | 3300041512 | Ga0451853_3358249 | Ga0451853_3358249_401_670 | 79 |
| 3 | 3300048913 | Ga0496110_0032271 | Ga0496110_0032271_1483_1752 | 79 |
| 4 | 3300005366 | Ga0070659_101196792 | Ga0070659_1011967922 | 81 |
| 5 | 3300005367 | Ga0070667_100708424 | Ga0070667_1007084241 | 81 |
| 6 | 3300005578 | Ga0068854_102276236 | Ga0068854_1022762361 | 81 |
| 7 | 3300005842 | Ga0068858_102090360 | Ga0068858_1020903602 | 81 |
| 8 | 3300005843 | Ga0068860_100197813 | Ga0068860_1001978133 | 81 |
| 9 | 3300005844 | Ga0068862_101363624 | Ga0068862_1013636242 | 81 |
| 10 | 3300013104 | Ga0157370_10682368 | Ga0157370_106823682 | 81 |
| 11 | 3300025986 | Ga0207658_10540619 | Ga0207658_105406192 | 81 |
| 12 | 3300028381 | Ga0268264_10011878 | Ga0268264_100118789 | 81 |
| 13 | 3300032002 | Ga0307416_102486880 | Ga0307416_1024868802 | 81 |
| 14 | 3300041509 | Ga0451843_0966362 | Ga0451843_0966362_324_572 | 81 |
| 15 | 3300046660 | Ga0495625_0057447 | Ga0495625_0057447_338_586 | 81 |
| 16 | 3300053739 | Ga0500587_000138 | Ga0500587_000138_2334_2582 | 81 |
| 17 | 3300005530 | Ga0070679_101568906 | Ga0070679_1015689061 | 86 |
| 18 | 3300010375 | Ga0105239_10853917 | Ga0105239_108539172 | 86 |
| 19 | 3300013105 | Ga0157369_10003984 | Ga0157369_1000398415 | 86 |
| 20 | 3300042134 | Ga0450898_047127 | Ga0450898_047127_320_586 | 86 |
| 21 | 3300005336 | Ga0070680_101710288 | Ga0070680_1017102881 | 87 |
| 22 | 3300005339 | Ga0070660_100072622 | Ga0070660_1000726221 | 87 |
| 23 | 3300005339 | Ga0070660_100114199 | Ga0070660_1001141992 | 87 |
| 24 | 3300005366 | Ga0070659_100034514 | Ga0070659_1000345143 | 87 |
| 25 | 3300005366 | Ga0070659_101385352 | Ga0070659_1013853522 | 87 |
| 26 | 3300005564 | Ga0070664_100319834 | Ga0070664_1003198343 | 87 |
| 27 | 3300005578 | Ga0068854_101930246 | Ga0068854_1019302462 | 87 |
| 28 | 3300013296 | Ga0157374_10650187 | Ga0157374_106501872 | 87 |
| 29 | 3300013307 | Ga0157372_10479603 | Ga0157372_104796032 | 87 |
| 30 | 3300025909 | Ga0207705_10289762 | Ga0207705_102897622 | 87 |
| 31 | 3300025917 | Ga0207660_11449314 | Ga0207660_114493142 | 87 |
| 32 | 3300025919 | Ga0207657_10130544 | Ga0207657_101305442 | 87 |
| 33 | 3300025920 | Ga0207649_10034401 | Ga0207649_100344013 | 87 |
| 34 | 3300025920 | Ga0207649_10438490 | Ga0207649_104384901 | 87 |
| 35 | 3300025921 | Ga0207652_10439743 | Ga0207652_104397432 | 87 |
| 36 | 3300025932 | Ga0207690_10039783 | Ga0207690_100397832 | 87 |
| 37 | 3300025932 | Ga0207690_10466721 | Ga0207690_104667212 | 87 |
| 38 | 3300025933 | Ga0207706_10262444 | Ga0207706_102624443 | 87 |
| 39 | 3300025945 | Ga0207679_11003439 | Ga0207679_110034392 | 87 |
| 40 | 3300026067 | Ga0207678_10009864 | Ga0207678_100098648 | 87 |
| 41 | 3300001915 | JGI24741J21665_1004116 | JGI24741J21665_10041163 | 88 |
| 42 | 3300001979 | JGI24740J21852_10006636 | JGI24740J21852_100066364 | 88 |
| 43 | 3300001979 | JGI24740J21852_10044450 | JGI24740J21852_100444502 | 88 |
| 44 | 3300001979 | JGI24740J21852_10111174 | JGI24740J21852_101111742 | 88 |
| 45 | 3300001990 | JGI24737J22298_10178200 | JGI24737J22298_101782002 | 88 |
| 46 | 3300002067 | JGI24735J21928_10024566 | JGI24735J21928_100245662 | 88 |
| 47 | 3300002075 | JGI24738J21930_10069572 | JGI24738J21930_100695721 | 88 |
| 48 | 3300002239 | JGI24034J26672_10051999 | JGI24034J26672_100519991 | 88 |
| 49 | 3300005290 | Ga0065712_10305370 | Ga0065712_103053702 | 88 |
| 50 | 3300005293 | Ga0065715_10412033 | Ga0065715_104120332 | 88 |
| 51 | 3300005327 | Ga0070658_10001056 | Ga0070658_100010566 | 88 |
| 52 | 3300005327 | Ga0070658_10064186 | Ga0070658_100641862 | 88 |
| 53 | 3300005327 | Ga0070658_10092954 | Ga0070658_100929542 | 88 |
| 54 | 3300005327 | Ga0070658_10234519 | Ga0070658_102345192 | 88 |
| 55 | 3300005327 | Ga0070658_10659939 | Ga0070658_106599391 | 88 |
| 56 | 3300005327 | Ga0070658_11051967 | Ga0070658_110519672 | 88 |
| 57 | 3300005328 | Ga0070676_10014314 | Ga0070676_100143142 | 88 |
| 58 | 3300005328 | Ga0070676_10021737 | Ga0070676_100217372 | 88 |
| 59 | 3300005329 | Ga0070683_100001823 | Ga0070683_10000182312 | 88 |
| 60 | 3300005330 | Ga0070690_100624028 | Ga0070690_1006240281 | 88 |
| 61 | 3300005331 | Ga0070670_100022194 | Ga0070670_1000221947 | 88 |
| 62 | 3300005331 | Ga0070670_100029461 | Ga0070670_1000294612 | 88 |
| 63 | 3300005331 | Ga0070670_100041338 | Ga0070670_1000413385 | 88 |
| 64 | 3300005331 | Ga0070670_100140812 | Ga0070670_1001408122 | 88 |
| 65 | 3300005331 | Ga0070670_100670829 | Ga0070670_1006708292 | 88 |
| 66 | 3300005331 | Ga0070670_101920709 | Ga0070670_1019207091 | 88 |
| 67 | 3300005331 | Ga0070670_102024131 | Ga0070670_1020241312 | 88 |
| 68 | 3300005331 | Ga0070670_102098580 | Ga0070670_1020985801 | 88 |
| 69 | 3300005333 | Ga0070677_10518799 | Ga0070677_105187992 | 88 |
| 70 | 3300005334 | Ga0068869_100043873 | Ga0068869_1000438734 | 88 |
| 71 | 3300005334 | Ga0068869_100215651 | Ga0068869_1002156512 | 88 |
| 72 | 3300005334 | Ga0068869_100291638 | Ga0068869_1002916383 | 88 |
| 73 | 3300005334 | Ga0068869_100853130 | Ga0068869_1008531302 | 88 |
| 74 | 3300005335 | Ga0070666_10003456 | Ga0070666_1000345610 | 88 |
| 75 | 3300005335 | Ga0070666_10043454 | Ga0070666_100434542 | 88 |
| 76 | 3300005335 | Ga0070666_10051321 | Ga0070666_100513212 | 88 |
| 77 | 3300005335 | Ga0070666_10528712 | Ga0070666_105287122 | 88 |
| 78 | 3300005336 | Ga0070680_100001306 | Ga0070680_1000013067 | 88 |
| 79 | 3300005336 | Ga0070680_100154756 | Ga0070680_1001547563 | 88 |
| 80 | 3300005336 | Ga0070680_101076432 | Ga0070680_1010764322 | 88 |
| 81 | 3300005336 | Ga0070680_101181277 | Ga0070680_1011812772 | 88 |
| 82 | 3300005337 | Ga0070682_100019091 | Ga0070682_1000190912 | 88 |
| 83 | 3300005337 | Ga0070682_100078258 | Ga0070682_1000782582 | 88 |
| 84 | 3300005338 | Ga0068868_100149441 | Ga0068868_1001494411 | 88 |
| 85 | 3300005338 | Ga0068868_100358143 | Ga0068868_1003581431 | 88 |
| 86 | 3300005338 | Ga0068868_100567498 | Ga0068868_1005674982 | 88 |
| 87 | 3300005338 | Ga0068868_100989463 | Ga0068868_1009894632 | 88 |
| 88 | 3300005338 | Ga0068868_101148399 | Ga0068868_1011483992 | 88 |
| 89 | 3300005339 | Ga0070660_100002280 | Ga0070660_1000022802 | 88 |
| 90 | 3300005339 | Ga0070660_100182022 | Ga0070660_1001820222 | 88 |
| 91 | 3300005339 | Ga0070660_100311592 | Ga0070660_1003115923 | 88 |
| 92 | 3300005339 | Ga0070660_100629583 | Ga0070660_1006295832 | 88 |
| 93 | 3300005339 | Ga0070660_100824980 | Ga0070660_1008249801 | 88 |
| 94 | 3300005339 | Ga0070660_101712182 | Ga0070660_1017121822 | 88 |
| 95 | 3300005341 | Ga0070691_10407110 | Ga0070691_104071102 | 88 |
| 96 | 3300005344 | Ga0070661_100020291 | Ga0070661_1000202914 | 88 |
| 97 | 3300005344 | Ga0070661_100033255 | Ga0070661_1000332552 | 88 |
| 98 | 3300005344 | Ga0070661_100033786 | Ga0070661_1000337862 | 88 |
| 99 | 3300005344 | Ga0070661_100060678 | Ga0070661_1000606785 | 88 |
| 100 | 3300005344 | Ga0070661_100068490 | Ga0070661_1000684902 | 88 |
| 101 | 3300005344 | Ga0070661_100080352 | Ga0070661_1000803522 | 88 |
| 102 | 3300005344 | Ga0070661_100166055 | Ga0070661_1001660552 | 88 |
| 103 | 3300005344 | Ga0070661_100467755 | Ga0070661_1004677552 | 88 |
| 104 | 3300005344 | Ga0070661_100588032 | Ga0070661_1005880321 | 88 |
| 105 | 3300005344 | Ga0070661_100731868 | Ga0070661_1007318682 | 88 |
| 106 | 3300005344 | Ga0070661_101291722 | Ga0070661_1012917221 | 88 |
| 107 | 3300005344 | Ga0070661_101864834 | Ga0070661_1018648341 | 88 |
| 108 | 3300005345 | Ga0070692_10023376 | Ga0070692_100233766 | 88 |
| 109 | 3300005345 | Ga0070692_10104582 | Ga0070692_101045822 | 88 |
| 110 | 3300005347 | Ga0070668_100018998 | Ga0070668_1000189981 | 88 |
| 111 | 3300005347 | Ga0070668_100321102 | Ga0070668_1003211022 | 88 |
| 112 | 3300005347 | Ga0070668_100346955 | Ga0070668_1003469552 | 88 |
| 113 | 3300005347 | Ga0070668_100637813 | Ga0070668_1006378132 | 88 |
| 114 | 3300005347 | Ga0070668_100883144 | Ga0070668_1008831442 | 88 |
| 115 | 3300005347 | Ga0070668_101700548 | Ga0070668_1017005481 | 88 |
| 116 | 3300005347 | Ga0070668_102280429 | Ga0070668_1022804291 | 88 |
| 117 | 3300005353 | Ga0070669_101110824 | Ga0070669_1011108242 | 88 |
| 118 | 3300005353 | Ga0070669_101344153 | Ga0070669_1013441531 | 88 |
| 119 | 3300005353 | Ga0070669_101881252 | Ga0070669_1018812521 | 88 |
| 120 | 3300005353 | Ga0070669_101915434 | Ga0070669_1019154341 | 88 |
| 121 | 3300005354 | Ga0070675_100026302 | Ga0070675_1000263022 | 88 |
| 122 | 3300005354 | Ga0070675_100109167 | Ga0070675_1001091671 | 88 |
| 123 | 3300005354 | Ga0070675_100460169 | Ga0070675_1004601692 | 88 |
| 124 | 3300005354 | Ga0070675_101070983 | Ga0070675_1010709831 | 88 |
| 125 | 3300005355 | Ga0070671_100010695 | Ga0070671_1000106954 | 88 |
| 126 | 3300005355 | Ga0070671_100115166 | Ga0070671_1001151663 | 88 |
| 127 | 3300005355 | Ga0070671_100143086 | Ga0070671_1001430862 | 88 |
| 128 | 3300005355 | Ga0070671_100149951 | Ga0070671_1001499512 | 88 |
| 129 | 3300005355 | Ga0070671_100161403 | Ga0070671_1001614032 | 88 |
| 130 | 3300005355 | Ga0070671_100195176 | Ga0070671_1001951762 | 88 |
| 131 | 3300005355 | Ga0070671_100854568 | Ga0070671_1008545682 | 88 |
| 132 | 3300005355 | Ga0070671_101991096 | Ga0070671_1019910961 | 88 |
| 133 | 3300005356 | Ga0070674_100007740 | Ga0070674_1000077407 | 88 |
| 134 | 3300005356 | Ga0070674_100772644 | Ga0070674_1007726442 | 88 |
| 135 | 3300005356 | Ga0070674_101154814 | Ga0070674_1011548142 | 88 |
| 136 | 3300005364 | Ga0070673_100005116 | Ga0070673_1000051168 | 88 |
| 137 | 3300005364 | Ga0070673_100032534 | Ga0070673_1000325342 | 88 |
| 138 | 3300005364 | Ga0070673_100118869 | Ga0070673_1001188692 | 88 |
| 139 | 3300005364 | Ga0070673_100237403 | Ga0070673_1002374032 | 88 |
| 140 | 3300005364 | Ga0070673_100256536 | Ga0070673_1002565362 | 88 |
| 141 | 3300005364 | Ga0070673_101705671 | Ga0070673_1017056712 | 88 |
| 142 | 3300005366 | Ga0070659_100009647 | Ga0070659_1000096475 | 88 |
| 143 | 3300005366 | Ga0070659_100163543 | Ga0070659_1001635432 | 88 |
| 144 | 3300005366 | Ga0070659_101065561 | Ga0070659_1010655612 | 88 |
| 145 | 3300005366 | Ga0070659_101162179 | Ga0070659_1011621792 | 88 |
| 146 | 3300005366 | Ga0070659_101712431 | Ga0070659_1017124312 | 88 |
| 147 | 3300005367 | Ga0070667_100002393 | Ga0070667_10000239316 | 88 |
| 148 | 3300005367 | Ga0070667_100036352 | Ga0070667_1000363523 | 88 |
| 149 | 3300005367 | Ga0070667_100037369 | Ga0070667_1000373694 | 88 |
| 150 | 3300005367 | Ga0070667_100075329 | Ga0070667_1000753293 | 88 |
| 151 | 3300005367 | Ga0070667_100496086 | Ga0070667_1004960863 | 88 |
| 152 | 3300005367 | Ga0070667_100506945 | Ga0070667_1005069452 | 88 |
| 153 | 3300005367 | Ga0070667_100647498 | Ga0070667_1006474982 | 88 |
| 154 | 3300005367 | Ga0070667_100674901 | Ga0070667_1006749012 | 88 |
| 155 | 3300005367 | Ga0070667_100712488 | Ga0070667_1007124882 | 88 |
| 156 | 3300005367 | Ga0070667_100740857 | Ga0070667_1007408572 | 88 |
| 157 | 3300005367 | Ga0070667_100763163 | Ga0070667_1007631631 | 88 |
| 158 | 3300005367 | Ga0070667_100854720 | Ga0070667_1008547202 | 88 |
| 159 | 3300005436 | Ga0070713_100942658 | Ga0070713_1009426582 | 88 |
| 160 | 3300005437 | Ga0070710_10610693 | Ga0070710_106106932 | 88 |
| 161 | 3300005440 | Ga0070705_100515045 | Ga0070705_1005150452 | 88 |
| 162 | 3300005440 | Ga0070705_101150988 | Ga0070705_1011509882 | 88 |
| 163 | 3300005455 | Ga0070663_100000271 | Ga0070663_10000027122 | 88 |
| 164 | 3300005455 | Ga0070663_100057324 | Ga0070663_1000573244 | 88 |
| 165 | 3300005455 | Ga0070663_100097344 | Ga0070663_1000973443 | 88 |
| 166 | 3300005455 | Ga0070663_100307846 | Ga0070663_1003078462 | 88 |
| 167 | 3300005455 | Ga0070663_100391464 | Ga0070663_1003914641 | 88 |
| 168 | 3300005455 | Ga0070663_100482154 | Ga0070663_1004821542 | 88 |
| 169 | 3300005455 | Ga0070663_100731588 | Ga0070663_1007315881 | 88 |
| 170 | 3300005456 | Ga0070678_100011061 | Ga0070678_1000110613 | 88 |
| 171 | 3300005456 | Ga0070678_100158426 | Ga0070678_1001584262 | 88 |
| 172 | 3300005456 | Ga0070678_102050242 | Ga0070678_1020502421 | 88 |
| 173 | 3300005457 | Ga0070662_100001018 | Ga0070662_10000101814 | 88 |
| 174 | 3300005457 | Ga0070662_100074011 | Ga0070662_1000740112 | 88 |
| 175 | 3300005457 | Ga0070662_100161640 | Ga0070662_1001616402 | 88 |
| 176 | 3300005457 | Ga0070662_100664919 | Ga0070662_1006649191 | 88 |
| 177 | 3300005458 | Ga0070681_10015737 | Ga0070681_100157373 | 88 |
| 178 | 3300005458 | Ga0070681_10067960 | Ga0070681_100679602 | 88 |
| 179 | 3300005458 | Ga0070681_10431034 | Ga0070681_104310342 | 88 |
| 180 | 3300005458 | Ga0070681_11690843 | Ga0070681_116908432 | 88 |
| 181 | 3300005459 | Ga0068867_100003017 | Ga0068867_1000030173 | 88 |
| 182 | 3300005459 | Ga0068867_100227968 | Ga0068867_1002279683 | 88 |
| 183 | 3300005466 | Ga0070685_10057069 | Ga0070685_100570692 | 88 |
| 184 | 3300005466 | Ga0070685_11059549 | Ga0070685_110595492 | 88 |
| 185 | 3300005530 | Ga0070679_100000346 | Ga0070679_10000034629 | 88 |
| 186 | 3300005530 | Ga0070679_100332434 | Ga0070679_1003324342 | 88 |
| 187 | 3300005530 | Ga0070679_100340672 | Ga0070679_1003406722 | 88 |
| 188 | 3300005530 | Ga0070679_101099751 | Ga0070679_1010997511 | 88 |
| 189 | 3300005535 | Ga0070684_101221319 | Ga0070684_1012213192 | 88 |
| 190 | 3300005536 | Ga0070697_101176841 | Ga0070697_1011768412 | 88 |
| 191 | 3300005539 | Ga0068853_100039150 | Ga0068853_1000391506 | 88 |
| 192 | 3300005539 | Ga0068853_100107496 | Ga0068853_1001074963 | 88 |
| 193 | 3300005539 | Ga0068853_100345817 | Ga0068853_1003458172 | 88 |
| 194 | 3300005539 | Ga0068853_100428474 | Ga0068853_1004284742 | 88 |
| 195 | 3300005539 | Ga0068853_100923459 | Ga0068853_1009234592 | 88 |
| 196 | 3300005539 | Ga0068853_100984180 | Ga0068853_1009841802 | 88 |
| 197 | 3300005539 | Ga0068853_102073122 | Ga0068853_1020731221 | 88 |
| 198 | 3300005543 | Ga0070672_100064580 | Ga0070672_1000645804 | 88 |
| 199 | 3300005543 | Ga0070672_100102934 | Ga0070672_1001029343 | 88 |
| 200 | 3300005543 | Ga0070672_100125287 | Ga0070672_1001252872 | 88 |
| 201 | 3300005543 | Ga0070672_100139318 | Ga0070672_1001393182 | 88 |
| 202 | 3300005543 | Ga0070672_100725664 | Ga0070672_1007256642 | 88 |
| 203 | 3300005544 | Ga0070686_101439915 | Ga0070686_1014399151 | 88 |
| 204 | 3300005545 | Ga0070695_100834250 | Ga0070695_1008342501 | 88 |
| 205 | 3300005546 | Ga0070696_100344834 | Ga0070696_1003448342 | 88 |
| 206 | 3300005547 | Ga0070693_100723640 | Ga0070693_1007236402 | 88 |
| 207 | 3300005547 | Ga0070693_100741077 | Ga0070693_1007410772 | 88 |
| 208 | 3300005548 | Ga0070665_100047018 | Ga0070665_1000470186 | 88 |
| 209 | 3300005548 | Ga0070665_100724673 | Ga0070665_1007246732 | 88 |
| 210 | 3300005548 | Ga0070665_100944391 | Ga0070665_1009443912 | 88 |
| 211 | 3300005563 | Ga0068855_100009125 | Ga0068855_1000091252 | 88 |
| 212 | 3300005563 | Ga0068855_100083160 | Ga0068855_1000831604 | 88 |
| 213 | 3300005563 | Ga0068855_100582068 | Ga0068855_1005820682 | 88 |
| 214 | 3300005564 | Ga0070664_100006576 | Ga0070664_1000065767 | 88 |
| 215 | 3300005564 | Ga0070664_100012615 | Ga0070664_1000126152 | 88 |
| 216 | 3300005564 | Ga0070664_100035259 | Ga0070664_1000352597 | 88 |
| 217 | 3300005564 | Ga0070664_100064886 | Ga0070664_1000648862 | 88 |
| 218 | 3300005564 | Ga0070664_100081576 | Ga0070664_1000815762 | 88 |
| 219 | 3300005564 | Ga0070664_100177496 | Ga0070664_1001774962 | 88 |
| 220 | 3300005564 | Ga0070664_100321986 | Ga0070664_1003219862 | 88 |
| 221 | 3300005577 | Ga0068857_100010349 | Ga0068857_1000103498 | 88 |
| 222 | 3300005577 | Ga0068857_100040473 | Ga0068857_1000404736 | 88 |
| 223 | 3300005577 | Ga0068857_100587708 | Ga0068857_1005877082 | 88 |
| 224 | 3300005577 | Ga0068857_101131274 | Ga0068857_1011312741 | 88 |
| 225 | 3300005578 | Ga0068854_100043054 | Ga0068854_1000430545 | 88 |
| 226 | 3300005578 | Ga0068854_100110134 | Ga0068854_1001101343 | 88 |
| 227 | 3300005578 | Ga0068854_100117343 | Ga0068854_1001173432 | 88 |
| 228 | 3300005578 | Ga0068854_100507859 | Ga0068854_1005078592 | 88 |
| 229 | 3300005578 | Ga0068854_100732837 | Ga0068854_1007328372 | 88 |
| 230 | 3300005614 | Ga0068856_100016476 | Ga0068856_1000164764 | 88 |
| 231 | 3300005614 | Ga0068856_100018394 | Ga0068856_1000183947 | 88 |
| 232 | 3300005614 | Ga0068856_100315111 | Ga0068856_1003151112 | 88 |
| 233 | 3300005614 | Ga0068856_100725498 | Ga0068856_1007254982 | 88 |
| 234 | 3300005614 | Ga0068856_100975793 | Ga0068856_1009757932 | 88 |
| 235 | 3300005614 | Ga0068856_101285131 | Ga0068856_1012851312 | 88 |
| 236 | 3300005614 | Ga0068856_101897954 | Ga0068856_1018979541 | 88 |
| 237 | 3300005615 | Ga0070702_100145871 | Ga0070702_1001458713 | 88 |
| 238 | 3300005616 | Ga0068852_100005849 | Ga0068852_1000058491 | 88 |
| 239 | 3300005616 | Ga0068852_100035562 | Ga0068852_1000355621 | 88 |
| 240 | 3300005616 | Ga0068852_100083782 | Ga0068852_1000837822 | 88 |
| 241 | 3300005616 | Ga0068852_100144204 | Ga0068852_1001442043 | 88 |
| 242 | 3300005616 | Ga0068852_100179808 | Ga0068852_1001798082 | 88 |
| 243 | 3300005616 | Ga0068852_100236611 | Ga0068852_1002366111 | 88 |
| 244 | 3300005616 | Ga0068852_100331534 | Ga0068852_1003315342 | 88 |
| 245 | 3300005617 | Ga0068859_100051278 | Ga0068859_1000512786 | 88 |
| 246 | 3300005617 | Ga0068859_100335433 | Ga0068859_1003354332 | 88 |
| 247 | 3300005617 | Ga0068859_100434249 | Ga0068859_1004342492 | 88 |
| 248 | 3300005617 | Ga0068859_101256627 | Ga0068859_1012566272 | 88 |
| 249 | 3300005617 | Ga0068859_102158555 | Ga0068859_1021585552 | 88 |
| 250 | 3300005617 | Ga0068859_102831081 | Ga0068859_1028310812 | 88 |
| 251 | 3300005618 | Ga0068864_100010864 | Ga0068864_1000108644 | 88 |
| 252 | 3300005618 | Ga0068864_100012608 | Ga0068864_1000126088 | 88 |
| 253 | 3300005618 | Ga0068864_100210534 | Ga0068864_1002105343 | 88 |
| 254 | 3300005618 | Ga0068864_100343428 | Ga0068864_1003434282 | 88 |
| 255 | 3300005618 | Ga0068864_100877709 | Ga0068864_1008777092 | 88 |
| 256 | 3300005718 | Ga0068866_11044380 | Ga0068866_110443801 | 88 |
| 257 | 3300005719 | Ga0068861_101299803 | Ga0068861_1012998032 | 88 |
| 258 | 3300005719 | Ga0068861_101748846 | Ga0068861_1017488461 | 88 |
| 259 | 3300005834 | Ga0068851_10001758 | Ga0068851_100017584 | 88 |
| 260 | 3300005834 | Ga0068851_10062144 | Ga0068851_100621442 | 88 |
| 261 | 3300005834 | Ga0068851_10069537 | Ga0068851_100695372 | 88 |
| 262 | 3300005834 | Ga0068851_10073656 | Ga0068851_100736562 | 88 |
| 263 | 3300005834 | Ga0068851_10130077 | Ga0068851_101300772 | 88 |
| 264 | 3300005840 | Ga0068870_10037294 | Ga0068870_100372943 | 88 |
| 265 | 3300005840 | Ga0068870_10301164 | Ga0068870_103011643 | 88 |
| 266 | 3300005841 | Ga0068863_100000607 | Ga0068863_10000060713 | 88 |
| 267 | 3300005841 | Ga0068863_100011565 | Ga0068863_1000115655 | 88 |
| 268 | 3300005841 | Ga0068863_100043854 | Ga0068863_1000438543 | 88 |
| 269 | 3300005841 | Ga0068863_100252699 | Ga0068863_1002526992 | 88 |
| 270 | 3300005842 | Ga0068858_100006875 | Ga0068858_10000687510 | 88 |
| 271 | 3300005842 | Ga0068858_100032216 | Ga0068858_1000322166 | 88 |
| 272 | 3300005842 | Ga0068858_100525312 | Ga0068858_1005253123 | 88 |
| 273 | 3300005842 | Ga0068858_101562566 | Ga0068858_1015625662 | 88 |
| 274 | 3300005842 | Ga0068858_102196719 | Ga0068858_1021967192 | 88 |
| 275 | 3300005843 | Ga0068860_100063733 | Ga0068860_1000637332 | 88 |
| 276 | 3300005843 | Ga0068860_100160363 | Ga0068860_1001603632 | 88 |
| 277 | 3300005843 | Ga0068860_100180289 | Ga0068860_1001802892 | 88 |
| 278 | 3300005843 | Ga0068860_100962590 | Ga0068860_1009625901 | 88 |
| 279 | 3300005843 | Ga0068860_102435410 | Ga0068860_1024354101 | 88 |
| 280 | 3300005844 | Ga0068862_100223546 | Ga0068862_1002235462 | 88 |
| 281 | 3300005844 | Ga0068862_100620056 | Ga0068862_1006200562 | 88 |
| 282 | 3300005844 | Ga0068862_100624199 | Ga0068862_1006241992 | 88 |
| 283 | 3300005985 | Ga0081539_10022959 | Ga0081539_100229592 | 88 |
| 284 | 3300006038 | Ga0075365_11185979 | Ga0075365_111859792 | 88 |
| 285 | 3300006048 | Ga0075363_100911267 | Ga0075363_1009112672 | 88 |
| 286 | 3300006051 | Ga0075364_10602526 | Ga0075364_106025262 | 88 |
| 287 | 3300006237 | Ga0097621_100034174 | Ga0097621_1000341742 | 88 |
| 288 | 3300006237 | Ga0097621_100049260 | Ga0097621_1000492602 | 88 |
| 289 | 3300006237 | Ga0097621_100083846 | Ga0097621_1000838464 | 88 |
| 290 | 3300006358 | Ga0068871_100030913 | Ga0068871_1000309133 | 88 |
| 291 | 3300006358 | Ga0068871_100088118 | Ga0068871_1000881184 | 88 |
| 292 | 3300006358 | Ga0068871_100109365 | Ga0068871_1001093653 | 88 |
| 293 | 3300006358 | Ga0068871_100125435 | Ga0068871_1001254352 | 88 |
| 294 | 3300006358 | Ga0068871_100502613 | Ga0068871_1005026132 | 88 |
| 295 | 3300006358 | Ga0068871_100660570 | Ga0068871_1006605702 | 88 |
| 296 | 3300006881 | Ga0068865_100105243 | Ga0068865_1001052433 | 88 |
| 297 | 3300006881 | Ga0068865_100120487 | Ga0068865_1001204872 | 88 |
| 298 | 3300006881 | Ga0068865_100610670 | Ga0068865_1006106702 | 88 |
| 299 | 3300006881 | Ga0068865_101765758 | Ga0068865_1017657582 | 88 |
| 300 | 3300006931 | Ga0097620_100051278 | Ga0097620_1000512786 | 88 |
| 301 | 3300006931 | Ga0097620_100335428 | Ga0097620_1003354282 | 88 |
| 302 | 3300006931 | Ga0097620_100434237 | Ga0097620_1004342372 | 88 |
| 303 | 3300006931 | Ga0097620_101256489 | Ga0097620_1012564892 | 88 |
| 304 | 3300006931 | Ga0097620_102158321 | Ga0097620_1021583212 | 88 |
| 305 | 3300006931 | Ga0097620_102830879 | Ga0097620_1028308792 | 88 |
| 306 | 3300007076 | Ga0075435_100135083 | Ga0075435_1001350832 | 88 |
| 307 | 3300009094 | Ga0111539_10188678 | Ga0111539_101886782 | 88 |
| 308 | 3300009094 | Ga0111539_11832955 | Ga0111539_118329551 | 88 |
| 309 | 3300009098 | Ga0105245_11832706 | Ga0105245_118327062 | 88 |
| 310 | 3300009098 | Ga0105245_13235962 | Ga0105245_132359622 | 88 |
| 311 | 3300009101 | Ga0105247_10245877 | Ga0105247_102458772 | 88 |
| 312 | 3300009148 | Ga0105243_10472642 | Ga0105243_104726422 | 88 |
| 313 | 3300009174 | Ga0105241_10858151 | Ga0105241_108581512 | 88 |
| 314 | 3300009177 | Ga0105248_10003825 | Ga0105248_100038254 | 88 |
| 315 | 3300009177 | Ga0105248_10003900 | Ga0105248_100039003 | 88 |
| 316 | 3300009177 | Ga0105248_10028196 | Ga0105248_100281966 | 88 |
| 317 | 3300009177 | Ga0105248_10031637 | Ga0105248_100316378 | 88 |
| 318 | 3300009177 | Ga0105248_10050987 | Ga0105248_100509874 | 88 |
| 319 | 3300009177 | Ga0105248_10369712 | Ga0105248_103697122 | 88 |
| 320 | 3300009177 | Ga0105248_10856061 | Ga0105248_108560612 | 88 |
| 321 | 3300009177 | Ga0105248_11878887 | Ga0105248_118788871 | 88 |
| 322 | 3300009177 | Ga0105248_12929703 | Ga0105248_129297032 | 88 |
| 323 | 3300009545 | Ga0105237_10008511 | Ga0105237_100085116 | 88 |
| 324 | 3300009545 | Ga0105237_10026407 | Ga0105237_100264072 | 88 |
| 325 | 3300009545 | Ga0105237_10106121 | Ga0105237_101061212 | 88 |
| 326 | 3300009551 | Ga0105238_10163614 | Ga0105238_101636142 | 88 |
| 327 | 3300009551 | Ga0105238_11631009 | Ga0105238_116310092 | 88 |
| 328 | 3300009551 | Ga0105238_12452109 | Ga0105238_124521091 | 88 |
| 329 | 3300009553 | Ga0105249_10119887 | Ga0105249_101198872 | 88 |
| 330 | 3300009553 | Ga0105249_12162334 | Ga0105249_121623342 | 88 |
| 331 | 3300011119 | Ga0105246_10738399 | Ga0105246_107383992 | 88 |
| 332 | 3300011119 | Ga0105246_12107904 | Ga0105246_121079041 | 88 |
| 333 | 3300013100 | Ga0157373_10062376 | Ga0157373_100623762 | 88 |
| 334 | 3300013100 | Ga0157373_10063721 | Ga0157373_100637212 | 88 |
| 335 | 3300013100 | Ga0157373_10065815 | Ga0157373_100658152 | 88 |
| 336 | 3300013100 | Ga0157373_10069494 | Ga0157373_100694942 | 88 |
| 337 | 3300013100 | Ga0157373_10542954 | Ga0157373_105429542 | 88 |
| 338 | 3300013100 | Ga0157373_10614010 | Ga0157373_106140102 | 88 |
| 339 | 3300013102 | Ga0157371_10048437 | Ga0157371_100484372 | 88 |
| 340 | 3300013102 | Ga0157371_10161022 | Ga0157371_101610222 | 88 |
| 341 | 3300013102 | Ga0157371_10178891 | Ga0157371_101788912 | 88 |
| 342 | 3300013104 | Ga0157370_10009490 | Ga0157370_100094904 | 88 |
| 343 | 3300013104 | Ga0157370_10101505 | Ga0157370_101015052 | 88 |
| 344 | 3300013104 | Ga0157370_10240149 | Ga0157370_102401492 | 88 |
| 345 | 3300013104 | Ga0157370_11276736 | Ga0157370_112767362 | 88 |
| 346 | 3300013105 | Ga0157369_10046645 | Ga0157369_100466453 | 88 |
| 347 | 3300013105 | Ga0157369_10589237 | Ga0157369_105892372 | 88 |
| 348 | 3300013105 | Ga0157369_11741992 | Ga0157369_117419922 | 88 |
| 349 | 3300013105 | Ga0157369_12212906 | Ga0157369_122129061 | 88 |
| 350 | 3300013296 | Ga0157374_10051565 | Ga0157374_100515652 | 88 |
| 351 | 3300013296 | Ga0157374_10059163 | Ga0157374_100591632 | 88 |
| 352 | 3300013296 | Ga0157374_10126976 | Ga0157374_101269766 | 88 |
| 353 | 3300013296 | Ga0157374_10165252 | Ga0157374_101652522 | 88 |
| 354 | 3300013297 | Ga0157378_10289604 | Ga0157378_102896042 | 88 |
| 355 | 3300013306 | Ga0163162_10004976 | Ga0163162_1000497610 | 88 |
| 356 | 3300013306 | Ga0163162_10013507 | Ga0163162_100135079 | 88 |
| 357 | 3300013306 | Ga0163162_10293129 | Ga0163162_102931292 | 88 |
| 358 | 3300013306 | Ga0163162_11117790 | Ga0163162_111177902 | 88 |
| 359 | 3300013306 | Ga0163162_13371909 | Ga0163162_133719091 | 88 |
| 360 | 3300013307 | Ga0157372_10584450 | Ga0157372_105844503 | 88 |
| 361 | 3300013307 | Ga0157372_10595510 | Ga0157372_105955102 | 88 |
| 362 | 3300013307 | Ga0157372_11465684 | Ga0157372_114656842 | 88 |
| 363 | 3300013307 | Ga0157372_12432697 | Ga0157372_124326972 | 88 |
| 364 | 3300013308 | Ga0157375_10005040 | Ga0157375_100050407 | 88 |
| 365 | 3300013308 | Ga0157375_10044879 | Ga0157375_100448792 | 88 |
| 366 | 3300013308 | Ga0157375_10060068 | Ga0157375_100600682 | 88 |
| 367 | 3300013308 | Ga0157375_10216451 | Ga0157375_102164512 | 88 |
| 368 | 3300013308 | Ga0157375_10258090 | Ga0157375_102580902 | 88 |
| 369 | 3300013308 | Ga0157375_10286423 | Ga0157375_102864234 | 88 |
| 370 | 3300014325 | Ga0163163_10014443 | Ga0163163_100144434 | 88 |
| 371 | 3300014325 | Ga0163163_10074586 | Ga0163163_100745862 | 88 |
| 372 | 3300014325 | Ga0163163_10328718 | Ga0163163_103287183 | 88 |
| 373 | 3300014497 | Ga0182008_10162231 | Ga0182008_101622312 | 88 |
| 374 | 3300014968 | Ga0157379_10001583 | Ga0157379_1000158318 | 88 |
| 375 | 3300014968 | Ga0157379_10502426 | Ga0157379_105024261 | 88 |
| 376 | 3300017792 | Ga0163161_10003295 | Ga0163161_100032954 | 88 |
| 377 | 3300017792 | Ga0163161_10524637 | Ga0163161_105246372 | 88 |
| 378 | 3300017792 | Ga0163161_10687361 | Ga0163161_106873612 | 88 |
| 379 | 3300020081 | Ga0206354_11449613 | Ga0206354_114496131 | 88 |
| 380 | 3300020082 | Ga0206353_10096358 | Ga0206353_100963582 | 88 |
| 381 | 3300025315 | Ga0207697_10163476 | Ga0207697_101634761 | 88 |
| 382 | 3300025315 | Ga0207697_10202809 | Ga0207697_102028092 | 88 |
| 383 | 3300025315 | Ga0207697_10396360 | Ga0207697_103963601 | 88 |
| 384 | 3300025321 | Ga0207656_10051512 | Ga0207656_100515122 | 88 |
| 385 | 3300025321 | Ga0207656_10054119 | Ga0207656_100541192 | 88 |
| 386 | 3300025321 | Ga0207656_10065642 | Ga0207656_100656423 | 88 |
| 387 | 3300025321 | Ga0207656_10212696 | Ga0207656_102126962 | 88 |
| 388 | 3300025901 | Ga0207688_10007813 | Ga0207688_100078138 | 88 |
| 389 | 3300025901 | Ga0207688_10158879 | Ga0207688_101588792 | 88 |
| 390 | 3300025901 | Ga0207688_10624526 | Ga0207688_106245262 | 88 |
| 391 | 3300025903 | Ga0207680_10035471 | Ga0207680_100354712 | 88 |
| 392 | 3300025903 | Ga0207680_10038224 | Ga0207680_100382243 | 88 |
| 393 | 3300025903 | Ga0207680_10327492 | Ga0207680_103274922 | 88 |
| 394 | 3300025904 | Ga0207647_10016084 | Ga0207647_100160843 | 88 |
| 395 | 3300025904 | Ga0207647_10360989 | Ga0207647_103609892 | 88 |
| 396 | 3300025904 | Ga0207647_10603305 | Ga0207647_106033052 | 88 |
| 397 | 3300025904 | Ga0207647_10816434 | Ga0207647_108164341 | 88 |
| 398 | 3300025905 | Ga0207685_10736048 | Ga0207685_107360482 | 88 |
| 399 | 3300025907 | Ga0207645_10001636 | Ga0207645_1000163615 | 88 |
| 400 | 3300025907 | Ga0207645_10005404 | Ga0207645_100054047 | 88 |
| 401 | 3300025907 | Ga0207645_10932327 | Ga0207645_109323272 | 88 |
| 402 | 3300025908 | Ga0207643_10054640 | Ga0207643_100546403 | 88 |
| 403 | 3300025909 | Ga0207705_10000270 | Ga0207705_1000027039 | 88 |
| 404 | 3300025909 | Ga0207705_10072190 | Ga0207705_100721902 | 88 |
| 405 | 3300025909 | Ga0207705_10369909 | Ga0207705_103699092 | 88 |
| 406 | 3300025909 | Ga0207705_10528072 | Ga0207705_105280722 | 88 |
| 407 | 3300025909 | Ga0207705_10708748 | Ga0207705_107087482 | 88 |
| 408 | 3300025909 | Ga0207705_10862427 | Ga0207705_108624272 | 88 |
| 409 | 3300025911 | Ga0207654_10335828 | Ga0207654_103358282 | 88 |
| 410 | 3300025912 | Ga0207707_10015148 | Ga0207707_100151482 | 88 |
| 411 | 3300025912 | Ga0207707_10049824 | Ga0207707_100498242 | 88 |
| 412 | 3300025914 | Ga0207671_10020935 | Ga0207671_100209352 | 88 |
| 413 | 3300025914 | Ga0207671_10076405 | Ga0207671_100764053 | 88 |
| 414 | 3300025917 | Ga0207660_10002965 | Ga0207660_1000296512 | 88 |
| 415 | 3300025917 | Ga0207660_10005305 | Ga0207660_100053052 | 88 |
| 416 | 3300025917 | Ga0207660_10096380 | Ga0207660_100963803 | 88 |
| 417 | 3300025917 | Ga0207660_10721510 | Ga0207660_107215102 | 88 |
| 418 | 3300025919 | Ga0207657_10001091 | Ga0207657_1000109113 | 88 |
| 419 | 3300025919 | Ga0207657_10003456 | Ga0207657_1000345610 | 88 |
| 420 | 3300025919 | Ga0207657_10005074 | Ga0207657_100050742 | 88 |
| 421 | 3300025919 | Ga0207657_10012494 | Ga0207657_100124947 | 88 |
| 422 | 3300025919 | Ga0207657_10020199 | Ga0207657_100201992 | 88 |
| 423 | 3300025919 | Ga0207657_10024128 | Ga0207657_100241286 | 88 |
| 424 | 3300025919 | Ga0207657_10054575 | Ga0207657_100545752 | 88 |
| 425 | 3300025919 | Ga0207657_10162912 | Ga0207657_101629121 | 88 |
| 426 | 3300025920 | Ga0207649_10056199 | Ga0207649_100561991 | 88 |
| 427 | 3300025920 | Ga0207649_10082203 | Ga0207649_100822032 | 88 |
| 428 | 3300025920 | Ga0207649_10085096 | Ga0207649_100850962 | 88 |
| 429 | 3300025920 | Ga0207649_10144769 | Ga0207649_101447692 | 88 |
| 430 | 3300025920 | Ga0207649_10147832 | Ga0207649_101478322 | 88 |
| 431 | 3300025920 | Ga0207649_10248910 | Ga0207649_102489102 | 88 |
| 432 | 3300025920 | Ga0207649_10464386 | Ga0207649_104643862 | 88 |
| 433 | 3300025920 | Ga0207649_10486017 | Ga0207649_104860172 | 88 |
| 434 | 3300025921 | Ga0207652_10000058 | Ga0207652_1000005879 | 88 |
| 435 | 3300025923 | Ga0207681_10048589 | Ga0207681_100485893 | 88 |
| 436 | 3300025923 | Ga0207681_10173070 | Ga0207681_101730702 | 88 |
| 437 | 3300025924 | Ga0207694_10041515 | Ga0207694_100415152 | 88 |
| 438 | 3300025925 | Ga0207650_10008323 | Ga0207650_100083238 | 88 |
| 439 | 3300025925 | Ga0207650_10021388 | Ga0207650_100213883 | 88 |
| 440 | 3300025925 | Ga0207650_10069382 | Ga0207650_100693822 | 88 |
| 441 | 3300025925 | Ga0207650_10168879 | Ga0207650_101688792 | 88 |
| 442 | 3300025925 | Ga0207650_10403309 | Ga0207650_104033092 | 88 |
| 443 | 3300025925 | Ga0207650_10650052 | Ga0207650_106500522 | 88 |
| 444 | 3300025925 | Ga0207650_11121088 | Ga0207650_111210882 | 88 |
| 445 | 3300025925 | Ga0207650_11620018 | Ga0207650_116200181 | 88 |
| 446 | 3300025926 | Ga0207659_10007014 | Ga0207659_100070149 | 88 |
| 447 | 3300025926 | Ga0207659_10187861 | Ga0207659_101878612 | 88 |
| 448 | 3300025926 | Ga0207659_10393399 | Ga0207659_103933992 | 88 |
| 449 | 3300025926 | Ga0207659_10621381 | Ga0207659_106213812 | 88 |
| 450 | 3300025928 | Ga0207700_10644479 | Ga0207700_106444792 | 88 |
| 451 | 3300025931 | Ga0207644_10043535 | Ga0207644_100435352 | 88 |
| 452 | 3300025931 | Ga0207644_10069764 | Ga0207644_100697643 | 88 |
| 453 | 3300025931 | Ga0207644_10081793 | Ga0207644_100817933 | 88 |
| 454 | 3300025931 | Ga0207644_10099178 | Ga0207644_100991782 | 88 |
| 455 | 3300025931 | Ga0207644_10155359 | Ga0207644_101553591 | 88 |
| 456 | 3300025931 | Ga0207644_10336485 | Ga0207644_103364852 | 88 |
| 457 | 3300025932 | Ga0207690_10016622 | Ga0207690_100166224 | 88 |
| 458 | 3300025932 | Ga0207690_10488920 | Ga0207690_104889202 | 88 |
| 459 | 3300025932 | Ga0207690_10501046 | Ga0207690_105010463 | 88 |
| 460 | 3300025932 | Ga0207690_10698425 | Ga0207690_106984252 | 88 |
| 461 | 3300025933 | Ga0207706_10004209 | Ga0207706_100042094 | 88 |
| 462 | 3300025933 | Ga0207706_10004893 | Ga0207706_1000489312 | 88 |
| 463 | 3300025933 | Ga0207706_10109683 | Ga0207706_101096832 | 88 |
| 464 | 3300025933 | Ga0207706_10132115 | Ga0207706_101321152 | 88 |
| 465 | 3300025933 | Ga0207706_10348575 | Ga0207706_103485752 | 88 |
| 466 | 3300025933 | Ga0207706_11484006 | Ga0207706_114840061 | 88 |
| 467 | 3300025937 | Ga0207669_10004891 | Ga0207669_100048912 | 88 |
| 468 | 3300025937 | Ga0207669_10119669 | Ga0207669_101196692 | 88 |
| 469 | 3300025937 | Ga0207669_10240714 | Ga0207669_102407142 | 88 |
| 470 | 3300025938 | Ga0207704_10459181 | Ga0207704_104591813 | 88 |
| 471 | 3300025938 | Ga0207704_10805168 | Ga0207704_108051682 | 88 |
| 472 | 3300025938 | Ga0207704_11040238 | Ga0207704_110402381 | 88 |
| 473 | 3300025940 | Ga0207691_10010453 | Ga0207691_100104536 | 88 |
| 474 | 3300025940 | Ga0207691_10028885 | Ga0207691_100288854 | 88 |
| 475 | 3300025940 | Ga0207691_10054138 | Ga0207691_100541384 | 88 |
| 476 | 3300025940 | Ga0207691_10113632 | Ga0207691_101136323 | 88 |
| 477 | 3300025940 | Ga0207691_10845599 | Ga0207691_108455992 | 88 |
| 478 | 3300025941 | Ga0207711_10001131 | Ga0207711_1000113114 | 88 |
| 479 | 3300025941 | Ga0207711_10005984 | Ga0207711_100059848 | 88 |
| 480 | 3300025941 | Ga0207711_10018447 | Ga0207711_100184474 | 88 |
| 481 | 3300025941 | Ga0207711_10032438 | Ga0207711_100324381 | 88 |
| 482 | 3300025941 | Ga0207711_10440992 | Ga0207711_104409922 | 88 |
| 483 | 3300025941 | Ga0207711_10516009 | Ga0207711_105160092 | 88 |
| 484 | 3300025942 | Ga0207689_10017153 | Ga0207689_100171532 | 88 |
| 485 | 3300025942 | Ga0207689_10047270 | Ga0207689_100472706 | 88 |
| 486 | 3300025942 | Ga0207689_10299012 | Ga0207689_102990123 | 88 |
| 487 | 3300025942 | Ga0207689_10453176 | Ga0207689_104531762 | 88 |
| 488 | 3300025944 | Ga0207661_10002950 | Ga0207661_100029509 | 88 |
| 489 | 3300025944 | Ga0207661_10588457 | Ga0207661_105884572 | 88 |
| 490 | 3300025945 | Ga0207679_10024262 | Ga0207679_100242627 | 88 |
| 491 | 3300025945 | Ga0207679_10130236 | Ga0207679_101302363 | 88 |
| 492 | 3300025945 | Ga0207679_10205059 | Ga0207679_102050592 | 88 |
| 493 | 3300025945 | Ga0207679_10272052 | Ga0207679_102720522 | 88 |
| 494 | 3300025945 | Ga0207679_10343395 | Ga0207679_103433952 | 88 |
| 495 | 3300025945 | Ga0207679_10836822 | Ga0207679_108368222 | 88 |
| 496 | 3300025949 | Ga0207667_10006485 | Ga0207667_1000648513 | 88 |
| 497 | 3300025949 | Ga0207667_10254582 | Ga0207667_102545823 | 88 |
| 498 | 3300025949 | Ga0207667_11084303 | Ga0207667_110843032 | 88 |
| 499 | 3300025960 | Ga0207651_10002688 | Ga0207651_100026889 | 88 |
| 500 | 3300025960 | Ga0207651_10014420 | Ga0207651_100144202 | 88 |
| 501 | 3300025960 | Ga0207651_10238208 | Ga0207651_102382082 | 88 |
| 502 | 3300025960 | Ga0207651_10262071 | Ga0207651_102620713 | 88 |
| 503 | 3300025961 | Ga0207712_11266493 | Ga0207712_112664932 | 88 |
| 504 | 3300025961 | Ga0207712_11328481 | Ga0207712_113284812 | 88 |
| 505 | 3300025972 | Ga0207668_10000086 | Ga0207668_1000008645 | 88 |
| 506 | 3300025972 | Ga0207668_10178623 | Ga0207668_101786232 | 88 |
| 507 | 3300025972 | Ga0207668_10184657 | Ga0207668_101846572 | 88 |
| 508 | 3300025972 | Ga0207668_10186813 | Ga0207668_101868133 | 88 |
| 509 | 3300025972 | Ga0207668_11548574 | Ga0207668_115485742 | 88 |
| 510 | 3300025972 | Ga0207668_11654106 | Ga0207668_116541061 | 88 |
| 511 | 3300025981 | Ga0207640_10029285 | Ga0207640_100292852 | 88 |
| 512 | 3300025981 | Ga0207640_10280521 | Ga0207640_102805212 | 88 |
| 513 | 3300025981 | Ga0207640_10464213 | Ga0207640_104642132 | 88 |
| 514 | 3300025981 | Ga0207640_10665921 | Ga0207640_106659212 | 88 |
| 515 | 3300025986 | Ga0207658_10002031 | Ga0207658_1000203118 | 88 |
| 516 | 3300025986 | Ga0207658_10010473 | Ga0207658_100104733 | 88 |
| 517 | 3300025986 | Ga0207658_10043070 | Ga0207658_100430705 | 88 |
| 518 | 3300025986 | Ga0207658_10043350 | Ga0207658_100433502 | 88 |
| 519 | 3300025986 | Ga0207658_10046411 | Ga0207658_100464114 | 88 |
| 520 | 3300025986 | Ga0207658_10056646 | Ga0207658_100566462 | 88 |
| 521 | 3300025986 | Ga0207658_10068404 | Ga0207658_100684043 | 88 |
| 522 | 3300025986 | Ga0207658_10151755 | Ga0207658_101517552 | 88 |
| 523 | 3300025986 | Ga0207658_10363907 | Ga0207658_103639072 | 88 |
| 524 | 3300025986 | Ga0207658_10539332 | Ga0207658_105393321 | 88 |
| 525 | 3300025986 | Ga0207658_11254773 | Ga0207658_112547731 | 88 |
| 526 | 3300026023 | Ga0207677_10022762 | Ga0207677_100227622 | 88 |
| 527 | 3300026023 | Ga0207677_10307589 | Ga0207677_103075892 | 88 |
| 528 | 3300026023 | Ga0207677_12177142 | Ga0207677_121771421 | 88 |
| 529 | 3300026035 | Ga0207703_10005582 | Ga0207703_100055826 | 88 |
| 530 | 3300026035 | Ga0207703_10189486 | Ga0207703_101894862 | 88 |
| 531 | 3300026035 | Ga0207703_10196246 | Ga0207703_101962462 | 88 |
| 532 | 3300026035 | Ga0207703_10334072 | Ga0207703_103340721 | 88 |
| 533 | 3300026035 | Ga0207703_11085353 | Ga0207703_110853532 | 88 |
| 534 | 3300026041 | Ga0207639_10047762 | Ga0207639_100477622 | 88 |
| 535 | 3300026041 | Ga0207639_10085740 | Ga0207639_100857402 | 88 |
| 536 | 3300026041 | Ga0207639_10500143 | Ga0207639_105001432 | 88 |
| 537 | 3300026041 | Ga0207639_10543232 | Ga0207639_105432322 | 88 |
| 538 | 3300026041 | Ga0207639_11404915 | Ga0207639_114049151 | 88 |
| 539 | 3300026067 | Ga0207678_10000217 | Ga0207678_1000021717 | 88 |
| 540 | 3300026067 | Ga0207678_10010463 | Ga0207678_100104636 | 88 |
| 541 | 3300026067 | Ga0207678_10015277 | Ga0207678_100152772 | 88 |
| 542 | 3300026067 | Ga0207678_10699810 | Ga0207678_106998102 | 88 |
| 543 | 3300026067 | Ga0207678_11831290 | Ga0207678_118312902 | 88 |
| 544 | 3300026078 | Ga0207702_10013141 | Ga0207702_100131417 | 88 |
| 545 | 3300026078 | Ga0207702_10179768 | Ga0207702_101797682 | 88 |
| 546 | 3300026078 | Ga0207702_10851144 | Ga0207702_108511442 | 88 |
| 547 | 3300026078 | Ga0207702_12403337 | Ga0207702_124033371 | 88 |
| 548 | 3300026078 | Ga0207702_12468894 | Ga0207702_124688942 | 88 |
| 549 | 3300026088 | Ga0207641_10004163 | Ga0207641_1000416313 | 88 |
| 550 | 3300026088 | Ga0207641_10019848 | Ga0207641_100198487 | 88 |
| 551 | 3300026088 | Ga0207641_10101337 | Ga0207641_101013372 | 88 |
| 552 | 3300026088 | Ga0207641_10115512 | Ga0207641_101155122 | 88 |
| 553 | 3300026088 | Ga0207641_10232815 | Ga0207641_102328153 | 88 |
| 554 | 3300026088 | Ga0207641_10778988 | Ga0207641_107789882 | 88 |
| 555 | 3300026089 | Ga0207648_10001535 | Ga0207648_1000153514 | 88 |
| 556 | 3300026089 | Ga0207648_10053565 | Ga0207648_100535656 | 88 |
| 557 | 3300026095 | Ga0207676_10013696 | Ga0207676_100136966 | 88 |
| 558 | 3300026095 | Ga0207676_10031084 | Ga0207676_100310843 | 88 |
| 559 | 3300026095 | Ga0207676_10353231 | Ga0207676_103532312 | 88 |
| 560 | 3300026095 | Ga0207676_10513954 | Ga0207676_105139542 | 88 |
| 561 | 3300026095 | Ga0207676_12150258 | Ga0207676_121502582 | 88 |
| 562 | 3300026116 | Ga0207674_10003022 | Ga0207674_1000302211 | 88 |
| 563 | 3300026116 | Ga0207674_10024700 | Ga0207674_100247008 | 88 |
| 564 | 3300026116 | Ga0207674_10065955 | Ga0207674_100659553 | 88 |
| 565 | 3300026118 | Ga0207675_100460281 | Ga0207675_1004602812 | 88 |
| 566 | 3300026118 | Ga0207675_102163680 | Ga0207675_1021636802 | 88 |
| 567 | 3300026121 | Ga0207683_10000541 | Ga0207683_1000054110 | 88 |
| 568 | 3300026121 | Ga0207683_10005768 | Ga0207683_100057683 | 88 |
| 569 | 3300026121 | Ga0207683_10015641 | Ga0207683_100156413 | 88 |
| 570 | 3300026121 | Ga0207683_10411449 | Ga0207683_104114491 | 88 |
| 571 | 3300026121 | Ga0207683_11325955 | Ga0207683_113259551 | 88 |
| 572 | 3300026142 | Ga0207698_10001554 | Ga0207698_100015547 | 88 |
| 573 | 3300026142 | Ga0207698_10021943 | Ga0207698_100219432 | 88 |
| 574 | 3300026142 | Ga0207698_10083043 | Ga0207698_100830432 | 88 |
| 575 | 3300026142 | Ga0207698_10112284 | Ga0207698_101122843 | 88 |
| 576 | 3300026142 | Ga0207698_10118693 | Ga0207698_101186932 | 88 |
| 577 | 3300026142 | Ga0207698_11053246 | Ga0207698_110532462 | 88 |
| 578 | 3300026142 | Ga0207698_11388778 | Ga0207698_113887782 | 88 |
| 579 | 3300028379 | Ga0268266_10034827 | Ga0268266_100348276 | 88 |
| 580 | 3300028379 | Ga0268266_10122325 | Ga0268266_101223252 | 88 |
| 581 | 3300028379 | Ga0268266_10731300 | Ga0268266_107313002 | 88 |
| 582 | 3300028380 | Ga0268265_10002511 | Ga0268265_100025115 | 88 |
| 583 | 3300028380 | Ga0268265_10358783 | Ga0268265_103587831 | 88 |
| 584 | 3300028380 | Ga0268265_12558909 | Ga0268265_125589092 | 88 |
| 585 | 3300028381 | Ga0268264_10005393 | Ga0268264_1000539313 | 88 |
| 586 | 3300028381 | Ga0268264_10053137 | Ga0268264_100531372 | 88 |
| 587 | 3300028381 | Ga0268264_10395671 | Ga0268264_103956712 | 88 |
| 588 | 3300028381 | Ga0268264_11037825 | Ga0268264_110378252 | 88 |
| 589 | 3300028381 | Ga0268264_11714972 | Ga0268264_117149722 | 88 |
| 590 | 3300028381 | Ga0268264_12197274 | Ga0268264_121972742 | 88 |
| 591 | 3300031852 | Ga0307410_11090771 | Ga0307410_110907712 | 88 |
| 592 | 3300031852 | Ga0307410_11829180 | Ga0307410_118291802 | 88 |
| 593 | 3300031995 | Ga0307409_102458471 | Ga0307409_1024584712 | 88 |
| 594 | 3300032002 | Ga0307416_101589439 | Ga0307416_1015894391 | 88 |
| 595 | 3300032126 | Ga0307415_100029692 | Ga0307415_1000296922 | 88 |
| 596 | 3300032126 | Ga0307415_101212581 | Ga0307415_1012125812 | 88 |
| 597 | 3300034820 | Ga0373959_0178094 | Ga0373959_0178094_133_402 | 88 |
| 598 | 3300035089 | Ga0373944_0121702 | Ga0373944_0121702_615_884 | 88 |
| 599 | 3300035115 | Ga0373941_0119906 | Ga0373941_0119906_334_603 | 88 |
| 600 | 3300035170 | Ga0373943_0037065 | Ga0373943_0037065_959_1228 | 88 |
| 601 | 3300035692 | Ga0373935_0112406 | Ga0373935_0112406_235_504 | 88 |
| 602 | 3300035695 | Ga0373927_0096638 | Ga0373927_0096638_840_1109 | 88 |
| 603 | 3300035725 | Ga0373947_0028056 | Ga0373947_0028056_91_360 | 88 |
| 604 | 3300036401 | Ga0373937_2084717 | Ga0373937_2084717_217_486 | 88 |
| 605 | 3300037068 | Ga0373925_0020969 | Ga0373925_0020969_1118_1387 | 88 |
| 606 | 3300037312 | Ga0395899_0000270 | Ga0395899_0000270_54107_54373 | 88 |
| 607 | 3300037312 | Ga0395899_0000998 | Ga0395899_0000998_15821_16087 | 88 |
| 608 | 3300037312 | Ga0395899_0003175 | Ga0395899_0003175_8426_8692 | 88 |
| 609 | 3300037312 | Ga0395899_0243334 | Ga0395899_0243334_295_561 | 88 |
| 610 | 3300037312 | Ga0395899_0251923 | Ga0395899_0251923_417_686 | 88 |
| 611 | 3300037312 | Ga0395899_0540977 | Ga0395899_0540977_139_405 | 88 |
| 612 | 3300037418 | Ga0395900_0000290 | Ga0395900_0000290_49493_49759 | 88 |
| 613 | 3300037418 | Ga0395900_0004722 | Ga0395900_0004722_4996_5262 | 88 |
| 614 | 3300037418 | Ga0395900_0034834 | Ga0395900_0034834_604_870 | 88 |
| 615 | 3300037418 | Ga0395900_0035230 | Ga0395900_0035230_3931_4200 | 88 |
| 616 | 3300037418 | Ga0395900_0051408 | Ga0395900_0051408_732_998 | 88 |
| 617 | 3300037418 | Ga0395900_0107032 | Ga0395900_0107032_1836_2102 | 88 |
| 618 | 3300037418 | Ga0395900_0173238 | Ga0395900_0173238_1830_2096 | 88 |
| 619 | 3300037418 | Ga0395900_0384182 | Ga0395900_0384182_959_1228 | 88 |
| 620 | 3300037418 | Ga0395900_0560890 | Ga0395900_0560890_711_980 | 88 |
| 621 | 3300037418 | Ga0395900_0609434 | Ga0395900_0609434_395_664 | 88 |
| 622 | 3300037418 | Ga0395900_1937173 | Ga0395900_1937173_179_448 | 88 |
| 623 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_225057_225323 | 88 |
| 624 | 3300037466 | Ga0395898_0002537 | Ga0395898_0002537_5409_5675 | 88 |
| 625 | 3300037466 | Ga0395898_0006151 | Ga0395898_0006151_622_888 | 88 |
| 626 | 3300037466 | Ga0395898_0088531 | Ga0395898_0088531_784_1050 | 88 |
| 627 | 3300037466 | Ga0395898_0552001 | Ga0395898_0552001_524_793 | 88 |
| 628 | 3300037466 | Ga0395898_1037030 | Ga0395898_1037030_125_394 | 88 |
| 629 | 3300037466 | Ga0395898_1053918 | Ga0395898_1053918_326_592 | 88 |
| 630 | 3300037466 | Ga0395898_1125464 | Ga0395898_1125464_235_501 | 88 |
| 631 | 3300037471 | Ga0395905_0000046 | Ga0395905_0000046_186063_186329 | 88 |
| 632 | 3300037471 | Ga0395905_0001943 | Ga0395905_0001943_22576_22842 | 88 |
| 633 | 3300037471 | Ga0395905_0004285 | Ga0395905_0004285_5499_5765 | 88 |
| 634 | 3300037471 | Ga0395905_0022116 | Ga0395905_0022116_2713_2979 | 88 |
| 635 | 3300037471 | Ga0395905_0028526 | Ga0395905_0028526_798_1064 | 88 |
| 636 | 3300037471 | Ga0395905_0035890 | Ga0395905_0035890_75_344 | 88 |
| 637 | 3300037471 | Ga0395905_0061629 | Ga0395905_0061629_835_1104 | 88 |
| 638 | 3300037471 | Ga0395905_0145811 | Ga0395905_0145811_1438_1704 | 88 |
| 639 | 3300037471 | Ga0395905_0179531 | Ga0395905_0179531_1341_1610 | 88 |
| 640 | 3300037471 | Ga0395905_0205413 | Ga0395905_0205413_355_621 | 88 |
| 641 | 3300037471 | Ga0395905_0279940 | Ga0395905_0279940_173_442 | 88 |
| 642 | 3300037471 | Ga0395905_0298788 | Ga0395905_0298788_224_496 | 88 |
| 643 | 3300037471 | Ga0395905_0405413 | Ga0395905_0405413_569_835 | 88 |
| 644 | 3300037471 | Ga0395905_0530940 | Ga0395905_0530940_721_993 | 88 |
| 645 | 3300037471 | Ga0395905_0622285 | Ga0395905_0622285_523_792 | 88 |
| 646 | 3300037471 | Ga0395905_0753200 | Ga0395905_0753200_30_302 | 88 |
| 647 | 3300037471 | Ga0395905_1627037 | Ga0395905_1627037_126_401 | 88 |
| 648 | 3300038443 | Ga0395901_0000102 | Ga0395901_0000102_37788_38054 | 88 |
| 649 | 3300038443 | Ga0395901_0003921 | Ga0395901_0003921_11298_11564 | 88 |
| 650 | 3300038443 | Ga0395901_0004019 | Ga0395901_0004019_5499_5765 | 88 |
| 651 | 3300038443 | Ga0395901_0008199 | Ga0395901_0008199_5525_5791 | 88 |
| 652 | 3300038443 | Ga0395901_0110381 | Ga0395901_0110381_2565_2831 | 88 |
| 653 | 3300038443 | Ga0395901_0115681 | Ga0395901_0115681_968_1234 | 88 |
| 654 | 3300038443 | Ga0395901_0410998 | Ga0395901_0410998_183_452 | 88 |
| 655 | 3300038443 | Ga0395901_1013823 | Ga0395901_1013823_135_404 | 88 |
| 656 | 3300038443 | Ga0395901_2079359 | Ga0395901_2079359_159_425 | 88 |
| 657 | 3300042157 | Ga0439458_0000409 | Ga0439458_0000409_6294_6560 | 88 |
| 658 | 3300044656 | Ga0466969_0461202 | Ga0466969_0461202_252_521 | 88 |
| 659 | 3300044658 | Ga0466972_0227153 | Ga0466972_0227153_512_778 | 88 |
| 660 | 3300044683 | Ga0466965_0045498 | Ga0466965_0045498_867_1136 | 88 |
| 661 | 3300044683 | Ga0466965_0047113 | Ga0466965_0047113_234_503 | 88 |
| 662 | 3300044684 | Ga0466966_0039692 | Ga0466966_0039692_1541_1810 | 88 |
| 663 | 3300044684 | Ga0466966_0088750 | Ga0466966_0088750_1138_1407 | 88 |
| 664 | 3300044684 | Ga0466966_0840913 | Ga0466966_0840913_82_351 | 88 |
| 665 | 3300044693 | Ga0466961_0011100 | Ga0466961_0011100_3233_3502 | 88 |
| 666 | 3300044693 | Ga0466961_0021179 | Ga0466961_0021179_2254_2523 | 88 |
| 667 | 3300044694 | Ga0466963_0001468 | Ga0466963_0001468_1282_1551 | 88 |
| 668 | 3300044694 | Ga0466963_0002992 | Ga0466963_0002992_5754_6023 | 88 |
| 669 | 3300044694 | Ga0466963_0419079 | Ga0466963_0419079_660_929 | 88 |
| 670 | 3300044694 | Ga0466963_0720165 | Ga0466963_0720165_353_622 | 88 |
| 671 | 3300044706 | Ga0466964_0017249 | Ga0466964_0017249_2052_2321 | 88 |
| 672 | 3300044706 | Ga0466964_0099252 | Ga0466964_0099252_51_320 | 88 |
| 673 | 3300044765 | Ga0466970_0946215 | Ga0466970_0946215_216_482 | 88 |
| 674 | 3300044842 | Ga0466957_0000630 | Ga0466957_0000630_3972_4241 | 88 |
| 675 | 3300044842 | Ga0466957_0038452 | Ga0466957_0038452_981_1250 | 88 |
| 676 | 3300044842 | Ga0466957_1404196 | Ga0466957_1404196_168_437 | 88 |
| 677 | 3300044901 | Ga0466960_0017037 | Ga0466960_0017037_356_625 | 88 |
| 678 | 3300044901 | Ga0466960_0409869 | Ga0466960_0409869_344_610 | 88 |
| 679 | 3300045049 | Ga0466959_0258420 | Ga0466959_0258420_448_717 | 88 |
| 680 | 3300045049 | Ga0466959_0324220 | Ga0466959_0324220_88_354 | 88 |
| 681 | 3300045049 | Ga0466959_0804483 | Ga0466959_0804483_42_311 | 88 |
| 682 | 3300045836 | Ga0466958_0089392 | Ga0466958_0089392_1554_1823 | 88 |
| 683 | 3300045836 | Ga0466958_0113732 | Ga0466958_0113732_107_376 | 88 |
| 684 | 3300045976 | Ga0466967_0012674 | Ga0466967_0012674_2909_3178 | 88 |
| 685 | 3300045976 | Ga0466967_0020351 | Ga0466967_0020351_598_867 | 88 |
| 686 | 3300045976 | Ga0466967_0043629 | Ga0466967_0043629_1839_2108 | 88 |
| 687 | 3300045976 | Ga0466967_0064589 | Ga0466967_0064589_2901_3170 | 88 |
| 688 | 3300045976 | Ga0466967_0603687 | Ga0466967_0603687_151_420 | 88 |
| 689 | 3300045976 | Ga0466967_2133310 | Ga0466967_2133310_220_489 | 88 |
| 690 | 3300046459 | Ga0495629_0331764 | Ga0495629_0331764_709_975 | 88 |
| 691 | 3300046537 | Ga0495598_0000426 | Ga0495598_0000426_5026_5295 | 88 |
| 692 | 3300046539 | Ga0495621_0002280 | Ga0495621_0002280_2630_2899 | 88 |
| 693 | 3300046539 | Ga0495621_0206481 | Ga0495621_0206481_336_611 | 88 |
| 694 | 3300046558 | Ga0495633_0212495 | Ga0495633_0212495_329_598 | 88 |
| 695 | 3300046684 | Ga0495669_0007270 | Ga0495669_0007270_2489_2758 | 88 |
| 696 | 3300046684 | Ga0495669_0102942 | Ga0495669_0102942_942_1211 | 88 |
| 697 | 3300046684 | Ga0495669_0212838 | Ga0495669_0212838_366_635 | 88 |
| 698 | 3300046684 | Ga0495669_0358612 | Ga0495669_0358612_386_655 | 88 |
| 699 | 3300046691 | Ga0495670_0000148 | Ga0495670_0000148_17980_18249 | 88 |
| 700 | 3300047320 | Ga0495672_0218644 | Ga0495672_0218644_626_895 | 88 |
| 701 | 3300048903 | Ga0496100_0060100 | Ga0496100_0060100_1229_1495 | 88 |
| 702 | 3300048904 | Ga0496101_0100868 | Ga0496101_0100868_1769_2035 | 88 |
| 703 | 3300048904 | Ga0496101_0195000 | Ga0496101_0195000_207_482 | 88 |
| 704 | 3300048904 | Ga0496101_0222960 | Ga0496101_0222960_17_283 | 88 |
| 705 | 3300048904 | Ga0496101_0254049 | Ga0496101_0254049_837_1109 | 88 |
| 706 | 3300048904 | Ga0496101_0393672 | Ga0496101_0393672_690_959 | 88 |
| 707 | 3300048904 | Ga0496101_0701220 | Ga0496101_0701220_381_650 | 88 |
| 708 | 3300048904 | Ga0496101_0735712 | Ga0496101_0735712_411_677 | 88 |
| 709 | 3300048905 | Ga0496102_0012425 | Ga0496102_0012425_1616_1888 | 88 |
| 710 | 3300048905 | Ga0496102_0281089 | Ga0496102_0281089_432_698 | 88 |
| 711 | 3300048906 | Ga0496103_0011174 | Ga0496103_0011174_2314_2586 | 88 |
| 712 | 3300048906 | Ga0496103_0407747 | Ga0496103_0407747_194_460 | 88 |
| 713 | 3300048906 | Ga0496103_0476165 | Ga0496103_0476165_149_415 | 88 |
| 714 | 3300048908 | Ga0496105_0191850 | Ga0496105_0191850_771_1037 | 88 |
| 715 | 3300048909 | Ga0496106_0066341 | Ga0496106_0066341_851_1117 | 88 |
| 716 | 3300048910 | Ga0496107_0010960 | Ga0496107_0010960_2573_2845 | 88 |
| 717 | 3300048910 | Ga0496107_0036939 | Ga0496107_0036939_2189_2464 | 88 |
| 718 | 3300048910 | Ga0496107_0127630 | Ga0496107_0127630_273_539 | 88 |
| 719 | 3300048910 | Ga0496107_0159382 | Ga0496107_0159382_1063_1329 | 88 |
| 720 | 3300048910 | Ga0496107_0163870 | Ga0496107_0163870_1331_1600 | 88 |
| 721 | 3300048910 | Ga0496107_0340279 | Ga0496107_0340279_55_324 | 88 |
| 722 | 3300048910 | Ga0496107_0384545 | Ga0496107_0384545_89_358 | 88 |
| 723 | 3300048910 | Ga0496107_0670894 | Ga0496107_0670894_167_436 | 88 |
| 724 | 3300048910 | Ga0496107_1282638 | Ga0496107_1282638_96_362 | 88 |
| 725 | 3300048911 | Ga0496108_0005054 | Ga0496108_0005054_1302_1568 | 88 |
| 726 | 3300048911 | Ga0496108_0410677 | Ga0496108_0410677_54_326 | 88 |
| 727 | 3300048911 | Ga0496108_1134728 | Ga0496108_1134728_264_533 | 88 |
| 728 | 3300048912 | Ga0496109_0004047 | Ga0496109_0004047_11861_12133 | 88 |
| 729 | 3300048912 | Ga0496109_0022851 | Ga0496109_0022851_745_1011 | 88 |
| 730 | 3300048912 | Ga0496109_0254243 | Ga0496109_0254243_398_673 | 88 |
| 731 | 3300048912 | Ga0496109_0547314 | Ga0496109_0547314_459_728 | 88 |
| 732 | 3300048912 | Ga0496109_1908533 | Ga0496109_1908533_63_329 | 88 |
| 733 | 3300048912 | Ga0496109_1971139 | Ga0496109_1971139_89_358 | 88 |
| 734 | 3300048913 | Ga0496110_0001649 | Ga0496110_0001649_6984_7250 | 88 |
| 735 | 3300048913 | Ga0496110_0006018 | Ga0496110_0006018_1898_2170 | 88 |
| 736 | 3300048913 | Ga0496110_0030168 | Ga0496110_0030168_1519_1794 | 88 |
| 737 | 3300048914 | Ga0496111_0009769 | Ga0496111_0009769_1458_1724 | 88 |
| 738 | 3300048914 | Ga0496111_0044116 | Ga0496111_0044116_969_1244 | 88 |
| 739 | 3300048915 | Ga0496112_0035398 | Ga0496112_0035398_3190_3462 | 88 |
| 740 | 3300048915 | Ga0496112_0136820 | Ga0496112_0136820_926_1192 | 88 |
| 741 | 3300048915 | Ga0496112_0198989 | Ga0496112_0198989_913_1179 | 88 |
| 742 | 3300048916 | Ga0496113_0002738 | Ga0496113_0002738_6370_6636 | 88 |
| 743 | 3300048916 | Ga0496113_0018235 | Ga0496113_0018235_736_1002 | 88 |
| 744 | 3300048916 | Ga0496113_0022120 | Ga0496113_0022120_2857_3129 | 88 |
| 745 | 3300048917 | Ga0496114_0004676 | Ga0496114_0004676_2584_2859 | 88 |
| 746 | 3300048917 | Ga0496114_0025026 | Ga0496114_0025026_3459_3725 | 88 |
| 747 | 3300048918 | Ga0496115_0156435 | Ga0496115_0156435_954_1220 | 88 |
| 748 | 3300049571 | Ga0501034_0848369 | Ga0501034_0848369_380_649 | 88 |
| 749 | 3300049584 | Ga0501068_0692632 | Ga0501068_0692632_185_454 | 88 |
| 750 | 3300049585 | Ga0501069_0448426 | Ga0501069_0448426_158_427 | 88 |
| 751 | 3300049589 | Ga0501073_0627850 | Ga0501073_0627850_110_379 | 88 |
| 752 | 3300049590 | Ga0501074_0079494 | Ga0501074_0079494_588_857 | 88 |
| 753 | 3300049742 | Ga0501080_0101660 | Ga0501080_0101660_1130_1399 | 88 |
| 754 | 3300049822 | Ga0501035_1471447 | Ga0501035_1471447_207_476 | 88 |
| 755 | 3300050490 | nmdc:mga03n38_792830_c1 | nmdc:mga03n38_792830_c1_129_398 | 88 |
| 756 | 3300050491 | nmdc:mga00v17_946026_c1 | nmdc:mga00v17_946026_c1_159_428 | 88 |
| 757 | 3300050492 | nmdc:mga0yw44_1045453_c1 | nmdc:mga0yw44_1045453_c1_143_412 | 88 |
| 758 | 3300050511 | nmdc:mga08y16_1856858_c1 | nmdc:mga08y16_1856858_c1_33_308 | 88 |
| 759 | 3300061719 | Ga0466962_0220849 | Ga0466962_0220849_399_668 | 88 |
| 760 | 3300061719 | Ga0466962_0413344 | Ga0466962_0413344_235_504 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2k5i-assembly1.cif.gz_A | solution structure of iron(ii) transport protein a from clostridium thermocellum , northeast structural genomics consortium (nesg) target vr131 | 0.9159 | 10 | 87 |
| 2k5f-assembly1.cif.gz_A | solution nmr structure of feoa protein from chlorobium tepidum. northeast structural genomics consortium target ctr121 | 0.9048 | 10 | 88 |
| 3e19-assembly1.cif.gz_D | crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group | 0.8976 | 9 | 87 |
| 4o5v-assembly1.cif.gz_A | crystal structure of t. acidophilum ider | 0.894 | 9 | 87 |
| 5zr4-assembly1.cif.gz_B | manganese-dependent transcriptional repressor | 0.8932 | 9 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2k5iA01 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.9159 | 10 | 87 | 2.30.30.90 |
| 2k5fA01 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.9048 | 10 | 88 | 2.30.30.90 |
| af_Q57987_2_81_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8896 | 10 | 86 | 2.30.30.90 |
| af_Q2G2L0_142_214_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8752 | 10 | 85 | 2.30.30.90 |
| 2k5lA00 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8571 | 10 | 88 | 2.30.30.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A418Q3T6-F1-model_v4 | Ferrous iron transport protein A | 1.003 | 9 | 88 |
GO:0046914
|
| AF-A0A516IRR1-F1-model_v4 | Ferrous iron transport protein A | 0.9974 | 9 | 88 |
GO:0046914
|
| AF-A0A1X7G5W0-F1-model_v4 | Ferrous iron transport protein A | 0.9855 | 10 | 87 |
GO:0046914
|
| AF-A0A6G7ZKR3-F1-model_v4 | Ferrous iron transport protein A | 0.9844 | 1 | 88 |
GO:0046914
|
| AF-A0A842HV07-F1-model_v4 | Ferrous iron transport protein A | 0.9832 | 9 | 88 |
GO:0046914
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar