F479551

General Info

Members Datasets Scaffolds Average Seq Length
760 225 760 90

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0032271|Ga0496110_0032271_1483_1752
Length 80
Sequence MNAPFQPGTVSLDQLELGTKARVASIDWNGLDEGEACRLQHFPLHLGPFGRDPIAIRVGRMTVAIRRKHASAIRVVPLSR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 6.32
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004116 3300001915 Bacteria 3293
2 JGI24740J21852_10006636 3300001979 Bacteria 4771
3 JGI24740J21852_10044450 3300001979 Bacteria 1318
4 JGI24740J21852_10111174 3300001979 Bacteria 691
5 JGI24737J22298_10178200 3300001990 Bacteria 627
6 JGI24735J21928_10024566 3300002067 Bacteria 1822
7 JGI24738J21930_10069572 3300002075 Bacteria 728
8 JGI24034J26672_10051999 3300002239 Bacteria 706
9 Ga0065712_10305370 3300005290 Bacteria 853
10 Ga0065715_10412033 3300005293 Bacteria 868
11 Ga0070658_10001056 3300005327 Bacteria 23556
12 Ga0070658_10064186 3300005327 Bacteria 2995
13 Ga0070658_10092954 3300005327 Bacteria 2488
14 Ga0070658_10234519 3300005327 Bacteria 1554
15 Ga0070658_10659939 3300005327 Bacteria 907
16 Ga0070658_11051967 3300005327 Bacteria 708
17 Ga0070676_10014314 3300005328 Bacteria 4360
18 Ga0070676_10021737 3300005328 Bacteria 3593
19 Ga0070683_100001823 3300005329 Bacteria 16621
20 Ga0070690_100624028 3300005330 Bacteria 821
21 Ga0070670_100022194 3300005331 Bacteria 5463
22 Ga0070670_100029461 3300005331 Bacteria 4726
23 Ga0070670_100041338 3300005331 Bacteria 3963
24 Ga0070670_100140812 3300005331 Bacteria 2086
25 Ga0070670_100670829 3300005331 Bacteria 931
26 Ga0070670_101920709 3300005331 Bacteria 545
27 Ga0070670_102024131 3300005331 Bacteria 531
28 Ga0070670_102098580 3300005331 Bacteria 521
29 Ga0070677_10518799 3300005333 Bacteria 648
30 Ga0068869_100043873 3300005334 Bacteria 3214
31 Ga0068869_100215651 3300005334 Bacteria 1519
32 Ga0068869_100291638 3300005334 Bacteria 1315
33 Ga0068869_100853130 3300005334 Bacteria 786
34 Ga0070666_10003456 3300005335 Bacteria 9571
35 Ga0070666_10043454 3300005335 Bacteria 3009
36 Ga0070666_10051321 3300005335 Bacteria 2777
37 Ga0070666_10528712 3300005335 Unclassified 857
38 Ga0070680_100001306 3300005336 Bacteria 18035
39 Ga0070680_100154756 3300005336 Bacteria 1926
40 Ga0070680_101076432 3300005336 Bacteria 695
41 Ga0070680_101181277 3300005336 Bacteria 662
42 Ga0070680_101710288 3300005336 Bacteria 545
43 Ga0070682_100019091 3300005337 Bacteria 4017
44 Ga0070682_100078258 3300005337 Bacteria 2132
45 Ga0068868_100149441 3300005338 Bacteria 1923
46 Ga0068868_100358143 3300005338 Bacteria 1251
47 Ga0068868_100567498 3300005338 Bacteria 1002
48 Ga0068868_100989463 3300005338 Bacteria 769
49 Ga0068868_101148399 3300005338 Bacteria 716
50 Ga0070660_100002280 3300005339 Bacteria 13171
51 Ga0070660_100072622 3300005339 Bacteria 2689
52 Ga0070660_100114199 3300005339 Bacteria 2151
53 Ga0070660_100182022 3300005339 Bacteria 1701
54 Ga0070660_100311592 3300005339 Bacteria 1291
55 Ga0070660_100629583 3300005339 Bacteria 898
56 Ga0070660_100824980 3300005339 Bacteria 780
57 Ga0070660_101712182 3300005339 Bacteria 535
58 Ga0070691_10407110 3300005341 Bacteria 768
59 Ga0070661_100020291 3300005344 Bacteria 4737
60 Ga0070661_100033255 3300005344 Bacteria 3734
61 Ga0070661_100033786 3300005344 Bacteria 3707
62 Ga0070661_100060678 3300005344 Bacteria 2774
63 Ga0070661_100068490 3300005344 Bacteria 2608
64 Ga0070661_100080352 3300005344 Bacteria 2407
65 Ga0070661_100166055 3300005344 Bacteria 1674
66 Ga0070661_100467755 3300005344 Bacteria 1005
67 Ga0070661_100588032 3300005344 Bacteria 899
68 Ga0070661_100731868 3300005344 Bacteria 808
69 Ga0070661_101291722 3300005344 Unclassified 612
70 Ga0070661_101864834 3300005344 Bacteria 511
71 Ga0070692_10023376 3300005345 Bacteria 3029
72 Ga0070692_10104582 3300005345 Bacteria 1557
73 Ga0070668_100018998 3300005347 Bacteria 5165
74 Ga0070668_100321102 3300005347 Bacteria 1304
75 Ga0070668_100346955 3300005347 Bacteria 1255
76 Ga0070668_100637813 3300005347 Bacteria 935
77 Ga0070668_100883144 3300005347 Bacteria 798
78 Ga0070668_101700548 3300005347 Bacteria 579
79 Ga0070668_102280429 3300005347 Bacteria 500
80 Ga0070669_101110824 3300005353 Bacteria 681
81 Ga0070669_101344153 3300005353 Bacteria 619
82 Ga0070669_101881252 3300005353 Bacteria 522
83 Ga0070669_101915434 3300005353 Bacteria 518
84 Ga0070675_100026302 3300005354 Bacteria 4670
85 Ga0070675_100109167 3300005354 Bacteria 2338
86 Ga0070675_100460169 3300005354 Bacteria 1142
87 Ga0070675_101070983 3300005354 Bacteria 741
88 Ga0070671_100010695 3300005355 Bacteria 7367
89 Ga0070671_100115166 3300005355 Bacteria 2260
90 Ga0070671_100143086 3300005355 Bacteria 2018
91 Ga0070671_100149951 3300005355 Bacteria 1969
92 Ga0070671_100161403 3300005355 Bacteria 1894
93 Ga0070671_100195176 3300005355 Bacteria 1716
94 Ga0070671_100854568 3300005355 Bacteria 794
95 Ga0070671_101991096 3300005355 Unclassified 517
96 Ga0070674_100007740 3300005356 Bacteria 6346
97 Ga0070674_100772644 3300005356 Bacteria 827
98 Ga0070674_101154814 3300005356 Bacteria 686
99 Ga0070673_100005116 3300005364 Bacteria 8366
100 Ga0070673_100032534 3300005364 Bacteria 3928
101 Ga0070673_100118869 3300005364 Bacteria 2201
102 Ga0070673_100237403 3300005364 Bacteria 1584
103 Ga0070673_100256536 3300005364 Bacteria 1526
104 Ga0070673_101705671 3300005364 Bacteria 596
105 Ga0070659_100009647 3300005366 Bacteria 7096
106 Ga0070659_100034514 3300005366 Bacteria 3935
107 Ga0070659_100163543 3300005366 Bacteria 1820
108 Ga0070659_101065561 3300005366 Bacteria 711
109 Ga0070659_101162179 3300005366 Bacteria 682
110 Ga0070659_101196792 3300005366 Bacteria 672
111 Ga0070659_101385352 3300005366 Bacteria 625
112 Ga0070659_101712431 3300005366 Unclassified 562
113 Ga0070667_100002393 3300005367 Bacteria 16426
114 Ga0070667_100036352 3300005367 Bacteria 4129
115 Ga0070667_100037369 3300005367 Bacteria 4070
116 Ga0070667_100075329 3300005367 Bacteria 2881
117 Ga0070667_100496086 3300005367 Bacteria 1119
118 Ga0070667_100506945 3300005367 Bacteria 1106
119 Ga0070667_100647498 3300005367 Bacteria 975
120 Ga0070667_100674901 3300005367 Bacteria 955
121 Ga0070667_100708424 3300005367 Bacteria 932
122 Ga0070667_100712488 3300005367 Unclassified 929
123 Ga0070667_100740857 3300005367 Bacteria 910
124 Ga0070667_100763163 3300005367 Bacteria 897
125 Ga0070667_100854720 3300005367 Bacteria 846
126 Ga0070713_100942658 3300005436 Bacteria 831
127 Ga0070710_10610693 3300005437 Bacteria 760
128 Ga0070705_100515045 3300005440 Bacteria 911
129 Ga0070705_101150988 3300005440 Bacteria 637
130 Ga0070663_100000271 3300005455 Bacteria 26098
131 Ga0070663_100057324 3300005455 Bacteria 2794
132 Ga0070663_100097344 3300005455 Bacteria 2190
133 Ga0070663_100307846 3300005455 Bacteria 1270
134 Ga0070663_100391464 3300005455 Bacteria 1134
135 Ga0070663_100482154 3300005455 Bacteria 1027
136 Ga0070663_100731588 3300005455 Unclassified 843
137 Ga0070678_100011061 3300005456 Bacteria 5548
138 Ga0070678_100158426 3300005456 Bacteria 1831
139 Ga0070678_102050242 3300005456 Bacteria 541
140 Ga0070662_100001018 3300005457 Bacteria 17157
141 Ga0070662_100074011 3300005457 Bacteria 2519
142 Ga0070662_100161640 3300005457 Bacteria 1752
143 Ga0070662_100664919 3300005457 Bacteria 879
144 Ga0070681_10015737 3300005458 Bacteria 7540
145 Ga0070681_10067960 3300005458 Bacteria 3531
146 Ga0070681_10431034 3300005458 Bacteria 1230
147 Ga0070681_11690843 3300005458 Bacteria 559
148 Ga0068867_100003017 3300005459 Bacteria 11867
149 Ga0068867_100227968 3300005459 Bacteria 1505
150 Ga0070685_10057069 3300005466 Bacteria 2272
151 Ga0070685_11059549 3300005466 Bacteria 611
152 Ga0070679_100000346 3300005530 Bacteria 39334
153 Ga0070679_100332434 3300005530 Bacteria 1468
154 Ga0070679_100340672 3300005530 Bacteria 1447
155 Ga0070679_101099751 3300005530 Bacteria 739
156 Ga0070679_101568906 3300005530 Bacteria 606
157 Ga0070684_101221319 3300005535 Bacteria 707
158 Ga0070697_101176841 3300005536 Bacteria 683
159 Ga0068853_100039150 3300005539 Bacteria 4042
160 Ga0068853_100107496 3300005539 Bacteria 2474
161 Ga0068853_100345817 3300005539 Bacteria 1382
162 Ga0068853_100428474 3300005539 Bacteria 1241
163 Ga0068853_100923459 3300005539 Bacteria 839
164 Ga0068853_100984180 3300005539 Bacteria 812
165 Ga0068853_102073122 3300005539 Bacteria 551
166 Ga0070672_100064580 3300005543 Bacteria 2893
167 Ga0070672_100102934 3300005543 Bacteria 2318
168 Ga0070672_100125287 3300005543 Bacteria 2106
169 Ga0070672_100139318 3300005543 Bacteria 2000
170 Ga0070672_100725664 3300005543 Bacteria 871
171 Ga0070686_101439915 3300005544 Bacteria 579
172 Ga0070695_100834250 3300005545 Bacteria 741
173 Ga0070696_100344834 3300005546 Bacteria 1152
174 Ga0070693_100723640 3300005547 Bacteria 731
175 Ga0070693_100741077 3300005547 Bacteria 723
176 Ga0070665_100047018 3300005548 Bacteria 4332
177 Ga0070665_100724673 3300005548 Bacteria 1007
178 Ga0070665_100944391 3300005548 Bacteria 875
179 Ga0068855_100009125 3300005563 Bacteria 11978
180 Ga0068855_100083160 3300005563 Bacteria 3708
181 Ga0068855_100582068 3300005563 Bacteria 1209
182 Ga0070664_100006576 3300005564 Bacteria 9375
183 Ga0070664_100012615 3300005564 Bacteria 6878
184 Ga0070664_100035259 3300005564 Bacteria 4200
185 Ga0070664_100064886 3300005564 Bacteria 3114
186 Ga0070664_100081576 3300005564 Bacteria 2788
187 Ga0070664_100177496 3300005564 Bacteria 1892
188 Ga0070664_100319834 3300005564 Bacteria 1406
189 Ga0070664_100321986 3300005564 Bacteria 1401
190 Ga0068857_100010349 3300005577 Bacteria 8103
191 Ga0068857_100040473 3300005577 Bacteria 4132
192 Ga0068857_100587708 3300005577 Bacteria 1052
193 Ga0068857_101131274 3300005577 Bacteria 757
194 Ga0068854_100043054 3300005578 Bacteria 3198
195 Ga0068854_100110134 3300005578 Bacteria 2076
196 Ga0068854_100117343 3300005578 Bacteria 2015
197 Ga0068854_100507859 3300005578 Bacteria 1016
198 Ga0068854_100732837 3300005578 Unclassified 856
199 Ga0068854_101930246 3300005578 Bacteria 543
200 Ga0068854_102276236 3300005578 Bacteria 502
201 Ga0068856_100016476 3300005614 Bacteria 7154
202 Ga0068856_100018394 3300005614 Bacteria 6772
203 Ga0068856_100315111 3300005614 Bacteria 1582
204 Ga0068856_100725498 3300005614 Bacteria 1014
205 Ga0068856_100975793 3300005614 Bacteria 866
206 Ga0068856_101285131 3300005614 Bacteria 747
207 Ga0068856_101897954 3300005614 Bacteria 607
208 Ga0070702_100145871 3300005615 Bacteria 1513
209 Ga0068852_100005849 3300005616 Bacteria 8834
210 Ga0068852_100035562 3300005616 Bacteria 4157
211 Ga0068852_100083782 3300005616 Bacteria 2836
212 Ga0068852_100144204 3300005616 Bacteria 2207
213 Ga0068852_100179808 3300005616 Bacteria 1988
214 Ga0068852_100236611 3300005616 Bacteria 1743
215 Ga0068852_100331534 3300005616 Bacteria 1481
216 Ga0068859_100051278 3300005617 Bacteria 4147
217 Ga0068859_100335433 3300005617 Bacteria 1606
218 Ga0068859_100434249 3300005617 Bacteria 1409
219 Ga0068859_101256627 3300005617 Bacteria 816
220 Ga0068859_102158555 3300005617 Bacteria 615
221 Ga0068859_102831081 3300005617 Bacteria 532
222 Ga0068864_100010864 3300005618 Bacteria 7525
223 Ga0068864_100012608 3300005618 Bacteria 6988
224 Ga0068864_100210534 3300005618 Bacteria 1790
225 Ga0068864_100343428 3300005618 Bacteria 1407
226 Ga0068864_100877709 3300005618 Bacteria 885
227 Ga0068866_11044380 3300005718 Bacteria 583
228 Ga0068861_101299803 3300005719 Bacteria 707
229 Ga0068861_101748846 3300005719 Bacteria 616
230 Ga0068851_10001758 3300005834 Bacteria 9463
231 Ga0068851_10062144 3300005834 Bacteria 1916
232 Ga0068851_10069537 3300005834 Bacteria 1819
233 Ga0068851_10073656 3300005834 Bacteria 1772
234 Ga0068851_10130077 3300005834 Bacteria 1361
235 Ga0068870_10037294 3300005840 Bacteria 2505
236 Ga0068870_10301164 3300005840 Bacteria 1012
237 Ga0068863_100000607 3300005841 Bacteria 36378
238 Ga0068863_100011565 3300005841 Bacteria 8537
239 Ga0068863_100043854 3300005841 Bacteria 4246
240 Ga0068863_100252699 3300005841 Bacteria 1703
241 Ga0068858_100006875 3300005842 Bacteria 11055
242 Ga0068858_100032216 3300005842 Bacteria 4869
243 Ga0068858_100525312 3300005842 Bacteria 1145
244 Ga0068858_101562566 3300005842 Bacteria 651
245 Ga0068858_102090360 3300005842 Bacteria 560
246 Ga0068858_102196719 3300005842 Bacteria 546
247 Ga0068860_100063733 3300005843 Bacteria 3500
248 Ga0068860_100160363 3300005843 Bacteria 2168
249 Ga0068860_100180289 3300005843 Bacteria 2041
250 Ga0068860_100197813 3300005843 Bacteria 1947
251 Ga0068860_100962590 3300005843 Bacteria 871
252 Ga0068860_102435410 3300005843 Bacteria 543
253 Ga0068862_100223546 3300005844 Bacteria 1705
254 Ga0068862_100620056 3300005844 Bacteria 1040
255 Ga0068862_100624199 3300005844 Bacteria 1037
256 Ga0068862_101363624 3300005844 Bacteria 712
257 Ga0081539_10022959 3300005985 Bacteria 4103
258 Ga0075365_11185979 3300006038 Bacteria 537
259 Ga0075363_100911267 3300006048 Bacteria 539
260 Ga0075364_10602526 3300006051 Bacteria 751
261 Ga0097621_100034174 3300006237 Bacteria 4054
262 Ga0097621_100049260 3300006237 Bacteria 3421
263 Ga0097621_100083846 3300006237 Bacteria 2656
264 Ga0068871_100030913 3300006358 Bacteria 4220
265 Ga0068871_100088118 3300006358 Bacteria 2582
266 Ga0068871_100109365 3300006358 Bacteria 2324
267 Ga0068871_100125435 3300006358 Bacteria 2173
268 Ga0068871_100502613 3300006358 Bacteria 1093
269 Ga0068871_100660570 3300006358 Bacteria 955
270 Ga0068865_100105243 3300006881 Bacteria 2072
271 Ga0068865_100120487 3300006881 Bacteria 1950
272 Ga0068865_100610670 3300006881 Bacteria 923
273 Ga0068865_101765758 3300006881 Bacteria 558
274 Ga0097620_100051278 3300006931 Bacteria 4147
275 Ga0097620_100335428 3300006931 Bacteria 1606
276 Ga0097620_100434237 3300006931 Bacteria 1409
277 Ga0097620_101256489 3300006931 Bacteria 816
278 Ga0097620_102158321 3300006931 Bacteria 615
279 Ga0097620_102830879 3300006931 Bacteria 532
280 Ga0075435_100135083 3300007076 Bacteria 2066
281 Ga0111539_10188678 3300009094 Bacteria 2406
282 Ga0111539_11832955 3300009094 Bacteria 703
283 Ga0105245_11832706 3300009098 Bacteria 660
284 Ga0105245_13235962 3300009098 Bacteria 505
285 Ga0105247_10245877 3300009101 Bacteria 1221
286 Ga0105243_10472642 3300009148 Bacteria 1181
287 Ga0105241_10858151 3300009174 Bacteria 840
288 Ga0105248_10003825 3300009177 Bacteria 16686
289 Ga0105248_10003900 3300009177 Bacteria 16492
290 Ga0105248_10028196 3300009177 Bacteria 6253
291 Ga0105248_10031637 3300009177 Bacteria 5911
292 Ga0105248_10050987 3300009177 Bacteria 4643
293 Ga0105248_10369712 3300009177 Bacteria 1614
294 Ga0105248_10856061 3300009177 Bacteria 1026
295 Ga0105248_11878887 3300009177 Bacteria 679
296 Ga0105248_12929703 3300009177 Bacteria 544
297 Ga0105237_10008511 3300009545 Bacteria 11096
298 Ga0105237_10026407 3300009545 Bacteria 5935
299 Ga0105237_10106121 3300009545 Bacteria 2801
300 Ga0105238_10163614 3300009551 Bacteria 2201
301 Ga0105238_11631009 3300009551 Bacteria 675
302 Ga0105238_12452109 3300009551 Bacteria 557
303 Ga0105249_10119887 3300009553 Bacteria 2499
304 Ga0105249_12162334 3300009553 Bacteria 629
305 Ga0105239_10853917 3300010375 Bacteria 1044
306 Ga0105246_10738399 3300011119 Bacteria 867
307 Ga0105246_12107904 3300011119 Bacteria 547
308 Ga0157373_10062376 3300013100 Bacteria 2640
309 Ga0157373_10063721 3300013100 Bacteria 2610
310 Ga0157373_10065815 3300013100 Bacteria 2565
311 Ga0157373_10069494 3300013100 Bacteria 2490
312 Ga0157373_10542954 3300013100 Bacteria 842
313 Ga0157373_10614010 3300013100 Bacteria 792
314 Ga0157371_10048437 3300013102 Bacteria 3020
315 Ga0157371_10161022 3300013102 Bacteria 1603
316 Ga0157371_10178891 3300013102 Bacteria 1517
317 Ga0157370_10009490 3300013104 Bacteria 10384
318 Ga0157370_10101505 3300013104 Bacteria 2695
319 Ga0157370_10240149 3300013104 Bacteria 1676
320 Ga0157370_10682368 3300013104 Bacteria 938
321 Ga0157370_11276736 3300013104 Bacteria 662
322 Ga0157369_10003984 3300013105 Bacteria 17513
323 Ga0157369_10046645 3300013105 Bacteria 4709
324 Ga0157369_10589237 3300013105 Bacteria 1148
325 Ga0157369_11741992 3300013105 Bacteria 633
326 Ga0157369_12212906 3300013105 Bacteria 557
327 Ga0157374_10051565 3300013296 Bacteria 3829
328 Ga0157374_10059163 3300013296 Bacteria 3582
329 Ga0157374_10126976 3300013296 Bacteria 2466
330 Ga0157374_10165252 3300013296 Bacteria 2157
331 Ga0157374_10650187 3300013296 Bacteria 1066
332 Ga0157378_10289604 3300013297 Bacteria 1581
333 Ga0163162_10004976 3300013306 Bacteria 12799
334 Ga0163162_10013507 3300013306 Bacteria 7973
335 Ga0163162_10293129 3300013306 Bacteria 1759
336 Ga0163162_10762260 3300013306 Bacteria 1087
337 Ga0163162_11117790 3300013306 Bacteria 893
338 Ga0163162_13371909 3300013306 Unclassified 510
339 Ga0157372_10479603 3300013307 Bacteria 1450
340 Ga0157372_10584450 3300013307 Bacteria 1302
341 Ga0157372_10595510 3300013307 Bacteria 1289
342 Ga0157372_11465684 3300013307 Bacteria 786
343 Ga0157372_12432697 3300013307 Bacteria 601
344 Ga0157375_10005040 3300013308 Bacteria 11472
345 Ga0157375_10044879 3300013308 Bacteria 4299
346 Ga0157375_10060068 3300013308 Bacteria 3768
347 Ga0157375_10216451 3300013308 Bacteria 2073
348 Ga0157375_10258090 3300013308 Bacteria 1904
349 Ga0157375_10286423 3300013308 Bacteria 1810
350 Ga0163163_10014443 3300014325 Bacteria 7259
351 Ga0163163_10074586 3300014325 Bacteria 3385
352 Ga0163163_10328718 3300014325 Bacteria 1583
353 Ga0182008_10162231 3300014497 Bacteria 1125
354 Ga0157379_10001583 3300014968 Bacteria 18752
355 Ga0157379_10502426 3300014968 Bacteria 1124
356 Ga0163161_10003295 3300017792 Bacteria 11341
357 Ga0163161_10524637 3300017792 Bacteria 968
358 Ga0163161_10687361 3300017792 Bacteria 851
359 Ga0206354_11449613 3300020081 Bacteria 564
360 Ga0206353_10096358 3300020082 Bacteria 507
361 Ga0207697_10163476 3300025315 Bacteria 972
362 Ga0207697_10202809 3300025315 Bacteria 873
363 Ga0207697_10396360 3300025315 Bacteria 613
364 Ga0207656_10051512 3300025321 Bacteria 1780
365 Ga0207656_10054119 3300025321 Bacteria 1743
366 Ga0207656_10065642 3300025321 Bacteria 1602
367 Ga0207656_10212696 3300025321 Bacteria 938
368 Ga0207688_10007813 3300025901 Bacteria 5820
369 Ga0207688_10158879 3300025901 Bacteria 1339
370 Ga0207688_10624526 3300025901 Bacteria 680
371 Ga0207680_10035471 3300025903 Bacteria 2864
372 Ga0207680_10038224 3300025903 Bacteria 2777
373 Ga0207680_10327492 3300025903 Bacteria 1072
374 Ga0207647_10016084 3300025904 Bacteria 5111
375 Ga0207647_10360989 3300025904 Bacteria 822
376 Ga0207647_10603305 3300025904 Bacteria 605
377 Ga0207647_10816434 3300025904 Bacteria 501
378 Ga0207685_10736048 3300025905 Bacteria 539
379 Ga0207645_10001636 3300025907 Bacteria 18270
380 Ga0207645_10005404 3300025907 Bacteria 9266
381 Ga0207645_10932327 3300025907 Unclassified 589
382 Ga0207643_10054640 3300025908 Bacteria 2270
383 Ga0207705_10000270 3300025909 Bacteria 49639
384 Ga0207705_10072190 3300025909 Bacteria 2503
385 Ga0207705_10289762 3300025909 Bacteria 1254
386 Ga0207705_10369909 3300025909 Bacteria 1106
387 Ga0207705_10528072 3300025909 Bacteria 917
388 Ga0207705_10708748 3300025909 Bacteria 782
389 Ga0207705_10862427 3300025909 Bacteria 702
390 Ga0207654_10335828 3300025911 Bacteria 1037
391 Ga0207707_10015148 3300025912 Bacteria 6712
392 Ga0207707_10049824 3300025912 Bacteria 3649
393 Ga0207671_10020935 3300025914 Bacteria 4972
394 Ga0207671_10076405 3300025914 Bacteria 2506
395 Ga0207660_10002965 3300025917 Bacteria 11098
396 Ga0207660_10005305 3300025917 Bacteria 8381
397 Ga0207660_10096380 3300025917 Bacteria 2202
398 Ga0207660_10721510 3300025917 Bacteria 813
399 Ga0207660_11449314 3300025917 Bacteria 556
400 Ga0207657_10001091 3300025919 Bacteria 28769
401 Ga0207657_10003456 3300025919 Bacteria 16857
402 Ga0207657_10005074 3300025919 Bacteria 13810
403 Ga0207657_10012494 3300025919 Bacteria 8381
404 Ga0207657_10020199 3300025919 Bacteria 6301
405 Ga0207657_10024128 3300025919 Bacteria 5646
406 Ga0207657_10054575 3300025919 Bacteria 3455
407 Ga0207657_10130544 3300025919 Bacteria 2059
408 Ga0207657_10162912 3300025919 Bacteria 1810
409 Ga0207649_10034401 3300025920 Bacteria 3036
410 Ga0207649_10056199 3300025920 Bacteria 2457
411 Ga0207649_10082203 3300025920 Bacteria 2088
412 Ga0207649_10085096 3300025920 Bacteria 2057
413 Ga0207649_10144769 3300025920 Bacteria 1630
414 Ga0207649_10147832 3300025920 Bacteria 1615
415 Ga0207649_10248910 3300025920 Bacteria 1279
416 Ga0207649_10438490 3300025920 Bacteria 984
417 Ga0207649_10464386 3300025920 Bacteria 957
418 Ga0207649_10486017 3300025920 Bacteria 937
419 Ga0207652_10000058 3300025921 Bacteria 113620
420 Ga0207652_10439743 3300025921 Bacteria 1176
421 Ga0207681_10048589 3300025923 Bacteria 2864
422 Ga0207681_10173070 3300025923 Bacteria 1638
423 Ga0207694_10041515 3300025924 Bacteria 3545
424 Ga0207650_10008323 3300025925 Bacteria 7081
425 Ga0207650_10021388 3300025925 Bacteria 4571
426 Ga0207650_10069382 3300025925 Bacteria 2648
427 Ga0207650_10168879 3300025925 Bacteria 1738
428 Ga0207650_10403309 3300025925 Bacteria 1132
429 Ga0207650_10650052 3300025925 Bacteria 889
430 Ga0207650_11121088 3300025925 Bacteria 670
431 Ga0207650_11620018 3300025925 Bacteria 549
432 Ga0207659_10007014 3300025926 Bacteria 6919
433 Ga0207659_10187861 3300025926 Bacteria 1642
434 Ga0207659_10393399 3300025926 Bacteria 1158
435 Ga0207659_10621381 3300025926 Bacteria 922
436 Ga0207700_10644479 3300025928 Bacteria 944
437 Ga0207644_10043535 3300025931 Bacteria 3186
438 Ga0207644_10069764 3300025931 Bacteria 2567
439 Ga0207644_10081793 3300025931 Bacteria 2388
440 Ga0207644_10099178 3300025931 Bacteria 2185
441 Ga0207644_10155359 3300025931 Bacteria 1773
442 Ga0207644_10336485 3300025931 Bacteria 1223
443 Ga0207690_10016622 3300025932 Bacteria 4481
444 Ga0207690_10039783 3300025932 Bacteria 3069
445 Ga0207690_10466721 3300025932 Bacteria 1017
446 Ga0207690_10488920 3300025932 Bacteria 994
447 Ga0207690_10501046 3300025932 Bacteria 982
448 Ga0207690_10698425 3300025932 Unclassified 834
449 Ga0207706_10004209 3300025933 Bacteria 13551
450 Ga0207706_10004893 3300025933 Bacteria 12526
451 Ga0207706_10109683 3300025933 Bacteria 2429
452 Ga0207706_10132115 3300025933 Bacteria 2196
453 Ga0207706_10262444 3300025933 Bacteria 1508
454 Ga0207706_10348575 3300025933 Bacteria 1288
455 Ga0207706_11484006 3300025933 Unclassified 554
456 Ga0207669_10004891 3300025937 Bacteria 5953
457 Ga0207669_10119669 3300025937 Bacteria 1784
458 Ga0207669_10240714 3300025937 Bacteria 1341
459 Ga0207704_10459181 3300025938 Bacteria 1018
460 Ga0207704_10805168 3300025938 Bacteria 785
461 Ga0207704_11040238 3300025938 Unclassified 694
462 Ga0207691_10010453 3300025940 Bacteria 8903
463 Ga0207691_10028885 3300025940 Bacteria 5190
464 Ga0207691_10054138 3300025940 Bacteria 3661
465 Ga0207691_10113632 3300025940 Bacteria 2406
466 Ga0207691_10845599 3300025940 Bacteria 768
467 Ga0207711_10001131 3300025941 Bacteria 25459
468 Ga0207711_10005984 3300025941 Bacteria 10279
469 Ga0207711_10018447 3300025941 Bacteria 5801
470 Ga0207711_10032438 3300025941 Bacteria 4416
471 Ga0207711_10440992 3300025941 Bacteria 1212
472 Ga0207711_10516009 3300025941 Bacteria 1114
473 Ga0207689_10017153 3300025942 Bacteria 6129
474 Ga0207689_10047270 3300025942 Bacteria 3555
475 Ga0207689_10299012 3300025942 Bacteria 1334
476 Ga0207689_10453176 3300025942 Bacteria 1072
477 Ga0207661_10002950 3300025944 Bacteria 11762
478 Ga0207661_10588457 3300025944 Bacteria 1021
479 Ga0207679_10024262 3300025945 Bacteria 4158
480 Ga0207679_10130236 3300025945 Bacteria 2017
481 Ga0207679_10205059 3300025945 Bacteria 1650
482 Ga0207679_10272052 3300025945 Bacteria 1449
483 Ga0207679_10343395 3300025945 Bacteria 1299
484 Ga0207679_10836822 3300025945 Bacteria 840
485 Ga0207679_11003439 3300025945 Bacteria 765
486 Ga0207667_10006485 3300025949 Bacteria 14155
487 Ga0207667_10254582 3300025949 Bacteria 1796
488 Ga0207667_11084303 3300025949 Bacteria 785
489 Ga0207651_10002688 3300025960 Bacteria 8513
490 Ga0207651_10014420 3300025960 Bacteria 4562
491 Ga0207651_10238208 3300025960 Bacteria 1481
492 Ga0207651_10262071 3300025960 Bacteria 1420
493 Ga0207712_11266493 3300025961 Bacteria 659
494 Ga0207712_11328481 3300025961 Bacteria 643
495 Ga0207668_10000086 3300025972 Bacteria 69871
496 Ga0207668_10178623 3300025972 Bacteria 1672
497 Ga0207668_10184657 3300025972 Bacteria 1648
498 Ga0207668_10186813 3300025972 Bacteria 1639
499 Ga0207668_11548574 3300025972 Bacteria 598
500 Ga0207668_11654106 3300025972 Bacteria 578
501 Ga0207640_10029285 3300025981 Bacteria 3378
502 Ga0207640_10280521 3300025981 Bacteria 1308
503 Ga0207640_10464213 3300025981 Bacteria 1046
504 Ga0207640_10665921 3300025981 Unclassified 888
505 Ga0207658_10002031 3300025986 Bacteria 15107
506 Ga0207658_10010473 3300025986 Bacteria 6297
507 Ga0207658_10043070 3300025986 Bacteria 3279
508 Ga0207658_10043350 3300025986 Bacteria 3270
509 Ga0207658_10046411 3300025986 Bacteria 3173
510 Ga0207658_10056646 3300025986 Bacteria 2910
511 Ga0207658_10068404 3300025986 Bacteria 2679
512 Ga0207658_10151755 3300025986 Bacteria 1888
513 Ga0207658_10363907 3300025986 Bacteria 1263
514 Ga0207658_10539332 3300025986 Bacteria 1043
515 Ga0207658_10540619 3300025986 Bacteria 1042
516 Ga0207658_11254773 3300025986 Unclassified 677
517 Ga0207677_10022762 3300026023 Bacteria 3858
518 Ga0207677_10307589 3300026023 Bacteria 1312
519 Ga0207677_12177142 3300026023 Bacteria 516
520 Ga0207703_10005582 3300026035 Bacteria 10098
521 Ga0207703_10189486 3300026035 Bacteria 1820
522 Ga0207703_10196246 3300026035 Bacteria 1791
523 Ga0207703_10334072 3300026035 Bacteria 1391
524 Ga0207703_11085353 3300026035 Bacteria 769
525 Ga0207639_10047762 3300026041 Bacteria 3237
526 Ga0207639_10085740 3300026041 Bacteria 2506
527 Ga0207639_10500143 3300026041 Bacteria 1110
528 Ga0207639_10543232 3300026041 Bacteria 1066
529 Ga0207639_11404915 3300026041 Bacteria 655
530 Ga0207678_10000217 3300026067 Bacteria 51179
531 Ga0207678_10009864 3300026067 Bacteria 8388
532 Ga0207678_10010463 3300026067 Bacteria 8146
533 Ga0207678_10015277 3300026067 Bacteria 6752
534 Ga0207678_10699810 3300026067 Bacteria 892
535 Ga0207678_11831290 3300026067 Bacteria 531
536 Ga0207702_10013141 3300026078 Bacteria 6883
537 Ga0207702_10179768 3300026078 Bacteria 1947
538 Ga0207702_10851144 3300026078 Bacteria 903
539 Ga0207702_12403337 3300026078 Bacteria 514
540 Ga0207702_12468894 3300026078 Bacteria 506
541 Ga0207641_10004163 3300026088 Bacteria 12605
542 Ga0207641_10019848 3300026088 Bacteria 5516
543 Ga0207641_10101337 3300026088 Bacteria 2537
544 Ga0207641_10115512 3300026088 Bacteria 2386
545 Ga0207641_10232815 3300026088 Bacteria 1713
546 Ga0207641_10778988 3300026088 Bacteria 945
547 Ga0207648_10001535 3300026089 Bacteria 25421
548 Ga0207648_10053565 3300026089 Bacteria 3526
549 Ga0207676_10013696 3300026095 Bacteria 5822
550 Ga0207676_10031084 3300026095 Bacteria 4013
551 Ga0207676_10353231 3300026095 Bacteria 1360
552 Ga0207676_10513954 3300026095 Bacteria 1139
553 Ga0207676_12150258 3300026095 Bacteria 556
554 Ga0207674_10003022 3300026116 Bacteria 20854
555 Ga0207674_10024700 3300026116 Bacteria 6416
556 Ga0207674_10065955 3300026116 Bacteria 3648
557 Ga0207675_100460281 3300026118 Bacteria 1262
558 Ga0207675_102163680 3300026118 Bacteria 572
559 Ga0207683_10000541 3300026121 Bacteria 34994
560 Ga0207683_10005768 3300026121 Bacteria 10613
561 Ga0207683_10015641 3300026121 Bacteria 6458
562 Ga0207683_10411449 3300026121 Bacteria 1245
563 Ga0207683_11325955 3300026121 Unclassified 666
564 Ga0207698_10001554 3300026142 Bacteria 13377
565 Ga0207698_10021943 3300026142 Bacteria 4426
566 Ga0207698_10083043 3300026142 Bacteria 2592
567 Ga0207698_10112284 3300026142 Bacteria 2287
568 Ga0207698_10118693 3300026142 Bacteria 2234
569 Ga0207698_11053246 3300026142 Bacteria 825
570 Ga0207698_11388778 3300026142 Bacteria 717
571 Ga0268266_10034827 3300028379 Bacteria 4283
572 Ga0268266_10122325 3300028379 Bacteria 2317
573 Ga0268266_10731300 3300028379 Bacteria 954
574 Ga0268265_10002511 3300028380 Bacteria 13738
575 Ga0268265_10358783 3300028380 Bacteria 1333
576 Ga0268265_12558909 3300028380 Bacteria 516
577 Ga0268264_10005393 3300028381 Bacteria 10828
578 Ga0268264_10011878 3300028381 Bacteria 7174
579 Ga0268264_10053137 3300028381 Bacteria 3380
580 Ga0268264_10395671 3300028381 Bacteria 1326
581 Ga0268264_11037825 3300028381 Bacteria 827
582 Ga0268264_11714972 3300028381 Bacteria 638
583 Ga0268264_12197274 3300028381 Bacteria 560
584 Ga0307410_11090771 3300031852 Bacteria 692
585 Ga0307410_11829180 3300031852 Bacteria 540
586 Ga0307409_102458471 3300031995 Bacteria 550
587 Ga0307416_101589439 3300032002 Bacteria 759
588 Ga0307416_102486880 3300032002 Bacteria 617
589 Ga0307415_100029692 3300032126 Bacteria 3498
590 Ga0307415_101212581 3300032126 Bacteria 711
591 Ga0373959_0178094 3300034820 Bacteria 551
592 Ga0373944_0121702 3300035089 Bacteria 900
593 Ga0373941_0119906 3300035115 Bacteria 937
594 Ga0373943_0037065 3300035170 Bacteria 2339
595 Ga0373935_0112406 3300035692 Bacteria 1809
596 Ga0373927_0096638 3300035695 Bacteria 1920
597 Ga0373947_0028056 3300035725 Bacteria 3297
598 Ga0373937_2084717 3300036401 Bacteria 513
599 Ga0373925_0020969 3300037068 Bacteria 4762
600 Ga0395899_0000270 3300037312 Bacteria 68004
601 Ga0395899_0000998 3300037312 Bacteria 25996
602 Ga0395899_0003175 3300037312 Bacteria 13042
603 Ga0395899_0243334 3300037312 Bacteria 1237
604 Ga0395899_0251923 3300037312 Bacteria 1211
605 Ga0395899_0540977 3300037312 Bacteria 750
606 Ga0395900_0000290 3300037418 Bacteria 75444
607 Ga0395900_0004722 3300037418 Bacteria 14370
608 Ga0395900_0034834 3300037418 Bacteria 5186
609 Ga0395900_0035230 3300037418 Bacteria 5155
610 Ga0395900_0051408 3300037418 Bacteria 4245
611 Ga0395900_0107032 3300037418 Bacteria 2873
612 Ga0395900_0173238 3300037418 Bacteria 2195
613 Ga0395900_0384182 3300037418 Bacteria 1371
614 Ga0395900_0560890 3300037418 Bacteria 1086
615 Ga0395900_0609434 3300037418 Bacteria 1032
616 Ga0395900_1937173 3300037418 Bacteria 500
617 Ga0395898_0000054 3300037466 Bacteria 279561
618 Ga0395898_0002537 3300037466 Bacteria 21412
619 Ga0395898_0006151 3300037466 Bacteria 12854
620 Ga0395898_0088531 3300037466 Bacteria 2980
621 Ga0395898_0552001 3300037466 Bacteria 1094
622 Ga0395898_1037030 3300037466 Bacteria 755
623 Ga0395898_1053918 3300037466 Bacteria 748
624 Ga0395898_1125464 3300037466 Bacteria 718
625 Ga0395905_0000046 3300037471 Bacteria 240463
626 Ga0395905_0001943 3300037471 Bacteria 23692
627 Ga0395905_0004285 3300037471 Bacteria 14873
628 Ga0395905_0022116 3300037471 Bacteria 6016
629 Ga0395905_0028526 3300037471 Bacteria 5261
630 Ga0395905_0035890 3300037471 Bacteria 4655
631 Ga0395905_0061629 3300037471 Bacteria 3509
632 Ga0395905_0145811 3300037471 Bacteria 2227
633 Ga0395905_0179531 3300037471 Bacteria 1987
634 Ga0395905_0205413 3300037471 Bacteria 1846
635 Ga0395905_0279940 3300037471 Bacteria 1554
636 Ga0395905_0298788 3300037471 Bacteria 1497
637 Ga0395905_0405413 3300037471 Bacteria 1258
638 Ga0395905_0530940 3300037471 Bacteria 1077
639 Ga0395905_0622285 3300037471 Bacteria 981
640 Ga0395905_0753200 3300037471 Bacteria 876
641 Ga0395905_1627037 3300037471 Bacteria 551
642 Ga0395901_0000102 3300038443 Bacteria 115611
643 Ga0395901_0003921 3300038443 Bacteria 14966
644 Ga0395901_0004019 3300038443 Bacteria 14813
645 Ga0395901_0008199 3300038443 Bacteria 10557
646 Ga0395901_0110381 3300038443 Bacteria 2887
647 Ga0395901_0115681 3300038443 Bacteria 2817
648 Ga0395901_0410998 3300038443 Bacteria 1389
649 Ga0395901_1013823 3300038443 Bacteria 805
650 Ga0395901_2079359 3300038443 Bacteria 513
651 Ga0451843_0966362 3300041509 Bacteria 604
652 Ga0451853_3358249 3300041512 Bacteria 756
653 Ga0450898_047127 3300042134 Bacteria 826
654 Ga0439458_0000409 3300042157 Bacteria 10769
655 Ga0466969_0461202 3300044656 Bacteria 578
656 Ga0466972_0227153 3300044658 Bacteria 874
657 Ga0466965_0045498 3300044683 Bacteria 2171
658 Ga0466965_0047113 3300044683 Bacteria 2134
659 Ga0466966_0039692 3300044684 Bacteria 3031
660 Ga0466966_0088750 3300044684 Unclassified 1921
661 Ga0466966_0840913 3300044684 Bacteria 553
662 Ga0466961_0011100 3300044693 Bacteria 5759
663 Ga0466961_0021179 3300044693 Bacteria 4185
664 Ga0466963_0001468 3300044694 Bacteria 12735
665 Ga0466963_0002992 3300044694 Bacteria 9559
666 Ga0466963_0419079 3300044694 Bacteria 944
667 Ga0466963_0720165 3300044694 Bacteria 704
668 Ga0466964_0017249 3300044706 Bacteria 2763
669 Ga0466964_0099252 3300044706 Bacteria 1281
670 Ga0466970_0946215 3300044765 Unclassified 507
671 Ga0466957_0000630 3300044842 Bacteria 17878
672 Ga0466957_0038452 3300044842 Bacteria 2883
673 Ga0466957_1404196 3300044842 Bacteria 508
674 Ga0466960_0017037 3300044901 Bacteria 3162
675 Ga0466960_0409869 3300044901 Bacteria 782
676 Ga0466959_0258420 3300045049 Bacteria 1199
677 Ga0466959_0324220 3300045049 Bacteria 1053
678 Ga0466959_0804483 3300045049 Bacteria 628
679 Ga0466958_0089392 3300045836 Bacteria 1904
680 Ga0466958_0113732 3300045836 Unclassified 1690
681 Ga0466967_0012674 3300045976 Bacteria 6468
682 Ga0466967_0020351 3300045976 Bacteria 5361
683 Ga0466967_0043629 3300045976 Bacteria 3884
684 Ga0466967_0064589 3300045976 Bacteria 3255
685 Ga0466967_0603687 3300045976 Bacteria 1083
686 Ga0466967_2133310 3300045976 Bacteria 556
687 Ga0495629_0331764 3300046459 Bacteria 1039
688 Ga0495598_0000426 3300046537 Bacteria 7621
689 Ga0495621_0002280 3300046539 Bacteria 5136
690 Ga0495621_0206481 3300046539 Bacteria 792
691 Ga0495633_0212495 3300046558 Bacteria 886
692 Ga0495625_0057447 3300046660 Bacteria 2767
693 Ga0495669_0007270 3300046684 Bacteria 4637
694 Ga0495669_0102942 3300046684 Bacteria 1327
695 Ga0495669_0212838 3300046684 Bacteria 925
696 Ga0495669_0358612 3300046684 Bacteria 705
697 Ga0495670_0000148 3300046691 Bacteria 30968
698 Ga0495672_0218644 3300047320 Bacteria 942
699 Ga0496100_0060100 3300048903 Bacteria 2500
700 Ga0496101_0100868 3300048904 Bacteria 2160
701 Ga0496101_0195000 3300048904 Bacteria 1564
702 Ga0496101_0222960 3300048904 Bacteria 1463
703 Ga0496101_0254049 3300048904 Bacteria 1370
704 Ga0496101_0393672 3300048904 Bacteria 1091
705 Ga0496101_0701220 3300048904 Bacteria 799
706 Ga0496101_0735712 3300048904 Bacteria 778
707 Ga0496102_0012425 3300048905 Bacteria 7368
708 Ga0496102_0281089 3300048905 Bacteria 1569
709 Ga0496103_0011174 3300048906 Bacteria 5316
710 Ga0496103_0407747 3300048906 Bacteria 873
711 Ga0496103_0476165 3300048906 Bacteria 800
712 Ga0496105_0191850 3300048908 Bacteria 1670
713 Ga0496106_0066341 3300048909 Bacteria 2749
714 Ga0496107_0010960 3300048910 Bacteria 6307
715 Ga0496107_0036939 3300048910 Bacteria 3505
716 Ga0496107_0127630 3300048910 Bacteria 1876
717 Ga0496107_0159382 3300048910 Bacteria 1672
718 Ga0496107_0163870 3300048910 Bacteria 1648
719 Ga0496107_0340279 3300048910 Bacteria 1116
720 Ga0496107_0384545 3300048910 Bacteria 1044
721 Ga0496107_0670894 3300048910 Bacteria 763
722 Ga0496107_1282638 3300048910 Unclassified 524
723 Ga0496108_0005054 3300048911 Bacteria 10659
724 Ga0496108_0410677 3300048911 Unclassified 1182
725 Ga0496108_1134728 3300048911 Bacteria 663
726 Ga0496109_0004047 3300048912 Bacteria 12245
727 Ga0496109_0022851 3300048912 Bacteria 5542
728 Ga0496109_0254243 3300048912 Bacteria 1655
729 Ga0496109_0547314 3300048912 Bacteria 1092
730 Ga0496109_1908533 3300048912 Bacteria 526
731 Ga0496109_1971139 3300048912 Bacteria 516
732 Ga0496110_0001649 3300048913 Bacteria 16372
733 Ga0496110_0006018 3300048913 Bacteria 9554
734 Ga0496110_0030168 3300048913 Bacteria 4673
735 Ga0496110_0032271 3300048913 Bacteria 4522
736 Ga0496111_0009769 3300048914 Bacteria 6413
737 Ga0496111_0044116 3300048914 Bacteria 3205
738 Ga0496112_0035398 3300048915 Bacteria 4863
739 Ga0496112_0136820 3300048915 Bacteria 2419
740 Ga0496112_0198989 3300048915 Bacteria 1963
741 Ga0496113_0002738 3300048916 Bacteria 10360
742 Ga0496113_0018235 3300048916 Bacteria 4887
743 Ga0496113_0022120 3300048916 Bacteria 4492
744 Ga0496114_0004676 3300048917 Bacteria 10644
745 Ga0496114_0025026 3300048917 Bacteria 4876
746 Ga0496115_0156435 3300048918 Bacteria 1883
747 Ga0501034_0848369 3300049571 Bacteria 804
748 Ga0501068_0692632 3300049584 Bacteria 666
749 Ga0501069_0448426 3300049585 Bacteria 767
750 Ga0501073_0627850 3300049589 Bacteria 742
751 Ga0501074_0079494 3300049590 Bacteria 2353
752 Ga0501080_0101660 3300049742 Bacteria 2667
753 Ga0501035_1471447 3300049822 Bacteria 520
754 nmdc:mga03n38_792830_c1 3300050490 Bacteria 551
755 nmdc:mga00v17_946026_c1 3300050491 Bacteria 544
756 nmdc:mga0yw44_1045453_c1 3300050492 Bacteria 552
757 nmdc:mga08y16_1856858_c1 3300050511 Bacteria 554
758 Ga0500587_000138 3300053739 Bacteria 6885
759 Ga0466962_0220849 3300061719 Bacteria 928
760 Ga0466962_0413344 3300061719 Bacteria 676

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10762260 Ga0163162_107622603 69
2 3300041512 Ga0451853_3358249 Ga0451853_3358249_401_670 79
3 3300048913 Ga0496110_0032271 Ga0496110_0032271_1483_1752 79
4 3300005366 Ga0070659_101196792 Ga0070659_1011967922 81
5 3300005367 Ga0070667_100708424 Ga0070667_1007084241 81
6 3300005578 Ga0068854_102276236 Ga0068854_1022762361 81
7 3300005842 Ga0068858_102090360 Ga0068858_1020903602 81
8 3300005843 Ga0068860_100197813 Ga0068860_1001978133 81
9 3300005844 Ga0068862_101363624 Ga0068862_1013636242 81
10 3300013104 Ga0157370_10682368 Ga0157370_106823682 81
11 3300025986 Ga0207658_10540619 Ga0207658_105406192 81
12 3300028381 Ga0268264_10011878 Ga0268264_100118789 81
13 3300032002 Ga0307416_102486880 Ga0307416_1024868802 81
14 3300041509 Ga0451843_0966362 Ga0451843_0966362_324_572 81
15 3300046660 Ga0495625_0057447 Ga0495625_0057447_338_586 81
16 3300053739 Ga0500587_000138 Ga0500587_000138_2334_2582 81
17 3300005530 Ga0070679_101568906 Ga0070679_1015689061 86
18 3300010375 Ga0105239_10853917 Ga0105239_108539172 86
19 3300013105 Ga0157369_10003984 Ga0157369_1000398415 86
20 3300042134 Ga0450898_047127 Ga0450898_047127_320_586 86
21 3300005336 Ga0070680_101710288 Ga0070680_1017102881 87
22 3300005339 Ga0070660_100072622 Ga0070660_1000726221 87
23 3300005339 Ga0070660_100114199 Ga0070660_1001141992 87
24 3300005366 Ga0070659_100034514 Ga0070659_1000345143 87
25 3300005366 Ga0070659_101385352 Ga0070659_1013853522 87
26 3300005564 Ga0070664_100319834 Ga0070664_1003198343 87
27 3300005578 Ga0068854_101930246 Ga0068854_1019302462 87
28 3300013296 Ga0157374_10650187 Ga0157374_106501872 87
29 3300013307 Ga0157372_10479603 Ga0157372_104796032 87
30 3300025909 Ga0207705_10289762 Ga0207705_102897622 87
31 3300025917 Ga0207660_11449314 Ga0207660_114493142 87
32 3300025919 Ga0207657_10130544 Ga0207657_101305442 87
33 3300025920 Ga0207649_10034401 Ga0207649_100344013 87
34 3300025920 Ga0207649_10438490 Ga0207649_104384901 87
35 3300025921 Ga0207652_10439743 Ga0207652_104397432 87
36 3300025932 Ga0207690_10039783 Ga0207690_100397832 87
37 3300025932 Ga0207690_10466721 Ga0207690_104667212 87
38 3300025933 Ga0207706_10262444 Ga0207706_102624443 87
39 3300025945 Ga0207679_11003439 Ga0207679_110034392 87
40 3300026067 Ga0207678_10009864 Ga0207678_100098648 87
41 3300001915 JGI24741J21665_1004116 JGI24741J21665_10041163 88
42 3300001979 JGI24740J21852_10006636 JGI24740J21852_100066364 88
43 3300001979 JGI24740J21852_10044450 JGI24740J21852_100444502 88
44 3300001979 JGI24740J21852_10111174 JGI24740J21852_101111742 88
45 3300001990 JGI24737J22298_10178200 JGI24737J22298_101782002 88
46 3300002067 JGI24735J21928_10024566 JGI24735J21928_100245662 88
47 3300002075 JGI24738J21930_10069572 JGI24738J21930_100695721 88
48 3300002239 JGI24034J26672_10051999 JGI24034J26672_100519991 88
49 3300005290 Ga0065712_10305370 Ga0065712_103053702 88
50 3300005293 Ga0065715_10412033 Ga0065715_104120332 88
51 3300005327 Ga0070658_10001056 Ga0070658_100010566 88
52 3300005327 Ga0070658_10064186 Ga0070658_100641862 88
53 3300005327 Ga0070658_10092954 Ga0070658_100929542 88
54 3300005327 Ga0070658_10234519 Ga0070658_102345192 88
55 3300005327 Ga0070658_10659939 Ga0070658_106599391 88
56 3300005327 Ga0070658_11051967 Ga0070658_110519672 88
57 3300005328 Ga0070676_10014314 Ga0070676_100143142 88
58 3300005328 Ga0070676_10021737 Ga0070676_100217372 88
59 3300005329 Ga0070683_100001823 Ga0070683_10000182312 88
60 3300005330 Ga0070690_100624028 Ga0070690_1006240281 88
61 3300005331 Ga0070670_100022194 Ga0070670_1000221947 88
62 3300005331 Ga0070670_100029461 Ga0070670_1000294612 88
63 3300005331 Ga0070670_100041338 Ga0070670_1000413385 88
64 3300005331 Ga0070670_100140812 Ga0070670_1001408122 88
65 3300005331 Ga0070670_100670829 Ga0070670_1006708292 88
66 3300005331 Ga0070670_101920709 Ga0070670_1019207091 88
67 3300005331 Ga0070670_102024131 Ga0070670_1020241312 88
68 3300005331 Ga0070670_102098580 Ga0070670_1020985801 88
69 3300005333 Ga0070677_10518799 Ga0070677_105187992 88
70 3300005334 Ga0068869_100043873 Ga0068869_1000438734 88
71 3300005334 Ga0068869_100215651 Ga0068869_1002156512 88
72 3300005334 Ga0068869_100291638 Ga0068869_1002916383 88
73 3300005334 Ga0068869_100853130 Ga0068869_1008531302 88
74 3300005335 Ga0070666_10003456 Ga0070666_1000345610 88
75 3300005335 Ga0070666_10043454 Ga0070666_100434542 88
76 3300005335 Ga0070666_10051321 Ga0070666_100513212 88
77 3300005335 Ga0070666_10528712 Ga0070666_105287122 88
78 3300005336 Ga0070680_100001306 Ga0070680_1000013067 88
79 3300005336 Ga0070680_100154756 Ga0070680_1001547563 88
80 3300005336 Ga0070680_101076432 Ga0070680_1010764322 88
81 3300005336 Ga0070680_101181277 Ga0070680_1011812772 88
82 3300005337 Ga0070682_100019091 Ga0070682_1000190912 88
83 3300005337 Ga0070682_100078258 Ga0070682_1000782582 88
84 3300005338 Ga0068868_100149441 Ga0068868_1001494411 88
85 3300005338 Ga0068868_100358143 Ga0068868_1003581431 88
86 3300005338 Ga0068868_100567498 Ga0068868_1005674982 88
87 3300005338 Ga0068868_100989463 Ga0068868_1009894632 88
88 3300005338 Ga0068868_101148399 Ga0068868_1011483992 88
89 3300005339 Ga0070660_100002280 Ga0070660_1000022802 88
90 3300005339 Ga0070660_100182022 Ga0070660_1001820222 88
91 3300005339 Ga0070660_100311592 Ga0070660_1003115923 88
92 3300005339 Ga0070660_100629583 Ga0070660_1006295832 88
93 3300005339 Ga0070660_100824980 Ga0070660_1008249801 88
94 3300005339 Ga0070660_101712182 Ga0070660_1017121822 88
95 3300005341 Ga0070691_10407110 Ga0070691_104071102 88
96 3300005344 Ga0070661_100020291 Ga0070661_1000202914 88
97 3300005344 Ga0070661_100033255 Ga0070661_1000332552 88
98 3300005344 Ga0070661_100033786 Ga0070661_1000337862 88
99 3300005344 Ga0070661_100060678 Ga0070661_1000606785 88
100 3300005344 Ga0070661_100068490 Ga0070661_1000684902 88
101 3300005344 Ga0070661_100080352 Ga0070661_1000803522 88
102 3300005344 Ga0070661_100166055 Ga0070661_1001660552 88
103 3300005344 Ga0070661_100467755 Ga0070661_1004677552 88
104 3300005344 Ga0070661_100588032 Ga0070661_1005880321 88
105 3300005344 Ga0070661_100731868 Ga0070661_1007318682 88
106 3300005344 Ga0070661_101291722 Ga0070661_1012917221 88
107 3300005344 Ga0070661_101864834 Ga0070661_1018648341 88
108 3300005345 Ga0070692_10023376 Ga0070692_100233766 88
109 3300005345 Ga0070692_10104582 Ga0070692_101045822 88
110 3300005347 Ga0070668_100018998 Ga0070668_1000189981 88
111 3300005347 Ga0070668_100321102 Ga0070668_1003211022 88
112 3300005347 Ga0070668_100346955 Ga0070668_1003469552 88
113 3300005347 Ga0070668_100637813 Ga0070668_1006378132 88
114 3300005347 Ga0070668_100883144 Ga0070668_1008831442 88
115 3300005347 Ga0070668_101700548 Ga0070668_1017005481 88
116 3300005347 Ga0070668_102280429 Ga0070668_1022804291 88
117 3300005353 Ga0070669_101110824 Ga0070669_1011108242 88
118 3300005353 Ga0070669_101344153 Ga0070669_1013441531 88
119 3300005353 Ga0070669_101881252 Ga0070669_1018812521 88
120 3300005353 Ga0070669_101915434 Ga0070669_1019154341 88
121 3300005354 Ga0070675_100026302 Ga0070675_1000263022 88
122 3300005354 Ga0070675_100109167 Ga0070675_1001091671 88
123 3300005354 Ga0070675_100460169 Ga0070675_1004601692 88
124 3300005354 Ga0070675_101070983 Ga0070675_1010709831 88
125 3300005355 Ga0070671_100010695 Ga0070671_1000106954 88
126 3300005355 Ga0070671_100115166 Ga0070671_1001151663 88
127 3300005355 Ga0070671_100143086 Ga0070671_1001430862 88
128 3300005355 Ga0070671_100149951 Ga0070671_1001499512 88
129 3300005355 Ga0070671_100161403 Ga0070671_1001614032 88
130 3300005355 Ga0070671_100195176 Ga0070671_1001951762 88
131 3300005355 Ga0070671_100854568 Ga0070671_1008545682 88
132 3300005355 Ga0070671_101991096 Ga0070671_1019910961 88
133 3300005356 Ga0070674_100007740 Ga0070674_1000077407 88
134 3300005356 Ga0070674_100772644 Ga0070674_1007726442 88
135 3300005356 Ga0070674_101154814 Ga0070674_1011548142 88
136 3300005364 Ga0070673_100005116 Ga0070673_1000051168 88
137 3300005364 Ga0070673_100032534 Ga0070673_1000325342 88
138 3300005364 Ga0070673_100118869 Ga0070673_1001188692 88
139 3300005364 Ga0070673_100237403 Ga0070673_1002374032 88
140 3300005364 Ga0070673_100256536 Ga0070673_1002565362 88
141 3300005364 Ga0070673_101705671 Ga0070673_1017056712 88
142 3300005366 Ga0070659_100009647 Ga0070659_1000096475 88
143 3300005366 Ga0070659_100163543 Ga0070659_1001635432 88
144 3300005366 Ga0070659_101065561 Ga0070659_1010655612 88
145 3300005366 Ga0070659_101162179 Ga0070659_1011621792 88
146 3300005366 Ga0070659_101712431 Ga0070659_1017124312 88
147 3300005367 Ga0070667_100002393 Ga0070667_10000239316 88
148 3300005367 Ga0070667_100036352 Ga0070667_1000363523 88
149 3300005367 Ga0070667_100037369 Ga0070667_1000373694 88
150 3300005367 Ga0070667_100075329 Ga0070667_1000753293 88
151 3300005367 Ga0070667_100496086 Ga0070667_1004960863 88
152 3300005367 Ga0070667_100506945 Ga0070667_1005069452 88
153 3300005367 Ga0070667_100647498 Ga0070667_1006474982 88
154 3300005367 Ga0070667_100674901 Ga0070667_1006749012 88
155 3300005367 Ga0070667_100712488 Ga0070667_1007124882 88
156 3300005367 Ga0070667_100740857 Ga0070667_1007408572 88
157 3300005367 Ga0070667_100763163 Ga0070667_1007631631 88
158 3300005367 Ga0070667_100854720 Ga0070667_1008547202 88
159 3300005436 Ga0070713_100942658 Ga0070713_1009426582 88
160 3300005437 Ga0070710_10610693 Ga0070710_106106932 88
161 3300005440 Ga0070705_100515045 Ga0070705_1005150452 88
162 3300005440 Ga0070705_101150988 Ga0070705_1011509882 88
163 3300005455 Ga0070663_100000271 Ga0070663_10000027122 88
164 3300005455 Ga0070663_100057324 Ga0070663_1000573244 88
165 3300005455 Ga0070663_100097344 Ga0070663_1000973443 88
166 3300005455 Ga0070663_100307846 Ga0070663_1003078462 88
167 3300005455 Ga0070663_100391464 Ga0070663_1003914641 88
168 3300005455 Ga0070663_100482154 Ga0070663_1004821542 88
169 3300005455 Ga0070663_100731588 Ga0070663_1007315881 88
170 3300005456 Ga0070678_100011061 Ga0070678_1000110613 88
171 3300005456 Ga0070678_100158426 Ga0070678_1001584262 88
172 3300005456 Ga0070678_102050242 Ga0070678_1020502421 88
173 3300005457 Ga0070662_100001018 Ga0070662_10000101814 88
174 3300005457 Ga0070662_100074011 Ga0070662_1000740112 88
175 3300005457 Ga0070662_100161640 Ga0070662_1001616402 88
176 3300005457 Ga0070662_100664919 Ga0070662_1006649191 88
177 3300005458 Ga0070681_10015737 Ga0070681_100157373 88
178 3300005458 Ga0070681_10067960 Ga0070681_100679602 88
179 3300005458 Ga0070681_10431034 Ga0070681_104310342 88
180 3300005458 Ga0070681_11690843 Ga0070681_116908432 88
181 3300005459 Ga0068867_100003017 Ga0068867_1000030173 88
182 3300005459 Ga0068867_100227968 Ga0068867_1002279683 88
183 3300005466 Ga0070685_10057069 Ga0070685_100570692 88
184 3300005466 Ga0070685_11059549 Ga0070685_110595492 88
185 3300005530 Ga0070679_100000346 Ga0070679_10000034629 88
186 3300005530 Ga0070679_100332434 Ga0070679_1003324342 88
187 3300005530 Ga0070679_100340672 Ga0070679_1003406722 88
188 3300005530 Ga0070679_101099751 Ga0070679_1010997511 88
189 3300005535 Ga0070684_101221319 Ga0070684_1012213192 88
190 3300005536 Ga0070697_101176841 Ga0070697_1011768412 88
191 3300005539 Ga0068853_100039150 Ga0068853_1000391506 88
192 3300005539 Ga0068853_100107496 Ga0068853_1001074963 88
193 3300005539 Ga0068853_100345817 Ga0068853_1003458172 88
194 3300005539 Ga0068853_100428474 Ga0068853_1004284742 88
195 3300005539 Ga0068853_100923459 Ga0068853_1009234592 88
196 3300005539 Ga0068853_100984180 Ga0068853_1009841802 88
197 3300005539 Ga0068853_102073122 Ga0068853_1020731221 88
198 3300005543 Ga0070672_100064580 Ga0070672_1000645804 88
199 3300005543 Ga0070672_100102934 Ga0070672_1001029343 88
200 3300005543 Ga0070672_100125287 Ga0070672_1001252872 88
201 3300005543 Ga0070672_100139318 Ga0070672_1001393182 88
202 3300005543 Ga0070672_100725664 Ga0070672_1007256642 88
203 3300005544 Ga0070686_101439915 Ga0070686_1014399151 88
204 3300005545 Ga0070695_100834250 Ga0070695_1008342501 88
205 3300005546 Ga0070696_100344834 Ga0070696_1003448342 88
206 3300005547 Ga0070693_100723640 Ga0070693_1007236402 88
207 3300005547 Ga0070693_100741077 Ga0070693_1007410772 88
208 3300005548 Ga0070665_100047018 Ga0070665_1000470186 88
209 3300005548 Ga0070665_100724673 Ga0070665_1007246732 88
210 3300005548 Ga0070665_100944391 Ga0070665_1009443912 88
211 3300005563 Ga0068855_100009125 Ga0068855_1000091252 88
212 3300005563 Ga0068855_100083160 Ga0068855_1000831604 88
213 3300005563 Ga0068855_100582068 Ga0068855_1005820682 88
214 3300005564 Ga0070664_100006576 Ga0070664_1000065767 88
215 3300005564 Ga0070664_100012615 Ga0070664_1000126152 88
216 3300005564 Ga0070664_100035259 Ga0070664_1000352597 88
217 3300005564 Ga0070664_100064886 Ga0070664_1000648862 88
218 3300005564 Ga0070664_100081576 Ga0070664_1000815762 88
219 3300005564 Ga0070664_100177496 Ga0070664_1001774962 88
220 3300005564 Ga0070664_100321986 Ga0070664_1003219862 88
221 3300005577 Ga0068857_100010349 Ga0068857_1000103498 88
222 3300005577 Ga0068857_100040473 Ga0068857_1000404736 88
223 3300005577 Ga0068857_100587708 Ga0068857_1005877082 88
224 3300005577 Ga0068857_101131274 Ga0068857_1011312741 88
225 3300005578 Ga0068854_100043054 Ga0068854_1000430545 88
226 3300005578 Ga0068854_100110134 Ga0068854_1001101343 88
227 3300005578 Ga0068854_100117343 Ga0068854_1001173432 88
228 3300005578 Ga0068854_100507859 Ga0068854_1005078592 88
229 3300005578 Ga0068854_100732837 Ga0068854_1007328372 88
230 3300005614 Ga0068856_100016476 Ga0068856_1000164764 88
231 3300005614 Ga0068856_100018394 Ga0068856_1000183947 88
232 3300005614 Ga0068856_100315111 Ga0068856_1003151112 88
233 3300005614 Ga0068856_100725498 Ga0068856_1007254982 88
234 3300005614 Ga0068856_100975793 Ga0068856_1009757932 88
235 3300005614 Ga0068856_101285131 Ga0068856_1012851312 88
236 3300005614 Ga0068856_101897954 Ga0068856_1018979541 88
237 3300005615 Ga0070702_100145871 Ga0070702_1001458713 88
238 3300005616 Ga0068852_100005849 Ga0068852_1000058491 88
239 3300005616 Ga0068852_100035562 Ga0068852_1000355621 88
240 3300005616 Ga0068852_100083782 Ga0068852_1000837822 88
241 3300005616 Ga0068852_100144204 Ga0068852_1001442043 88
242 3300005616 Ga0068852_100179808 Ga0068852_1001798082 88
243 3300005616 Ga0068852_100236611 Ga0068852_1002366111 88
244 3300005616 Ga0068852_100331534 Ga0068852_1003315342 88
245 3300005617 Ga0068859_100051278 Ga0068859_1000512786 88
246 3300005617 Ga0068859_100335433 Ga0068859_1003354332 88
247 3300005617 Ga0068859_100434249 Ga0068859_1004342492 88
248 3300005617 Ga0068859_101256627 Ga0068859_1012566272 88
249 3300005617 Ga0068859_102158555 Ga0068859_1021585552 88
250 3300005617 Ga0068859_102831081 Ga0068859_1028310812 88
251 3300005618 Ga0068864_100010864 Ga0068864_1000108644 88
252 3300005618 Ga0068864_100012608 Ga0068864_1000126088 88
253 3300005618 Ga0068864_100210534 Ga0068864_1002105343 88
254 3300005618 Ga0068864_100343428 Ga0068864_1003434282 88
255 3300005618 Ga0068864_100877709 Ga0068864_1008777092 88
256 3300005718 Ga0068866_11044380 Ga0068866_110443801 88
257 3300005719 Ga0068861_101299803 Ga0068861_1012998032 88
258 3300005719 Ga0068861_101748846 Ga0068861_1017488461 88
259 3300005834 Ga0068851_10001758 Ga0068851_100017584 88
260 3300005834 Ga0068851_10062144 Ga0068851_100621442 88
261 3300005834 Ga0068851_10069537 Ga0068851_100695372 88
262 3300005834 Ga0068851_10073656 Ga0068851_100736562 88
263 3300005834 Ga0068851_10130077 Ga0068851_101300772 88
264 3300005840 Ga0068870_10037294 Ga0068870_100372943 88
265 3300005840 Ga0068870_10301164 Ga0068870_103011643 88
266 3300005841 Ga0068863_100000607 Ga0068863_10000060713 88
267 3300005841 Ga0068863_100011565 Ga0068863_1000115655 88
268 3300005841 Ga0068863_100043854 Ga0068863_1000438543 88
269 3300005841 Ga0068863_100252699 Ga0068863_1002526992 88
270 3300005842 Ga0068858_100006875 Ga0068858_10000687510 88
271 3300005842 Ga0068858_100032216 Ga0068858_1000322166 88
272 3300005842 Ga0068858_100525312 Ga0068858_1005253123 88
273 3300005842 Ga0068858_101562566 Ga0068858_1015625662 88
274 3300005842 Ga0068858_102196719 Ga0068858_1021967192 88
275 3300005843 Ga0068860_100063733 Ga0068860_1000637332 88
276 3300005843 Ga0068860_100160363 Ga0068860_1001603632 88
277 3300005843 Ga0068860_100180289 Ga0068860_1001802892 88
278 3300005843 Ga0068860_100962590 Ga0068860_1009625901 88
279 3300005843 Ga0068860_102435410 Ga0068860_1024354101 88
280 3300005844 Ga0068862_100223546 Ga0068862_1002235462 88
281 3300005844 Ga0068862_100620056 Ga0068862_1006200562 88
282 3300005844 Ga0068862_100624199 Ga0068862_1006241992 88
283 3300005985 Ga0081539_10022959 Ga0081539_100229592 88
284 3300006038 Ga0075365_11185979 Ga0075365_111859792 88
285 3300006048 Ga0075363_100911267 Ga0075363_1009112672 88
286 3300006051 Ga0075364_10602526 Ga0075364_106025262 88
287 3300006237 Ga0097621_100034174 Ga0097621_1000341742 88
288 3300006237 Ga0097621_100049260 Ga0097621_1000492602 88
289 3300006237 Ga0097621_100083846 Ga0097621_1000838464 88
290 3300006358 Ga0068871_100030913 Ga0068871_1000309133 88
291 3300006358 Ga0068871_100088118 Ga0068871_1000881184 88
292 3300006358 Ga0068871_100109365 Ga0068871_1001093653 88
293 3300006358 Ga0068871_100125435 Ga0068871_1001254352 88
294 3300006358 Ga0068871_100502613 Ga0068871_1005026132 88
295 3300006358 Ga0068871_100660570 Ga0068871_1006605702 88
296 3300006881 Ga0068865_100105243 Ga0068865_1001052433 88
297 3300006881 Ga0068865_100120487 Ga0068865_1001204872 88
298 3300006881 Ga0068865_100610670 Ga0068865_1006106702 88
299 3300006881 Ga0068865_101765758 Ga0068865_1017657582 88
300 3300006931 Ga0097620_100051278 Ga0097620_1000512786 88
301 3300006931 Ga0097620_100335428 Ga0097620_1003354282 88
302 3300006931 Ga0097620_100434237 Ga0097620_1004342372 88
303 3300006931 Ga0097620_101256489 Ga0097620_1012564892 88
304 3300006931 Ga0097620_102158321 Ga0097620_1021583212 88
305 3300006931 Ga0097620_102830879 Ga0097620_1028308792 88
306 3300007076 Ga0075435_100135083 Ga0075435_1001350832 88
307 3300009094 Ga0111539_10188678 Ga0111539_101886782 88
308 3300009094 Ga0111539_11832955 Ga0111539_118329551 88
309 3300009098 Ga0105245_11832706 Ga0105245_118327062 88
310 3300009098 Ga0105245_13235962 Ga0105245_132359622 88
311 3300009101 Ga0105247_10245877 Ga0105247_102458772 88
312 3300009148 Ga0105243_10472642 Ga0105243_104726422 88
313 3300009174 Ga0105241_10858151 Ga0105241_108581512 88
314 3300009177 Ga0105248_10003825 Ga0105248_100038254 88
315 3300009177 Ga0105248_10003900 Ga0105248_100039003 88
316 3300009177 Ga0105248_10028196 Ga0105248_100281966 88
317 3300009177 Ga0105248_10031637 Ga0105248_100316378 88
318 3300009177 Ga0105248_10050987 Ga0105248_100509874 88
319 3300009177 Ga0105248_10369712 Ga0105248_103697122 88
320 3300009177 Ga0105248_10856061 Ga0105248_108560612 88
321 3300009177 Ga0105248_11878887 Ga0105248_118788871 88
322 3300009177 Ga0105248_12929703 Ga0105248_129297032 88
323 3300009545 Ga0105237_10008511 Ga0105237_100085116 88
324 3300009545 Ga0105237_10026407 Ga0105237_100264072 88
325 3300009545 Ga0105237_10106121 Ga0105237_101061212 88
326 3300009551 Ga0105238_10163614 Ga0105238_101636142 88
327 3300009551 Ga0105238_11631009 Ga0105238_116310092 88
328 3300009551 Ga0105238_12452109 Ga0105238_124521091 88
329 3300009553 Ga0105249_10119887 Ga0105249_101198872 88
330 3300009553 Ga0105249_12162334 Ga0105249_121623342 88
331 3300011119 Ga0105246_10738399 Ga0105246_107383992 88
332 3300011119 Ga0105246_12107904 Ga0105246_121079041 88
333 3300013100 Ga0157373_10062376 Ga0157373_100623762 88
334 3300013100 Ga0157373_10063721 Ga0157373_100637212 88
335 3300013100 Ga0157373_10065815 Ga0157373_100658152 88
336 3300013100 Ga0157373_10069494 Ga0157373_100694942 88
337 3300013100 Ga0157373_10542954 Ga0157373_105429542 88
338 3300013100 Ga0157373_10614010 Ga0157373_106140102 88
339 3300013102 Ga0157371_10048437 Ga0157371_100484372 88
340 3300013102 Ga0157371_10161022 Ga0157371_101610222 88
341 3300013102 Ga0157371_10178891 Ga0157371_101788912 88
342 3300013104 Ga0157370_10009490 Ga0157370_100094904 88
343 3300013104 Ga0157370_10101505 Ga0157370_101015052 88
344 3300013104 Ga0157370_10240149 Ga0157370_102401492 88
345 3300013104 Ga0157370_11276736 Ga0157370_112767362 88
346 3300013105 Ga0157369_10046645 Ga0157369_100466453 88
347 3300013105 Ga0157369_10589237 Ga0157369_105892372 88
348 3300013105 Ga0157369_11741992 Ga0157369_117419922 88
349 3300013105 Ga0157369_12212906 Ga0157369_122129061 88
350 3300013296 Ga0157374_10051565 Ga0157374_100515652 88
351 3300013296 Ga0157374_10059163 Ga0157374_100591632 88
352 3300013296 Ga0157374_10126976 Ga0157374_101269766 88
353 3300013296 Ga0157374_10165252 Ga0157374_101652522 88
354 3300013297 Ga0157378_10289604 Ga0157378_102896042 88
355 3300013306 Ga0163162_10004976 Ga0163162_1000497610 88
356 3300013306 Ga0163162_10013507 Ga0163162_100135079 88
357 3300013306 Ga0163162_10293129 Ga0163162_102931292 88
358 3300013306 Ga0163162_11117790 Ga0163162_111177902 88
359 3300013306 Ga0163162_13371909 Ga0163162_133719091 88
360 3300013307 Ga0157372_10584450 Ga0157372_105844503 88
361 3300013307 Ga0157372_10595510 Ga0157372_105955102 88
362 3300013307 Ga0157372_11465684 Ga0157372_114656842 88
363 3300013307 Ga0157372_12432697 Ga0157372_124326972 88
364 3300013308 Ga0157375_10005040 Ga0157375_100050407 88
365 3300013308 Ga0157375_10044879 Ga0157375_100448792 88
366 3300013308 Ga0157375_10060068 Ga0157375_100600682 88
367 3300013308 Ga0157375_10216451 Ga0157375_102164512 88
368 3300013308 Ga0157375_10258090 Ga0157375_102580902 88
369 3300013308 Ga0157375_10286423 Ga0157375_102864234 88
370 3300014325 Ga0163163_10014443 Ga0163163_100144434 88
371 3300014325 Ga0163163_10074586 Ga0163163_100745862 88
372 3300014325 Ga0163163_10328718 Ga0163163_103287183 88
373 3300014497 Ga0182008_10162231 Ga0182008_101622312 88
374 3300014968 Ga0157379_10001583 Ga0157379_1000158318 88
375 3300014968 Ga0157379_10502426 Ga0157379_105024261 88
376 3300017792 Ga0163161_10003295 Ga0163161_100032954 88
377 3300017792 Ga0163161_10524637 Ga0163161_105246372 88
378 3300017792 Ga0163161_10687361 Ga0163161_106873612 88
379 3300020081 Ga0206354_11449613 Ga0206354_114496131 88
380 3300020082 Ga0206353_10096358 Ga0206353_100963582 88
381 3300025315 Ga0207697_10163476 Ga0207697_101634761 88
382 3300025315 Ga0207697_10202809 Ga0207697_102028092 88
383 3300025315 Ga0207697_10396360 Ga0207697_103963601 88
384 3300025321 Ga0207656_10051512 Ga0207656_100515122 88
385 3300025321 Ga0207656_10054119 Ga0207656_100541192 88
386 3300025321 Ga0207656_10065642 Ga0207656_100656423 88
387 3300025321 Ga0207656_10212696 Ga0207656_102126962 88
388 3300025901 Ga0207688_10007813 Ga0207688_100078138 88
389 3300025901 Ga0207688_10158879 Ga0207688_101588792 88
390 3300025901 Ga0207688_10624526 Ga0207688_106245262 88
391 3300025903 Ga0207680_10035471 Ga0207680_100354712 88
392 3300025903 Ga0207680_10038224 Ga0207680_100382243 88
393 3300025903 Ga0207680_10327492 Ga0207680_103274922 88
394 3300025904 Ga0207647_10016084 Ga0207647_100160843 88
395 3300025904 Ga0207647_10360989 Ga0207647_103609892 88
396 3300025904 Ga0207647_10603305 Ga0207647_106033052 88
397 3300025904 Ga0207647_10816434 Ga0207647_108164341 88
398 3300025905 Ga0207685_10736048 Ga0207685_107360482 88
399 3300025907 Ga0207645_10001636 Ga0207645_1000163615 88
400 3300025907 Ga0207645_10005404 Ga0207645_100054047 88
401 3300025907 Ga0207645_10932327 Ga0207645_109323272 88
402 3300025908 Ga0207643_10054640 Ga0207643_100546403 88
403 3300025909 Ga0207705_10000270 Ga0207705_1000027039 88
404 3300025909 Ga0207705_10072190 Ga0207705_100721902 88
405 3300025909 Ga0207705_10369909 Ga0207705_103699092 88
406 3300025909 Ga0207705_10528072 Ga0207705_105280722 88
407 3300025909 Ga0207705_10708748 Ga0207705_107087482 88
408 3300025909 Ga0207705_10862427 Ga0207705_108624272 88
409 3300025911 Ga0207654_10335828 Ga0207654_103358282 88
410 3300025912 Ga0207707_10015148 Ga0207707_100151482 88
411 3300025912 Ga0207707_10049824 Ga0207707_100498242 88
412 3300025914 Ga0207671_10020935 Ga0207671_100209352 88
413 3300025914 Ga0207671_10076405 Ga0207671_100764053 88
414 3300025917 Ga0207660_10002965 Ga0207660_1000296512 88
415 3300025917 Ga0207660_10005305 Ga0207660_100053052 88
416 3300025917 Ga0207660_10096380 Ga0207660_100963803 88
417 3300025917 Ga0207660_10721510 Ga0207660_107215102 88
418 3300025919 Ga0207657_10001091 Ga0207657_1000109113 88
419 3300025919 Ga0207657_10003456 Ga0207657_1000345610 88
420 3300025919 Ga0207657_10005074 Ga0207657_100050742 88
421 3300025919 Ga0207657_10012494 Ga0207657_100124947 88
422 3300025919 Ga0207657_10020199 Ga0207657_100201992 88
423 3300025919 Ga0207657_10024128 Ga0207657_100241286 88
424 3300025919 Ga0207657_10054575 Ga0207657_100545752 88
425 3300025919 Ga0207657_10162912 Ga0207657_101629121 88
426 3300025920 Ga0207649_10056199 Ga0207649_100561991 88
427 3300025920 Ga0207649_10082203 Ga0207649_100822032 88
428 3300025920 Ga0207649_10085096 Ga0207649_100850962 88
429 3300025920 Ga0207649_10144769 Ga0207649_101447692 88
430 3300025920 Ga0207649_10147832 Ga0207649_101478322 88
431 3300025920 Ga0207649_10248910 Ga0207649_102489102 88
432 3300025920 Ga0207649_10464386 Ga0207649_104643862 88
433 3300025920 Ga0207649_10486017 Ga0207649_104860172 88
434 3300025921 Ga0207652_10000058 Ga0207652_1000005879 88
435 3300025923 Ga0207681_10048589 Ga0207681_100485893 88
436 3300025923 Ga0207681_10173070 Ga0207681_101730702 88
437 3300025924 Ga0207694_10041515 Ga0207694_100415152 88
438 3300025925 Ga0207650_10008323 Ga0207650_100083238 88
439 3300025925 Ga0207650_10021388 Ga0207650_100213883 88
440 3300025925 Ga0207650_10069382 Ga0207650_100693822 88
441 3300025925 Ga0207650_10168879 Ga0207650_101688792 88
442 3300025925 Ga0207650_10403309 Ga0207650_104033092 88
443 3300025925 Ga0207650_10650052 Ga0207650_106500522 88
444 3300025925 Ga0207650_11121088 Ga0207650_111210882 88
445 3300025925 Ga0207650_11620018 Ga0207650_116200181 88
446 3300025926 Ga0207659_10007014 Ga0207659_100070149 88
447 3300025926 Ga0207659_10187861 Ga0207659_101878612 88
448 3300025926 Ga0207659_10393399 Ga0207659_103933992 88
449 3300025926 Ga0207659_10621381 Ga0207659_106213812 88
450 3300025928 Ga0207700_10644479 Ga0207700_106444792 88
451 3300025931 Ga0207644_10043535 Ga0207644_100435352 88
452 3300025931 Ga0207644_10069764 Ga0207644_100697643 88
453 3300025931 Ga0207644_10081793 Ga0207644_100817933 88
454 3300025931 Ga0207644_10099178 Ga0207644_100991782 88
455 3300025931 Ga0207644_10155359 Ga0207644_101553591 88
456 3300025931 Ga0207644_10336485 Ga0207644_103364852 88
457 3300025932 Ga0207690_10016622 Ga0207690_100166224 88
458 3300025932 Ga0207690_10488920 Ga0207690_104889202 88
459 3300025932 Ga0207690_10501046 Ga0207690_105010463 88
460 3300025932 Ga0207690_10698425 Ga0207690_106984252 88
461 3300025933 Ga0207706_10004209 Ga0207706_100042094 88
462 3300025933 Ga0207706_10004893 Ga0207706_1000489312 88
463 3300025933 Ga0207706_10109683 Ga0207706_101096832 88
464 3300025933 Ga0207706_10132115 Ga0207706_101321152 88
465 3300025933 Ga0207706_10348575 Ga0207706_103485752 88
466 3300025933 Ga0207706_11484006 Ga0207706_114840061 88
467 3300025937 Ga0207669_10004891 Ga0207669_100048912 88
468 3300025937 Ga0207669_10119669 Ga0207669_101196692 88
469 3300025937 Ga0207669_10240714 Ga0207669_102407142 88
470 3300025938 Ga0207704_10459181 Ga0207704_104591813 88
471 3300025938 Ga0207704_10805168 Ga0207704_108051682 88
472 3300025938 Ga0207704_11040238 Ga0207704_110402381 88
473 3300025940 Ga0207691_10010453 Ga0207691_100104536 88
474 3300025940 Ga0207691_10028885 Ga0207691_100288854 88
475 3300025940 Ga0207691_10054138 Ga0207691_100541384 88
476 3300025940 Ga0207691_10113632 Ga0207691_101136323 88
477 3300025940 Ga0207691_10845599 Ga0207691_108455992 88
478 3300025941 Ga0207711_10001131 Ga0207711_1000113114 88
479 3300025941 Ga0207711_10005984 Ga0207711_100059848 88
480 3300025941 Ga0207711_10018447 Ga0207711_100184474 88
481 3300025941 Ga0207711_10032438 Ga0207711_100324381 88
482 3300025941 Ga0207711_10440992 Ga0207711_104409922 88
483 3300025941 Ga0207711_10516009 Ga0207711_105160092 88
484 3300025942 Ga0207689_10017153 Ga0207689_100171532 88
485 3300025942 Ga0207689_10047270 Ga0207689_100472706 88
486 3300025942 Ga0207689_10299012 Ga0207689_102990123 88
487 3300025942 Ga0207689_10453176 Ga0207689_104531762 88
488 3300025944 Ga0207661_10002950 Ga0207661_100029509 88
489 3300025944 Ga0207661_10588457 Ga0207661_105884572 88
490 3300025945 Ga0207679_10024262 Ga0207679_100242627 88
491 3300025945 Ga0207679_10130236 Ga0207679_101302363 88
492 3300025945 Ga0207679_10205059 Ga0207679_102050592 88
493 3300025945 Ga0207679_10272052 Ga0207679_102720522 88
494 3300025945 Ga0207679_10343395 Ga0207679_103433952 88
495 3300025945 Ga0207679_10836822 Ga0207679_108368222 88
496 3300025949 Ga0207667_10006485 Ga0207667_1000648513 88
497 3300025949 Ga0207667_10254582 Ga0207667_102545823 88
498 3300025949 Ga0207667_11084303 Ga0207667_110843032 88
499 3300025960 Ga0207651_10002688 Ga0207651_100026889 88
500 3300025960 Ga0207651_10014420 Ga0207651_100144202 88
501 3300025960 Ga0207651_10238208 Ga0207651_102382082 88
502 3300025960 Ga0207651_10262071 Ga0207651_102620713 88
503 3300025961 Ga0207712_11266493 Ga0207712_112664932 88
504 3300025961 Ga0207712_11328481 Ga0207712_113284812 88
505 3300025972 Ga0207668_10000086 Ga0207668_1000008645 88
506 3300025972 Ga0207668_10178623 Ga0207668_101786232 88
507 3300025972 Ga0207668_10184657 Ga0207668_101846572 88
508 3300025972 Ga0207668_10186813 Ga0207668_101868133 88
509 3300025972 Ga0207668_11548574 Ga0207668_115485742 88
510 3300025972 Ga0207668_11654106 Ga0207668_116541061 88
511 3300025981 Ga0207640_10029285 Ga0207640_100292852 88
512 3300025981 Ga0207640_10280521 Ga0207640_102805212 88
513 3300025981 Ga0207640_10464213 Ga0207640_104642132 88
514 3300025981 Ga0207640_10665921 Ga0207640_106659212 88
515 3300025986 Ga0207658_10002031 Ga0207658_1000203118 88
516 3300025986 Ga0207658_10010473 Ga0207658_100104733 88
517 3300025986 Ga0207658_10043070 Ga0207658_100430705 88
518 3300025986 Ga0207658_10043350 Ga0207658_100433502 88
519 3300025986 Ga0207658_10046411 Ga0207658_100464114 88
520 3300025986 Ga0207658_10056646 Ga0207658_100566462 88
521 3300025986 Ga0207658_10068404 Ga0207658_100684043 88
522 3300025986 Ga0207658_10151755 Ga0207658_101517552 88
523 3300025986 Ga0207658_10363907 Ga0207658_103639072 88
524 3300025986 Ga0207658_10539332 Ga0207658_105393321 88
525 3300025986 Ga0207658_11254773 Ga0207658_112547731 88
526 3300026023 Ga0207677_10022762 Ga0207677_100227622 88
527 3300026023 Ga0207677_10307589 Ga0207677_103075892 88
528 3300026023 Ga0207677_12177142 Ga0207677_121771421 88
529 3300026035 Ga0207703_10005582 Ga0207703_100055826 88
530 3300026035 Ga0207703_10189486 Ga0207703_101894862 88
531 3300026035 Ga0207703_10196246 Ga0207703_101962462 88
532 3300026035 Ga0207703_10334072 Ga0207703_103340721 88
533 3300026035 Ga0207703_11085353 Ga0207703_110853532 88
534 3300026041 Ga0207639_10047762 Ga0207639_100477622 88
535 3300026041 Ga0207639_10085740 Ga0207639_100857402 88
536 3300026041 Ga0207639_10500143 Ga0207639_105001432 88
537 3300026041 Ga0207639_10543232 Ga0207639_105432322 88
538 3300026041 Ga0207639_11404915 Ga0207639_114049151 88
539 3300026067 Ga0207678_10000217 Ga0207678_1000021717 88
540 3300026067 Ga0207678_10010463 Ga0207678_100104636 88
541 3300026067 Ga0207678_10015277 Ga0207678_100152772 88
542 3300026067 Ga0207678_10699810 Ga0207678_106998102 88
543 3300026067 Ga0207678_11831290 Ga0207678_118312902 88
544 3300026078 Ga0207702_10013141 Ga0207702_100131417 88
545 3300026078 Ga0207702_10179768 Ga0207702_101797682 88
546 3300026078 Ga0207702_10851144 Ga0207702_108511442 88
547 3300026078 Ga0207702_12403337 Ga0207702_124033371 88
548 3300026078 Ga0207702_12468894 Ga0207702_124688942 88
549 3300026088 Ga0207641_10004163 Ga0207641_1000416313 88
550 3300026088 Ga0207641_10019848 Ga0207641_100198487 88
551 3300026088 Ga0207641_10101337 Ga0207641_101013372 88
552 3300026088 Ga0207641_10115512 Ga0207641_101155122 88
553 3300026088 Ga0207641_10232815 Ga0207641_102328153 88
554 3300026088 Ga0207641_10778988 Ga0207641_107789882 88
555 3300026089 Ga0207648_10001535 Ga0207648_1000153514 88
556 3300026089 Ga0207648_10053565 Ga0207648_100535656 88
557 3300026095 Ga0207676_10013696 Ga0207676_100136966 88
558 3300026095 Ga0207676_10031084 Ga0207676_100310843 88
559 3300026095 Ga0207676_10353231 Ga0207676_103532312 88
560 3300026095 Ga0207676_10513954 Ga0207676_105139542 88
561 3300026095 Ga0207676_12150258 Ga0207676_121502582 88
562 3300026116 Ga0207674_10003022 Ga0207674_1000302211 88
563 3300026116 Ga0207674_10024700 Ga0207674_100247008 88
564 3300026116 Ga0207674_10065955 Ga0207674_100659553 88
565 3300026118 Ga0207675_100460281 Ga0207675_1004602812 88
566 3300026118 Ga0207675_102163680 Ga0207675_1021636802 88
567 3300026121 Ga0207683_10000541 Ga0207683_1000054110 88
568 3300026121 Ga0207683_10005768 Ga0207683_100057683 88
569 3300026121 Ga0207683_10015641 Ga0207683_100156413 88
570 3300026121 Ga0207683_10411449 Ga0207683_104114491 88
571 3300026121 Ga0207683_11325955 Ga0207683_113259551 88
572 3300026142 Ga0207698_10001554 Ga0207698_100015547 88
573 3300026142 Ga0207698_10021943 Ga0207698_100219432 88
574 3300026142 Ga0207698_10083043 Ga0207698_100830432 88
575 3300026142 Ga0207698_10112284 Ga0207698_101122843 88
576 3300026142 Ga0207698_10118693 Ga0207698_101186932 88
577 3300026142 Ga0207698_11053246 Ga0207698_110532462 88
578 3300026142 Ga0207698_11388778 Ga0207698_113887782 88
579 3300028379 Ga0268266_10034827 Ga0268266_100348276 88
580 3300028379 Ga0268266_10122325 Ga0268266_101223252 88
581 3300028379 Ga0268266_10731300 Ga0268266_107313002 88
582 3300028380 Ga0268265_10002511 Ga0268265_100025115 88
583 3300028380 Ga0268265_10358783 Ga0268265_103587831 88
584 3300028380 Ga0268265_12558909 Ga0268265_125589092 88
585 3300028381 Ga0268264_10005393 Ga0268264_1000539313 88
586 3300028381 Ga0268264_10053137 Ga0268264_100531372 88
587 3300028381 Ga0268264_10395671 Ga0268264_103956712 88
588 3300028381 Ga0268264_11037825 Ga0268264_110378252 88
589 3300028381 Ga0268264_11714972 Ga0268264_117149722 88
590 3300028381 Ga0268264_12197274 Ga0268264_121972742 88
591 3300031852 Ga0307410_11090771 Ga0307410_110907712 88
592 3300031852 Ga0307410_11829180 Ga0307410_118291802 88
593 3300031995 Ga0307409_102458471 Ga0307409_1024584712 88
594 3300032002 Ga0307416_101589439 Ga0307416_1015894391 88
595 3300032126 Ga0307415_100029692 Ga0307415_1000296922 88
596 3300032126 Ga0307415_101212581 Ga0307415_1012125812 88
597 3300034820 Ga0373959_0178094 Ga0373959_0178094_133_402 88
598 3300035089 Ga0373944_0121702 Ga0373944_0121702_615_884 88
599 3300035115 Ga0373941_0119906 Ga0373941_0119906_334_603 88
600 3300035170 Ga0373943_0037065 Ga0373943_0037065_959_1228 88
601 3300035692 Ga0373935_0112406 Ga0373935_0112406_235_504 88
602 3300035695 Ga0373927_0096638 Ga0373927_0096638_840_1109 88
603 3300035725 Ga0373947_0028056 Ga0373947_0028056_91_360 88
604 3300036401 Ga0373937_2084717 Ga0373937_2084717_217_486 88
605 3300037068 Ga0373925_0020969 Ga0373925_0020969_1118_1387 88
606 3300037312 Ga0395899_0000270 Ga0395899_0000270_54107_54373 88
607 3300037312 Ga0395899_0000998 Ga0395899_0000998_15821_16087 88
608 3300037312 Ga0395899_0003175 Ga0395899_0003175_8426_8692 88
609 3300037312 Ga0395899_0243334 Ga0395899_0243334_295_561 88
610 3300037312 Ga0395899_0251923 Ga0395899_0251923_417_686 88
611 3300037312 Ga0395899_0540977 Ga0395899_0540977_139_405 88
612 3300037418 Ga0395900_0000290 Ga0395900_0000290_49493_49759 88
613 3300037418 Ga0395900_0004722 Ga0395900_0004722_4996_5262 88
614 3300037418 Ga0395900_0034834 Ga0395900_0034834_604_870 88
615 3300037418 Ga0395900_0035230 Ga0395900_0035230_3931_4200 88
616 3300037418 Ga0395900_0051408 Ga0395900_0051408_732_998 88
617 3300037418 Ga0395900_0107032 Ga0395900_0107032_1836_2102 88
618 3300037418 Ga0395900_0173238 Ga0395900_0173238_1830_2096 88
619 3300037418 Ga0395900_0384182 Ga0395900_0384182_959_1228 88
620 3300037418 Ga0395900_0560890 Ga0395900_0560890_711_980 88
621 3300037418 Ga0395900_0609434 Ga0395900_0609434_395_664 88
622 3300037418 Ga0395900_1937173 Ga0395900_1937173_179_448 88
623 3300037466 Ga0395898_0000054 Ga0395898_0000054_225057_225323 88
624 3300037466 Ga0395898_0002537 Ga0395898_0002537_5409_5675 88
625 3300037466 Ga0395898_0006151 Ga0395898_0006151_622_888 88
626 3300037466 Ga0395898_0088531 Ga0395898_0088531_784_1050 88
627 3300037466 Ga0395898_0552001 Ga0395898_0552001_524_793 88
628 3300037466 Ga0395898_1037030 Ga0395898_1037030_125_394 88
629 3300037466 Ga0395898_1053918 Ga0395898_1053918_326_592 88
630 3300037466 Ga0395898_1125464 Ga0395898_1125464_235_501 88
631 3300037471 Ga0395905_0000046 Ga0395905_0000046_186063_186329 88
632 3300037471 Ga0395905_0001943 Ga0395905_0001943_22576_22842 88
633 3300037471 Ga0395905_0004285 Ga0395905_0004285_5499_5765 88
634 3300037471 Ga0395905_0022116 Ga0395905_0022116_2713_2979 88
635 3300037471 Ga0395905_0028526 Ga0395905_0028526_798_1064 88
636 3300037471 Ga0395905_0035890 Ga0395905_0035890_75_344 88
637 3300037471 Ga0395905_0061629 Ga0395905_0061629_835_1104 88
638 3300037471 Ga0395905_0145811 Ga0395905_0145811_1438_1704 88
639 3300037471 Ga0395905_0179531 Ga0395905_0179531_1341_1610 88
640 3300037471 Ga0395905_0205413 Ga0395905_0205413_355_621 88
641 3300037471 Ga0395905_0279940 Ga0395905_0279940_173_442 88
642 3300037471 Ga0395905_0298788 Ga0395905_0298788_224_496 88
643 3300037471 Ga0395905_0405413 Ga0395905_0405413_569_835 88
644 3300037471 Ga0395905_0530940 Ga0395905_0530940_721_993 88
645 3300037471 Ga0395905_0622285 Ga0395905_0622285_523_792 88
646 3300037471 Ga0395905_0753200 Ga0395905_0753200_30_302 88
647 3300037471 Ga0395905_1627037 Ga0395905_1627037_126_401 88
648 3300038443 Ga0395901_0000102 Ga0395901_0000102_37788_38054 88
649 3300038443 Ga0395901_0003921 Ga0395901_0003921_11298_11564 88
650 3300038443 Ga0395901_0004019 Ga0395901_0004019_5499_5765 88
651 3300038443 Ga0395901_0008199 Ga0395901_0008199_5525_5791 88
652 3300038443 Ga0395901_0110381 Ga0395901_0110381_2565_2831 88
653 3300038443 Ga0395901_0115681 Ga0395901_0115681_968_1234 88
654 3300038443 Ga0395901_0410998 Ga0395901_0410998_183_452 88
655 3300038443 Ga0395901_1013823 Ga0395901_1013823_135_404 88
656 3300038443 Ga0395901_2079359 Ga0395901_2079359_159_425 88
657 3300042157 Ga0439458_0000409 Ga0439458_0000409_6294_6560 88
658 3300044656 Ga0466969_0461202 Ga0466969_0461202_252_521 88
659 3300044658 Ga0466972_0227153 Ga0466972_0227153_512_778 88
660 3300044683 Ga0466965_0045498 Ga0466965_0045498_867_1136 88
661 3300044683 Ga0466965_0047113 Ga0466965_0047113_234_503 88
662 3300044684 Ga0466966_0039692 Ga0466966_0039692_1541_1810 88
663 3300044684 Ga0466966_0088750 Ga0466966_0088750_1138_1407 88
664 3300044684 Ga0466966_0840913 Ga0466966_0840913_82_351 88
665 3300044693 Ga0466961_0011100 Ga0466961_0011100_3233_3502 88
666 3300044693 Ga0466961_0021179 Ga0466961_0021179_2254_2523 88
667 3300044694 Ga0466963_0001468 Ga0466963_0001468_1282_1551 88
668 3300044694 Ga0466963_0002992 Ga0466963_0002992_5754_6023 88
669 3300044694 Ga0466963_0419079 Ga0466963_0419079_660_929 88
670 3300044694 Ga0466963_0720165 Ga0466963_0720165_353_622 88
671 3300044706 Ga0466964_0017249 Ga0466964_0017249_2052_2321 88
672 3300044706 Ga0466964_0099252 Ga0466964_0099252_51_320 88
673 3300044765 Ga0466970_0946215 Ga0466970_0946215_216_482 88
674 3300044842 Ga0466957_0000630 Ga0466957_0000630_3972_4241 88
675 3300044842 Ga0466957_0038452 Ga0466957_0038452_981_1250 88
676 3300044842 Ga0466957_1404196 Ga0466957_1404196_168_437 88
677 3300044901 Ga0466960_0017037 Ga0466960_0017037_356_625 88
678 3300044901 Ga0466960_0409869 Ga0466960_0409869_344_610 88
679 3300045049 Ga0466959_0258420 Ga0466959_0258420_448_717 88
680 3300045049 Ga0466959_0324220 Ga0466959_0324220_88_354 88
681 3300045049 Ga0466959_0804483 Ga0466959_0804483_42_311 88
682 3300045836 Ga0466958_0089392 Ga0466958_0089392_1554_1823 88
683 3300045836 Ga0466958_0113732 Ga0466958_0113732_107_376 88
684 3300045976 Ga0466967_0012674 Ga0466967_0012674_2909_3178 88
685 3300045976 Ga0466967_0020351 Ga0466967_0020351_598_867 88
686 3300045976 Ga0466967_0043629 Ga0466967_0043629_1839_2108 88
687 3300045976 Ga0466967_0064589 Ga0466967_0064589_2901_3170 88
688 3300045976 Ga0466967_0603687 Ga0466967_0603687_151_420 88
689 3300045976 Ga0466967_2133310 Ga0466967_2133310_220_489 88
690 3300046459 Ga0495629_0331764 Ga0495629_0331764_709_975 88
691 3300046537 Ga0495598_0000426 Ga0495598_0000426_5026_5295 88
692 3300046539 Ga0495621_0002280 Ga0495621_0002280_2630_2899 88
693 3300046539 Ga0495621_0206481 Ga0495621_0206481_336_611 88
694 3300046558 Ga0495633_0212495 Ga0495633_0212495_329_598 88
695 3300046684 Ga0495669_0007270 Ga0495669_0007270_2489_2758 88
696 3300046684 Ga0495669_0102942 Ga0495669_0102942_942_1211 88
697 3300046684 Ga0495669_0212838 Ga0495669_0212838_366_635 88
698 3300046684 Ga0495669_0358612 Ga0495669_0358612_386_655 88
699 3300046691 Ga0495670_0000148 Ga0495670_0000148_17980_18249 88
700 3300047320 Ga0495672_0218644 Ga0495672_0218644_626_895 88
701 3300048903 Ga0496100_0060100 Ga0496100_0060100_1229_1495 88
702 3300048904 Ga0496101_0100868 Ga0496101_0100868_1769_2035 88
703 3300048904 Ga0496101_0195000 Ga0496101_0195000_207_482 88
704 3300048904 Ga0496101_0222960 Ga0496101_0222960_17_283 88
705 3300048904 Ga0496101_0254049 Ga0496101_0254049_837_1109 88
706 3300048904 Ga0496101_0393672 Ga0496101_0393672_690_959 88
707 3300048904 Ga0496101_0701220 Ga0496101_0701220_381_650 88
708 3300048904 Ga0496101_0735712 Ga0496101_0735712_411_677 88
709 3300048905 Ga0496102_0012425 Ga0496102_0012425_1616_1888 88
710 3300048905 Ga0496102_0281089 Ga0496102_0281089_432_698 88
711 3300048906 Ga0496103_0011174 Ga0496103_0011174_2314_2586 88
712 3300048906 Ga0496103_0407747 Ga0496103_0407747_194_460 88
713 3300048906 Ga0496103_0476165 Ga0496103_0476165_149_415 88
714 3300048908 Ga0496105_0191850 Ga0496105_0191850_771_1037 88
715 3300048909 Ga0496106_0066341 Ga0496106_0066341_851_1117 88
716 3300048910 Ga0496107_0010960 Ga0496107_0010960_2573_2845 88
717 3300048910 Ga0496107_0036939 Ga0496107_0036939_2189_2464 88
718 3300048910 Ga0496107_0127630 Ga0496107_0127630_273_539 88
719 3300048910 Ga0496107_0159382 Ga0496107_0159382_1063_1329 88
720 3300048910 Ga0496107_0163870 Ga0496107_0163870_1331_1600 88
721 3300048910 Ga0496107_0340279 Ga0496107_0340279_55_324 88
722 3300048910 Ga0496107_0384545 Ga0496107_0384545_89_358 88
723 3300048910 Ga0496107_0670894 Ga0496107_0670894_167_436 88
724 3300048910 Ga0496107_1282638 Ga0496107_1282638_96_362 88
725 3300048911 Ga0496108_0005054 Ga0496108_0005054_1302_1568 88
726 3300048911 Ga0496108_0410677 Ga0496108_0410677_54_326 88
727 3300048911 Ga0496108_1134728 Ga0496108_1134728_264_533 88
728 3300048912 Ga0496109_0004047 Ga0496109_0004047_11861_12133 88
729 3300048912 Ga0496109_0022851 Ga0496109_0022851_745_1011 88
730 3300048912 Ga0496109_0254243 Ga0496109_0254243_398_673 88
731 3300048912 Ga0496109_0547314 Ga0496109_0547314_459_728 88
732 3300048912 Ga0496109_1908533 Ga0496109_1908533_63_329 88
733 3300048912 Ga0496109_1971139 Ga0496109_1971139_89_358 88
734 3300048913 Ga0496110_0001649 Ga0496110_0001649_6984_7250 88
735 3300048913 Ga0496110_0006018 Ga0496110_0006018_1898_2170 88
736 3300048913 Ga0496110_0030168 Ga0496110_0030168_1519_1794 88
737 3300048914 Ga0496111_0009769 Ga0496111_0009769_1458_1724 88
738 3300048914 Ga0496111_0044116 Ga0496111_0044116_969_1244 88
739 3300048915 Ga0496112_0035398 Ga0496112_0035398_3190_3462 88
740 3300048915 Ga0496112_0136820 Ga0496112_0136820_926_1192 88
741 3300048915 Ga0496112_0198989 Ga0496112_0198989_913_1179 88
742 3300048916 Ga0496113_0002738 Ga0496113_0002738_6370_6636 88
743 3300048916 Ga0496113_0018235 Ga0496113_0018235_736_1002 88
744 3300048916 Ga0496113_0022120 Ga0496113_0022120_2857_3129 88
745 3300048917 Ga0496114_0004676 Ga0496114_0004676_2584_2859 88
746 3300048917 Ga0496114_0025026 Ga0496114_0025026_3459_3725 88
747 3300048918 Ga0496115_0156435 Ga0496115_0156435_954_1220 88
748 3300049571 Ga0501034_0848369 Ga0501034_0848369_380_649 88
749 3300049584 Ga0501068_0692632 Ga0501068_0692632_185_454 88
750 3300049585 Ga0501069_0448426 Ga0501069_0448426_158_427 88
751 3300049589 Ga0501073_0627850 Ga0501073_0627850_110_379 88
752 3300049590 Ga0501074_0079494 Ga0501074_0079494_588_857 88
753 3300049742 Ga0501080_0101660 Ga0501080_0101660_1130_1399 88
754 3300049822 Ga0501035_1471447 Ga0501035_1471447_207_476 88
755 3300050490 nmdc:mga03n38_792830_c1 nmdc:mga03n38_792830_c1_129_398 88
756 3300050491 nmdc:mga00v17_946026_c1 nmdc:mga00v17_946026_c1_159_428 88
757 3300050492 nmdc:mga0yw44_1045453_c1 nmdc:mga0yw44_1045453_c1_143_412 88
758 3300050511 nmdc:mga08y16_1856858_c1 nmdc:mga08y16_1856858_c1_33_308 88
759 3300061719 Ga0466962_0220849 Ga0466962_0220849_399_668 88
760 3300061719 Ga0466962_0413344 Ga0466962_0413344_235_504 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04023

FeoA

FeoA domain

10

77

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k5i-assembly1.cif.gz_A solution structure of iron(ii) transport protein a from clostridium thermocellum , northeast structural genomics consortium (nesg) target vr131 0.9159 10 87
2k5f-assembly1.cif.gz_A solution nmr structure of feoa protein from chlorobium tepidum. northeast structural genomics consortium target ctr121 0.9048 10 88
3e19-assembly1.cif.gz_D crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group 0.8976 9 87
4o5v-assembly1.cif.gz_A crystal structure of t. acidophilum ider 0.894 9 87
5zr4-assembly1.cif.gz_B manganese-dependent transcriptional repressor 0.8932 9 87
ID Description Score Start End Superfamily
2k5iA01 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.9159 10 87 2.30.30.90
2k5fA01 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.9048 10 88 2.30.30.90
af_Q57987_2_81_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8896 10 86 2.30.30.90
af_Q2G2L0_142_214_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8752 10 85 2.30.30.90
2k5lA00 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8571 10 88 2.30.30.90
ID Description Score Start End GO Terms
AF-A0A418Q3T6-F1-model_v4 Ferrous iron transport protein A 1.003 9 88 GO:0046914
AF-A0A516IRR1-F1-model_v4 Ferrous iron transport protein A 0.9974 9 88 GO:0046914
AF-A0A1X7G5W0-F1-model_v4 Ferrous iron transport protein A 0.9855 10 87 GO:0046914
AF-A0A6G7ZKR3-F1-model_v4 Ferrous iron transport protein A 0.9844 1 88 GO:0046914
AF-A0A842HV07-F1-model_v4 Ferrous iron transport protein A 0.9832 9 88 GO:0046914

Feature Viewer

pLDDT pTM Quality
90.34 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map