F479542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 268 | 1520 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0084462|Ga0395899_0084462_352_585 |
| Length | 77 |
| Sequence | MMDCDHCEKVLQPYLDRVLSEEERLEAELHLTECSWCAKRYRFEANLRQIVKTSVAYEMPPHFVEKLSALRPGTPLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 61 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 62 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 63 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 78 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.68 |
| Metatranscriptomes | 6.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.24 |
| Rhizosphere | 91.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0084462 | 3300037312 | Bacteria | 2308 |
| 2 | Ga0058863_10083633 | 3300004799 | Bacteria | 929 |
| 3 | Ga0058862_10021270 | 3300004803 | Unclassified | 1376 |
| 4 | Ga0070658_10020999 | 3300005327 | Bacteria | 5230 |
| 5 | Ga0070658_10059417 | 3300005327 | Unclassified | 3113 |
| 6 | Ga0070658_10231389 | 3300005327 | Bacteria | 1565 |
| 7 | Ga0070658_10674831 | 3300005327 | Bacteria | 897 |
| 8 | Ga0070658_10953912 | 3300005327 | Bacteria | 746 |
| 9 | Ga0070683_100010433 | 3300005329 | Bacteria | 7990 |
| 10 | Ga0070683_100079772 | 3300005329 | Bacteria | 3063 |
| 11 | Ga0070683_100810561 | 3300005329 | Bacteria | 897 |
| 12 | Ga0070680_100000833 | 3300005336 | Bacteria | 21795 |
| 13 | Ga0070680_100040065 | 3300005336 | Bacteria | 3791 |
| 14 | Ga0070680_100057288 | 3300005336 | Bacteria | 3186 |
| 15 | Ga0070680_100126361 | 3300005336 | Unclassified | 2136 |
| 16 | Ga0070680_100341399 | 3300005336 | Bacteria | 1273 |
| 17 | Ga0070680_101644318 | 3300005336 | Bacteria | 556 |
| 18 | Ga0070682_100834671 | 3300005337 | Bacteria | 752 |
| 19 | Ga0070682_101152528 | 3300005337 | Bacteria | 652 |
| 20 | Ga0070682_101167187 | 3300005337 | Unclassified | 648 |
| 21 | Ga0070660_100002148 | 3300005339 | Bacteria | 13604 |
| 22 | Ga0070660_100013910 | 3300005339 | Bacteria | 5788 |
| 23 | Ga0070660_100015853 | 3300005339 | Bacteria | 5455 |
| 24 | Ga0070660_100057714 | 3300005339 | Unclassified | 3008 |
| 25 | Ga0070660_100320209 | 3300005339 | Unclassified | 1274 |
| 26 | Ga0070660_100386608 | 3300005339 | Bacteria | 1155 |
| 27 | Ga0070660_100395174 | 3300005339 | Unclassified | 1143 |
| 28 | Ga0070660_100556798 | 3300005339 | Bacteria | 957 |
| 29 | Ga0070661_100029052 | 3300005344 | Bacteria | 3989 |
| 30 | Ga0070661_100081157 | 3300005344 | Bacteria | 2394 |
| 31 | Ga0070661_100249055 | 3300005344 | Bacteria | 1370 |
| 32 | Ga0070661_101387550 | 3300005344 | Unclassified | 591 |
| 33 | Ga0070668_101565612 | 3300005347 | Bacteria | 603 |
| 34 | Ga0070671_100023681 | 3300005355 | Bacteria | 5027 |
| 35 | Ga0070671_100083957 | 3300005355 | Bacteria | 2664 |
| 36 | Ga0070659_100023903 | 3300005366 | Bacteria | 4681 |
| 37 | Ga0070659_100514255 | 3300005366 | Bacteria | 1022 |
| 38 | Ga0070659_100539527 | 3300005366 | Bacteria | 998 |
| 39 | Ga0070659_100885503 | 3300005366 | Unclassified | 780 |
| 40 | Ga0070667_100059094 | 3300005367 | Unclassified | 3243 |
| 41 | Ga0070709_10128941 | 3300005434 | Bacteria | 1724 |
| 42 | Ga0070709_10657890 | 3300005434 | Bacteria | 812 |
| 43 | Ga0070709_11394692 | 3300005434 | Unclassified | 567 |
| 44 | Ga0070714_100241408 | 3300005435 | Bacteria | 1668 |
| 45 | Ga0070714_100244115 | 3300005435 | Bacteria | 1658 |
| 46 | Ga0070714_100277554 | 3300005435 | Bacteria | 1556 |
| 47 | Ga0070714_100335873 | 3300005435 | Bacteria | 1416 |
| 48 | Ga0070714_100397566 | 3300005435 | Bacteria | 1302 |
| 49 | Ga0070714_100552532 | 3300005435 | Bacteria | 1102 |
| 50 | Ga0070714_101170466 | 3300005435 | Bacteria | 750 |
| 51 | Ga0070714_101703390 | 3300005435 | Unclassified | 616 |
| 52 | Ga0070713_100522356 | 3300005436 | Bacteria | 1122 |
| 53 | Ga0070713_101295684 | 3300005436 | Bacteria | 706 |
| 54 | Ga0070713_101819963 | 3300005436 | Bacteria | 591 |
| 55 | Ga0070710_10559794 | 3300005437 | Bacteria | 791 |
| 56 | Ga0070710_11004512 | 3300005437 | Bacteria | 608 |
| 57 | Ga0070710_11259369 | 3300005437 | Unclassified | 549 |
| 58 | Ga0070711_100159468 | 3300005439 | Bacteria | 1709 |
| 59 | Ga0070711_100377334 | 3300005439 | Bacteria | 1146 |
| 60 | Ga0070711_101422838 | 3300005439 | Bacteria | 604 |
| 61 | Ga0070705_101752906 | 3300005440 | Bacteria | 526 |
| 62 | Ga0070708_100100145 | 3300005445 | Bacteria | 2652 |
| 63 | Ga0070708_100954035 | 3300005445 | Bacteria | 805 |
| 64 | Ga0070663_100289570 | 3300005455 | Unclassified | 1308 |
| 65 | Ga0070663_100608598 | 3300005455 | Unclassified | 920 |
| 66 | Ga0070678_100213302 | 3300005456 | Bacteria | 1601 |
| 67 | Ga0070678_100304861 | 3300005456 | Bacteria | 1355 |
| 68 | Ga0070681_10004219 | 3300005458 | Bacteria | 13620 |
| 69 | Ga0070681_10008361 | 3300005458 | Bacteria | 10137 |
| 70 | Ga0070681_10010829 | 3300005458 | Bacteria | 9011 |
| 71 | Ga0070681_10024951 | 3300005458 | Bacteria | 6015 |
| 72 | Ga0070681_10026250 | 3300005458 | Bacteria | 5855 |
| 73 | Ga0070681_10120338 | 3300005458 | Bacteria | 2561 |
| 74 | Ga0070681_10167514 | 3300005458 | Bacteria | 2119 |
| 75 | Ga0070681_10205092 | 3300005458 | Bacteria | 1889 |
| 76 | Ga0070681_10348761 | 3300005458 | Bacteria | 1390 |
| 77 | Ga0070706_101102019 | 3300005467 | Unclassified | 731 |
| 78 | Ga0070707_100580004 | 3300005468 | Unclassified | 1084 |
| 79 | Ga0070707_101833300 | 3300005468 | Bacteria | 574 |
| 80 | Ga0070679_100006261 | 3300005530 | Bacteria | 11081 |
| 81 | Ga0070679_100030239 | 3300005530 | Bacteria | 5346 |
| 82 | Ga0070679_100039019 | 3300005530 | Bacteria | 4721 |
| 83 | Ga0070679_100190800 | 3300005530 | Bacteria | 2018 |
| 84 | Ga0070679_100445433 | 3300005530 | Bacteria | 1240 |
| 85 | Ga0070679_100494959 | 3300005530 | Bacteria | 1166 |
| 86 | Ga0070679_100841539 | 3300005530 | Bacteria | 861 |
| 87 | Ga0070679_102212487 | 3300005530 | Bacteria | 500 |
| 88 | Ga0070684_100114310 | 3300005535 | Bacteria | 2423 |
| 89 | Ga0070684_100217539 | 3300005535 | Unclassified | 1742 |
| 90 | Ga0070684_100218943 | 3300005535 | Bacteria | 1737 |
| 91 | Ga0070684_100233370 | 3300005535 | Bacteria | 1680 |
| 92 | Ga0070684_100723515 | 3300005535 | Unclassified | 928 |
| 93 | Ga0070684_100944561 | 3300005535 | Bacteria | 808 |
| 94 | Ga0068853_100386015 | 3300005539 | Unclassified | 1308 |
| 95 | Ga0068853_100941319 | 3300005539 | Bacteria | 830 |
| 96 | Ga0068853_101118958 | 3300005539 | Bacteria | 760 |
| 97 | Ga0068853_101522794 | 3300005539 | Bacteria | 648 |
| 98 | Ga0068853_101672647 | 3300005539 | Bacteria | 617 |
| 99 | Ga0070686_100547271 | 3300005544 | Bacteria | 905 |
| 100 | Ga0070696_101822211 | 3300005546 | Unclassified | 526 |
| 101 | Ga0070693_100309137 | 3300005547 | Bacteria | 1068 |
| 102 | Ga0070665_100087389 | 3300005548 | Bacteria | 3123 |
| 103 | Ga0068855_100059100 | 3300005563 | Bacteria | 4487 |
| 104 | Ga0068855_100087841 | 3300005563 | Unclassified | 3592 |
| 105 | Ga0068855_100118791 | 3300005563 | Unclassified | 3028 |
| 106 | Ga0068855_100231315 | 3300005563 | Bacteria | 2070 |
| 107 | Ga0068855_100568347 | 3300005563 | Bacteria | 1226 |
| 108 | Ga0068855_100655669 | 3300005563 | Unclassified | 1127 |
| 109 | Ga0068855_101026155 | 3300005563 | Unclassified | 865 |
| 110 | Ga0068855_102068959 | 3300005563 | Unclassified | 574 |
| 111 | Ga0070664_100663109 | 3300005564 | Bacteria | 970 |
| 112 | Ga0068857_100011065 | 3300005577 | Bacteria | 7852 |
| 113 | Ga0068857_100056219 | 3300005577 | Bacteria | 3493 |
| 114 | Ga0068857_100277923 | 3300005577 | Bacteria | 1540 |
| 115 | Ga0068857_100295501 | 3300005577 | Bacteria | 1492 |
| 116 | Ga0068854_100518775 | 3300005578 | Bacteria | 1006 |
| 117 | Ga0068854_100590595 | 3300005578 | Bacteria | 947 |
| 118 | Ga0068854_101127868 | 3300005578 | Unclassified | 700 |
| 119 | Ga0068856_100010475 | 3300005614 | Bacteria | 9001 |
| 120 | Ga0068856_100072255 | 3300005614 | Bacteria | 3416 |
| 121 | Ga0068856_100555044 | 3300005614 | Bacteria | 1170 |
| 122 | Ga0068856_100666761 | 3300005614 | Bacteria | 1061 |
| 123 | Ga0068856_102007884 | 3300005614 | Bacteria | 589 |
| 124 | Ga0068852_100494264 | 3300005616 | Bacteria | 1217 |
| 125 | Ga0068852_101141215 | 3300005616 | Bacteria | 800 |
| 126 | Ga0081455_10051298 | 3300005937 | Bacteria | 3539 |
| 127 | Ga0070717_10584475 | 3300006028 | Bacteria | 1013 |
| 128 | Ga0070717_10649387 | 3300006028 | Bacteria | 958 |
| 129 | Ga0070717_10674667 | 3300006028 | Unclassified | 938 |
| 130 | Ga0070715_10065620 | 3300006163 | Bacteria | 1607 |
| 131 | Ga0070716_100580447 | 3300006173 | Bacteria | 840 |
| 132 | Ga0070716_101118759 | 3300006173 | Bacteria | 629 |
| 133 | Ga0070712_100003082 | 3300006175 | Bacteria | 10296 |
| 134 | Ga0070712_100574569 | 3300006175 | Bacteria | 952 |
| 135 | Ga0070712_101304732 | 3300006175 | Unclassified | 632 |
| 136 | Ga0097621_100936512 | 3300006237 | Bacteria | 808 |
| 137 | Ga0068871_100966462 | 3300006358 | Bacteria | 792 |
| 138 | Ga0068871_101225643 | 3300006358 | Bacteria | 704 |
| 139 | Ga0075433_10014776 | 3300006852 | Bacteria | 6390 |
| 140 | Ga0075434_100003308 | 3300006871 | Bacteria | 14404 |
| 141 | Ga0068865_100213802 | 3300006881 | Bacteria | 1504 |
| 142 | Ga0075436_100241875 | 3300006914 | Bacteria | 1284 |
| 143 | Ga0075435_100015837 | 3300007076 | Bacteria | 5675 |
| 144 | Ga0105240_10082546 | 3300009093 | Bacteria | 3947 |
| 145 | Ga0105240_10203145 | 3300009093 | Bacteria | 2321 |
| 146 | Ga0105240_10361031 | 3300009093 | Bacteria | 1645 |
| 147 | Ga0105240_10429504 | 3300009093 | Unclassified | 1482 |
| 148 | Ga0105240_10893224 | 3300009093 | Bacteria | 956 |
| 149 | Ga0105240_11096749 | 3300009093 | Unclassified | 847 |
| 150 | Ga0105240_11341034 | 3300009093 | Bacteria | 753 |
| 151 | Ga0105245_10916525 | 3300009098 | Bacteria | 918 |
| 152 | Ga0105243_10087554 | 3300009148 | Bacteria | 2557 |
| 153 | Ga0105241_10079979 | 3300009174 | Bacteria | 2557 |
| 154 | Ga0105241_10325800 | 3300009174 | Unclassified | 1326 |
| 155 | Ga0105241_10572599 | 3300009174 | Bacteria | 1017 |
| 156 | Ga0105241_10901362 | 3300009174 | Unclassified | 821 |
| 157 | Ga0105242_10011407 | 3300009176 | Bacteria | 6830 |
| 158 | Ga0105237_10048265 | 3300009545 | Bacteria | 4279 |
| 159 | Ga0105237_10118964 | 3300009545 | Bacteria | 2636 |
| 160 | Ga0105237_12321929 | 3300009545 | Bacteria | 546 |
| 161 | Ga0105238_10010051 | 3300009551 | Bacteria | 9493 |
| 162 | Ga0105238_10025309 | 3300009551 | Bacteria | 6049 |
| 163 | Ga0105238_11143761 | 3300009551 | Unclassified | 802 |
| 164 | Ga0105238_11260603 | 3300009551 | Unclassified | 764 |
| 165 | Ga0105238_11656464 | 3300009551 | Bacteria | 670 |
| 166 | Ga0105238_12075972 | 3300009551 | Bacteria | 602 |
| 167 | Ga0105239_10422750 | 3300010375 | Bacteria | 1510 |
| 168 | Ga0105239_11352560 | 3300010375 | Bacteria | 822 |
| 169 | Ga0105246_12026032 | 3300011119 | Bacteria | 556 |
| 170 | Ga0157341_1047460 | 3300012494 | Bacteria | 516 |
| 171 | Ga0157345_1007765 | 3300012498 | Unclassified | 882 |
| 172 | Ga0157313_1033403 | 3300012503 | Unclassified | 596 |
| 173 | Ga0157327_1066646 | 3300012512 | Unclassified | 549 |
| 174 | Ga0157373_10194066 | 3300013100 | Bacteria | 1431 |
| 175 | Ga0157373_10617204 | 3300013100 | Bacteria | 790 |
| 176 | Ga0157373_10934732 | 3300013100 | Bacteria | 645 |
| 177 | Ga0157371_10509914 | 3300013102 | Unclassified | 889 |
| 178 | Ga0157370_10058957 | 3300013104 | Bacteria | 3649 |
| 179 | Ga0157370_10142432 | 3300013104 | Bacteria | 2234 |
| 180 | Ga0157370_10197113 | 3300013104 | Bacteria | 1869 |
| 181 | Ga0157370_10252193 | 3300013104 | Unclassified | 1632 |
| 182 | Ga0157370_10301505 | 3300013104 | Bacteria | 1479 |
| 183 | Ga0157370_10640720 | 3300013104 | Bacteria | 972 |
| 184 | Ga0157370_10668342 | 3300013104 | Bacteria | 949 |
| 185 | Ga0157369_10019147 | 3300013105 | Bacteria | 7662 |
| 186 | Ga0157369_10056755 | 3300013105 | Bacteria | 4225 |
| 187 | Ga0157369_10118792 | 3300013105 | Unclassified | 2806 |
| 188 | Ga0157369_10125959 | 3300013105 | Bacteria | 2716 |
| 189 | Ga0157369_10372844 | 3300013105 | Bacteria | 1481 |
| 190 | Ga0157369_10422519 | 3300013105 | Bacteria | 1382 |
| 191 | Ga0157369_11715400 | 3300013105 | Unclassified | 638 |
| 192 | Ga0157374_10074991 | 3300013296 | Bacteria | 3196 |
| 193 | Ga0157374_10870492 | 3300013296 | Bacteria | 918 |
| 194 | Ga0157374_11205236 | 3300013296 | Unclassified | 778 |
| 195 | Ga0157374_12101684 | 3300013296 | Bacteria | 591 |
| 196 | Ga0157378_10335642 | 3300013297 | Bacteria | 1472 |
| 197 | Ga0157378_12418555 | 3300013297 | Bacteria | 577 |
| 198 | Ga0157372_10061582 | 3300013307 | Bacteria | 4202 |
| 199 | Ga0157372_10080718 | 3300013307 | Bacteria | 3681 |
| 200 | Ga0157372_10284303 | 3300013307 | Bacteria | 1923 |
| 201 | Ga0157372_10308215 | 3300013307 | Bacteria | 1842 |
| 202 | Ga0157372_10450416 | 3300013307 | Unclassified | 1500 |
| 203 | Ga0157372_10787920 | 3300013307 | Unclassified | 1105 |
| 204 | Ga0157372_12321874 | 3300013307 | Bacteria | 616 |
| 205 | Ga0157372_13022580 | 3300013307 | Bacteria | 538 |
| 206 | Ga0157375_11082037 | 3300013308 | Bacteria | 938 |
| 207 | Ga0163163_10739311 | 3300014325 | Bacteria | 1047 |
| 208 | Ga0182008_10876576 | 3300014497 | Bacteria | 526 |
| 209 | Ga0157376_10857131 | 3300014969 | Bacteria | 924 |
| 210 | Ga0197907_10173273 | 3300020069 | Bacteria | 1762 |
| 211 | Ga0197907_10339535 | 3300020069 | Bacteria | 1343 |
| 212 | Ga0197907_10507941 | 3300020069 | Bacteria | 1546 |
| 213 | Ga0197907_10595388 | 3300020069 | Bacteria | 1303 |
| 214 | Ga0197907_10962352 | 3300020069 | Bacteria | 543 |
| 215 | Ga0197907_11119477 | 3300020069 | Unclassified | 876 |
| 216 | Ga0206356_10578748 | 3300020070 | Bacteria | 1981 |
| 217 | Ga0206356_10635958 | 3300020070 | Unclassified | 1262 |
| 218 | Ga0206356_10856040 | 3300020070 | Bacteria | 605 |
| 219 | Ga0206356_11498134 | 3300020070 | Bacteria | 842 |
| 220 | Ga0206356_11830929 | 3300020070 | Bacteria | 840 |
| 221 | Ga0206355_1008459 | 3300020076 | Bacteria | 1130 |
| 222 | Ga0206355_1041960 | 3300020076 | Bacteria | 880 |
| 223 | Ga0206355_1099827 | 3300020076 | Bacteria | 1363 |
| 224 | Ga0206355_1537900 | 3300020076 | Bacteria | 1835 |
| 225 | Ga0206351_10843812 | 3300020077 | Unclassified | 659 |
| 226 | Ga0206351_10991913 | 3300020077 | Bacteria | 1261 |
| 227 | Ga0206352_10020547 | 3300020078 | Bacteria | 1116 |
| 228 | Ga0206350_10753255 | 3300020080 | Bacteria | 913 |
| 229 | Ga0206350_11127130 | 3300020080 | Bacteria | 1228 |
| 230 | Ga0206350_11135316 | 3300020080 | Bacteria | 1127 |
| 231 | Ga0206350_11574936 | 3300020080 | Bacteria | 600 |
| 232 | Ga0206354_10295361 | 3300020081 | Bacteria | 618 |
| 233 | Ga0206354_10981365 | 3300020081 | Bacteria | 770 |
| 234 | Ga0206354_11022399 | 3300020081 | Bacteria | 698 |
| 235 | Ga0206354_11045379 | 3300020081 | Bacteria | 611 |
| 236 | Ga0206354_11235662 | 3300020081 | Bacteria | 2216 |
| 237 | Ga0206354_11282843 | 3300020081 | Bacteria | 4747 |
| 238 | Ga0206354_11650944 | 3300020081 | Bacteria | 821 |
| 239 | Ga0206353_10455743 | 3300020082 | Bacteria | 1211 |
| 240 | Ga0206353_11261646 | 3300020082 | Bacteria | 5237 |
| 241 | Ga0206353_11393041 | 3300020082 | Bacteria | 1385 |
| 242 | Ga0206353_11757796 | 3300020082 | Unclassified | 1762 |
| 243 | Ga0206353_11925226 | 3300020082 | Bacteria | 1260 |
| 244 | Ga0206353_11940842 | 3300020082 | Bacteria | 1215 |
| 245 | Ga0154015_1284807 | 3300020610 | Unclassified | 612 |
| 246 | Ga0213876_10052936 | 3300021384 | Bacteria | 2145 |
| 247 | Ga0224712_10009759 | 3300022467 | Bacteria | 2907 |
| 248 | Ga0224712_10015183 | 3300022467 | Bacteria | 2500 |
| 249 | Ga0224712_10094160 | 3300022467 | Bacteria | 1260 |
| 250 | Ga0224712_10117194 | 3300022467 | Bacteria | 1149 |
| 251 | Ga0224712_10199927 | 3300022467 | Bacteria | 908 |
| 252 | Ga0224712_10447349 | 3300022467 | Bacteria | 620 |
| 253 | Ga0207692_10693840 | 3300025898 | Unclassified | 660 |
| 254 | Ga0207647_10437919 | 3300025904 | Bacteria | 733 |
| 255 | Ga0207699_10248472 | 3300025906 | Bacteria | 1225 |
| 256 | Ga0207699_10683915 | 3300025906 | Bacteria | 750 |
| 257 | Ga0207705_10025343 | 3300025909 | Bacteria | 4235 |
| 258 | Ga0207705_10084817 | 3300025909 | Unclassified | 2313 |
| 259 | Ga0207705_10114886 | 3300025909 | Bacteria | 1992 |
| 260 | Ga0207705_10351137 | 3300025909 | Bacteria | 1136 |
| 261 | Ga0207705_10770780 | 3300025909 | Bacteria | 747 |
| 262 | Ga0207705_10808980 | 3300025909 | Bacteria | 727 |
| 263 | Ga0207654_10102433 | 3300025911 | Bacteria | 1766 |
| 264 | Ga0207654_11171439 | 3300025911 | Unclassified | 560 |
| 265 | Ga0207707_10001354 | 3300025912 | Bacteria | 22790 |
| 266 | Ga0207707_10003861 | 3300025912 | Bacteria | 13289 |
| 267 | Ga0207707_10016946 | 3300025912 | Bacteria | 6347 |
| 268 | Ga0207707_10024347 | 3300025912 | Bacteria | 5298 |
| 269 | Ga0207707_10091058 | 3300025912 | Bacteria | 2665 |
| 270 | Ga0207707_10165303 | 3300025912 | Bacteria | 1934 |
| 271 | Ga0207707_10497003 | 3300025912 | Bacteria | 1040 |
| 272 | Ga0207707_10556418 | 3300025912 | Bacteria | 974 |
| 273 | Ga0207707_10748804 | 3300025912 | Bacteria | 817 |
| 274 | Ga0207707_11428843 | 3300025912 | Bacteria | 551 |
| 275 | Ga0207695_10073892 | 3300025913 | Bacteria | 3472 |
| 276 | Ga0207695_10683479 | 3300025913 | Bacteria | 907 |
| 277 | Ga0207695_10829146 | 3300025913 | Bacteria | 805 |
| 278 | Ga0207671_10067541 | 3300025914 | Bacteria | 2663 |
| 279 | Ga0207671_10172996 | 3300025914 | Bacteria | 1678 |
| 280 | Ga0207693_10015541 | 3300025915 | Bacteria | 6106 |
| 281 | Ga0207693_10202083 | 3300025915 | Bacteria | 1563 |
| 282 | Ga0207693_10215668 | 3300025915 | Bacteria | 1508 |
| 283 | Ga0207663_10171611 | 3300025916 | Bacteria | 1541 |
| 284 | Ga0207663_10396673 | 3300025916 | Bacteria | 1054 |
| 285 | Ga0207660_10087942 | 3300025917 | Unclassified | 2297 |
| 286 | Ga0207660_10098842 | 3300025917 | Bacteria | 2177 |
| 287 | Ga0207660_10221339 | 3300025917 | Bacteria | 1485 |
| 288 | Ga0207660_10338052 | 3300025917 | Unclassified | 1205 |
| 289 | Ga0207660_10353224 | 3300025917 | Bacteria | 1178 |
| 290 | Ga0207660_10701571 | 3300025917 | Bacteria | 825 |
| 291 | Ga0207657_10000184 | 3300025919 | Bacteria | 64813 |
| 292 | Ga0207657_10001572 | 3300025919 | Bacteria | 24505 |
| 293 | Ga0207657_10002804 | 3300025919 | Bacteria | 18753 |
| 294 | Ga0207657_10004538 | 3300025919 | Bacteria | 14672 |
| 295 | Ga0207657_10104909 | 3300025919 | Bacteria | 2341 |
| 296 | Ga0207657_10293935 | 3300025919 | Bacteria | 1288 |
| 297 | Ga0207657_10488861 | 3300025919 | Bacteria | 964 |
| 298 | Ga0207657_11215560 | 3300025919 | Bacteria | 572 |
| 299 | Ga0207649_10008750 | 3300025920 | Bacteria | 5526 |
| 300 | Ga0207649_10023639 | 3300025920 | Bacteria | 3562 |
| 301 | Ga0207649_10064842 | 3300025920 | Bacteria | 2311 |
| 302 | Ga0207649_10817973 | 3300025920 | Unclassified | 728 |
| 303 | Ga0207649_11156358 | 3300025920 | Bacteria | 611 |
| 304 | Ga0207652_10077744 | 3300025921 | Bacteria | 2896 |
| 305 | Ga0207652_10097916 | 3300025921 | Bacteria | 2586 |
| 306 | Ga0207652_10617958 | 3300025921 | Bacteria | 971 |
| 307 | Ga0207652_10656338 | 3300025921 | Bacteria | 938 |
| 308 | Ga0207652_11280008 | 3300025921 | Bacteria | 636 |
| 309 | Ga0207646_10323864 | 3300025922 | Bacteria | 1393 |
| 310 | Ga0207694_10178276 | 3300025924 | Bacteria | 1722 |
| 311 | Ga0207694_10243785 | 3300025924 | Bacteria | 1469 |
| 312 | Ga0207694_10795746 | 3300025924 | Unclassified | 799 |
| 313 | Ga0207694_11197508 | 3300025924 | Bacteria | 643 |
| 314 | Ga0207687_10475144 | 3300025927 | Bacteria | 1040 |
| 315 | Ga0207687_11289182 | 3300025927 | Bacteria | 628 |
| 316 | Ga0207700_10610889 | 3300025928 | Bacteria | 971 |
| 317 | Ga0207700_11022002 | 3300025928 | Bacteria | 740 |
| 318 | Ga0207664_10535467 | 3300025929 | Bacteria | 1050 |
| 319 | Ga0207664_10793434 | 3300025929 | Bacteria | 852 |
| 320 | Ga0207664_10966736 | 3300025929 | Bacteria | 764 |
| 321 | Ga0207664_11178669 | 3300025929 | Bacteria | 684 |
| 322 | Ga0207664_11213525 | 3300025929 | Bacteria | 672 |
| 323 | Ga0207664_11406286 | 3300025929 | Unclassified | 618 |
| 324 | Ga0207644_10410483 | 3300025931 | Bacteria | 1108 |
| 325 | Ga0207644_10490064 | 3300025931 | Bacteria | 1013 |
| 326 | Ga0207690_10512668 | 3300025932 | Bacteria | 971 |
| 327 | Ga0207690_10556242 | 3300025932 | Bacteria | 933 |
| 328 | Ga0207690_11633012 | 3300025932 | Bacteria | 539 |
| 329 | Ga0207690_11736351 | 3300025932 | Unclassified | 521 |
| 330 | Ga0207686_10009407 | 3300025934 | Bacteria | 5301 |
| 331 | Ga0207709_10089900 | 3300025935 | Bacteria | 2003 |
| 332 | Ga0207704_10976964 | 3300025938 | Bacteria | 715 |
| 333 | Ga0207665_10138695 | 3300025939 | Bacteria | 1732 |
| 334 | Ga0207665_10548902 | 3300025939 | Bacteria | 898 |
| 335 | Ga0207665_11320273 | 3300025939 | Bacteria | 575 |
| 336 | Ga0207661_10067685 | 3300025944 | Bacteria | 2905 |
| 337 | Ga0207661_11187382 | 3300025944 | Bacteria | 702 |
| 338 | Ga0207661_11389091 | 3300025944 | Bacteria | 644 |
| 339 | Ga0207667_10147866 | 3300025949 | Unclassified | 2418 |
| 340 | Ga0207667_10264338 | 3300025949 | Bacteria | 1759 |
| 341 | Ga0207667_10407958 | 3300025949 | Bacteria | 1383 |
| 342 | Ga0207667_10412065 | 3300025949 | Unclassified | 1375 |
| 343 | Ga0207667_11630797 | 3300025949 | Unclassified | 613 |
| 344 | Ga0207668_11318868 | 3300025972 | Bacteria | 650 |
| 345 | Ga0207640_10252006 | 3300025981 | Bacteria | 1371 |
| 346 | Ga0207640_11280639 | 3300025981 | Unclassified | 654 |
| 347 | Ga0207658_10043523 | 3300025986 | Unclassified | 3264 |
| 348 | Ga0207639_10220297 | 3300026041 | Unclassified | 1638 |
| 349 | Ga0207639_10544732 | 3300026041 | Bacteria | 1065 |
| 350 | Ga0207678_10468505 | 3300026067 | Bacteria | 1096 |
| 351 | Ga0207678_10728952 | 3300026067 | Unclassified | 873 |
| 352 | Ga0207702_10033479 | 3300026078 | Bacteria | 4293 |
| 353 | Ga0207702_10161198 | 3300026078 | Unclassified | 2048 |
| 354 | Ga0207702_10579234 | 3300026078 | Bacteria | 1100 |
| 355 | Ga0207702_11154557 | 3300026078 | Bacteria | 769 |
| 356 | Ga0207674_10036719 | 3300026116 | Bacteria | 5101 |
| 357 | Ga0207674_10373780 | 3300026116 | Bacteria | 1378 |
| 358 | Ga0207683_10227739 | 3300026121 | Bacteria | 1699 |
| 359 | Ga0207683_10229143 | 3300026121 | Bacteria | 1694 |
| 360 | Ga0207698_10278857 | 3300026142 | Bacteria | 1545 |
| 361 | Ga0207698_12210285 | 3300026142 | Unclassified | 563 |
| 362 | Ga0268266_10321005 | 3300028379 | Bacteria | 1449 |
| 363 | Ga0265318_10030206 | 3300028577 | Bacteria | 2109 |
| 364 | Ga0265318_10306429 | 3300028577 | Bacteria | 580 |
| 365 | Ga0265323_10096894 | 3300028653 | Bacteria | 980 |
| 366 | Ga0265322_10003676 | 3300028654 | Bacteria | 4620 |
| 367 | Ga0265322_10026563 | 3300028654 | Bacteria | 1655 |
| 368 | Ga0265338_10040828 | 3300028800 | Bacteria | 4351 |
| 369 | Ga0265338_10306688 | 3300028800 | Bacteria | 1152 |
| 370 | Ga0265324_10112656 | 3300029957 | Bacteria | 924 |
| 371 | Ga0265330_10017267 | 3300031235 | Bacteria | 3326 |
| 372 | Ga0265328_10063286 | 3300031239 | Bacteria | 1358 |
| 373 | Ga0265320_10115550 | 3300031240 | Unclassified | 1227 |
| 374 | Ga0265325_10009990 | 3300031241 | Bacteria | 5516 |
| 375 | Ga0265329_10020381 | 3300031242 | Bacteria | 2240 |
| 376 | Ga0265340_10118416 | 3300031247 | Bacteria | 1220 |
| 377 | Ga0265340_10561742 | 3300031247 | Bacteria | 502 |
| 378 | Ga0265339_10087142 | 3300031249 | Bacteria | 1641 |
| 379 | Ga0265331_10191876 | 3300031250 | Bacteria | 921 |
| 380 | Ga0265327_10079025 | 3300031251 | Bacteria | 1629 |
| 381 | Ga0265327_10175506 | 3300031251 | Unclassified | 982 |
| 382 | Ga0265327_10291637 | 3300031251 | Bacteria | 719 |
| 383 | Ga0265316_10009291 | 3300031344 | Bacteria | 9058 |
| 384 | Ga0265313_10005258 | 3300031595 | Bacteria | 9584 |
| 385 | Ga0265314_10010364 | 3300031711 | Bacteria | 7781 |
| 386 | Ga0265342_10012054 | 3300031712 | Bacteria | 5871 |
| 387 | Ga0307405_10143198 | 3300031731 | Bacteria | 1670 |
| 388 | Ga0307409_100150263 | 3300031995 | Bacteria | 2021 |
| 389 | Ga0307416_100079822 | 3300032002 | Bacteria | 2759 |
| 390 | Ga0373934_0157584 | 3300035086 | Bacteria | 931 |
| 391 | Ga0373944_0018016 | 3300035089 | Bacteria | 2013 |
| 392 | Ga0373923_0286885 | 3300035111 | Bacteria | 777 |
| 393 | Ga0373936_0065108 | 3300035113 | Bacteria | 1495 |
| 394 | Ga0373936_0434312 | 3300035113 | Bacteria | 606 |
| 395 | Ga0373945_0003252 | 3300035116 | Bacteria | 5097 |
| 396 | Ga0373953_0199303 | 3300035117 | Bacteria | 866 |
| 397 | Ga0373943_0002483 | 3300035170 | Bacteria | 8378 |
| 398 | Ga0373946_0003171 | 3300035171 | Bacteria | 5826 |
| 399 | Ga0373955_0081658 | 3300035172 | Bacteria | 1828 |
| 400 | Ga0373955_0183070 | 3300035172 | Unclassified | 1244 |
| 401 | Ga0373935_0005754 | 3300035692 | Bacteria | 7328 |
| 402 | Ga0373927_0050966 | 3300035695 | Bacteria | 2677 |
| 403 | Ga0373933_0147766 | 3300035724 | Bacteria | 1487 |
| 404 | Ga0373933_0848125 | 3300035724 | Unclassified | 601 |
| 405 | Ga0373947_0008338 | 3300035725 | Bacteria | 5968 |
| 406 | Ga0373947_1065119 | 3300035725 | Bacteria | 551 |
| 407 | Ga0373937_0420027 | 3300036401 | Unclassified | 1269 |
| 408 | Ga0373937_1003071 | 3300036401 | Bacteria | 784 |
| 409 | Ga0373925_0001472 | 3300037068 | Bacteria | 20286 |
| 410 | Ga0395899_0118452 | 3300037312 | Bacteria | 1899 |
| 411 | Ga0395899_0123052 | 3300037312 | Bacteria | 1856 |
| 412 | Ga0395899_0153618 | 3300037312 | Bacteria | 1630 |
| 413 | Ga0395899_0242192 | 3300037312 | Bacteria | 1241 |
| 414 | Ga0395899_0407412 | 3300037312 | Bacteria | 898 |
| 415 | Ga0395899_0733235 | 3300037312 | Unclassified | 617 |
| 416 | Ga0395899_0755134 | 3300037312 | Bacteria | 605 |
| 417 | Ga0395899_0758429 | 3300037312 | Bacteria | 603 |
| 418 | Ga0395900_0005432 | 3300037418 | Bacteria | 13351 |
| 419 | Ga0395900_0006090 | 3300037418 | Bacteria | 12579 |
| 420 | Ga0395900_0013485 | 3300037418 | Bacteria | 8351 |
| 421 | Ga0395900_0046484 | 3300037418 | Bacteria | 4470 |
| 422 | Ga0395900_0101632 | 3300037418 | Bacteria | 2953 |
| 423 | Ga0395900_0111471 | 3300037418 | Bacteria | 2810 |
| 424 | Ga0395900_0115035 | 3300037418 | Bacteria | 2760 |
| 425 | Ga0395900_0129398 | 3300037418 | Bacteria | 2588 |
| 426 | Ga0395900_0164769 | 3300037418 | Bacteria | 2259 |
| 427 | Ga0395900_0281025 | 3300037418 | Bacteria | 1656 |
| 428 | Ga0395900_0388603 | 3300037418 | Bacteria | 1362 |
| 429 | Ga0395900_0496831 | 3300037418 | Unclassified | 1171 |
| 430 | Ga0395900_0520845 | 3300037418 | Bacteria | 1137 |
| 431 | Ga0395900_0671684 | 3300037418 | Unclassified | 971 |
| 432 | Ga0395900_0817539 | 3300037418 | Bacteria | 859 |
| 433 | Ga0395900_0856429 | 3300037418 | Bacteria | 834 |
| 434 | Ga0395900_1357843 | 3300037418 | Unclassified | 624 |
| 435 | Ga0395900_1634443 | 3300037418 | Bacteria | 555 |
| 436 | Ga0395898_0002274 | 3300037466 | Bacteria | 23201 |
| 437 | Ga0395898_0015457 | 3300037466 | Bacteria | 7828 |
| 438 | Ga0395898_0041314 | 3300037466 | Bacteria | 4556 |
| 439 | Ga0395898_0119368 | 3300037466 | Bacteria | 2526 |
| 440 | Ga0395898_0223119 | 3300037466 | Bacteria | 1798 |
| 441 | Ga0395898_0413096 | 3300037466 | Bacteria | 1286 |
| 442 | Ga0395898_0428594 | 3300037466 | Bacteria | 1260 |
| 443 | Ga0395898_0468980 | 3300037466 | Unclassified | 1198 |
| 444 | Ga0395898_0475411 | 3300037466 | Bacteria | 1189 |
| 445 | Ga0395898_0503656 | 3300037466 | Bacteria | 1152 |
| 446 | Ga0395898_0864451 | 3300037466 | Bacteria | 843 |
| 447 | Ga0395905_0012897 | 3300037471 | Bacteria | 8034 |
| 448 | Ga0395905_0020154 | 3300037471 | Bacteria | 6317 |
| 449 | Ga0395905_0062674 | 3300037471 | Bacteria | 3478 |
| 450 | Ga0395905_0114585 | 3300037471 | Bacteria | 2533 |
| 451 | Ga0395905_0263099 | 3300037471 | Bacteria | 1610 |
| 452 | Ga0395905_0847326 | 3300037471 | Unclassified | 817 |
| 453 | Ga0395905_1223801 | 3300037471 | Bacteria | 654 |
| 454 | Ga0395905_1259727 | 3300037471 | Unclassified | 643 |
| 455 | Ga0395905_1700007 | 3300037471 | Bacteria | 536 |
| 456 | Ga0436364_1307196 | 3300037853 | Bacteria | 2188 |
| 457 | Ga0395901_0001441 | 3300038443 | Bacteria | 24821 |
| 458 | Ga0395901_0004815 | 3300038443 | Bacteria | 13618 |
| 459 | Ga0395901_0014173 | 3300038443 | Bacteria | 8117 |
| 460 | Ga0395901_0048801 | 3300038443 | Bacteria | 4397 |
| 461 | Ga0395901_0061820 | 3300038443 | Bacteria | 3897 |
| 462 | Ga0395901_0082175 | 3300038443 | Bacteria | 3366 |
| 463 | Ga0395901_0119973 | 3300038443 | Bacteria | 2763 |
| 464 | Ga0395901_0148116 | 3300038443 | Unclassified | 2467 |
| 465 | Ga0395901_0154532 | 3300038443 | Bacteria | 2410 |
| 466 | Ga0395901_0310439 | 3300038443 | Unclassified | 1633 |
| 467 | Ga0395901_0734159 | 3300038443 | Bacteria | 982 |
| 468 | Ga0395901_1032823 | 3300038443 | Bacteria | 796 |
| 469 | Ga0395901_1366349 | 3300038443 | Bacteria | 668 |
| 470 | Ga0436365_0144409 | 3300039437 | Unclassified | 1515 |
| 471 | Ga0436365_0530545 | 3300039437 | Bacteria | 510 |
| 472 | Ga0436365_0773939 | 3300039437 | Bacteria | 1793 |
| 473 | Ga0436363_0317241 | 3300039450 | Bacteria | 1933 |
| 474 | Ga0439448_0029464 | 3300042005 | Bacteria | 1738 |
| 475 | Ga0466969_0049365 | 3300044656 | Unclassified | 2077 |
| 476 | Ga0466969_0191715 | 3300044656 | Bacteria | 934 |
| 477 | Ga0466972_0345183 | 3300044658 | Unclassified | 696 |
| 478 | Ga0466972_0619788 | 3300044658 | Unclassified | 512 |
| 479 | Ga0466965_0347708 | 3300044683 | Bacteria | 812 |
| 480 | Ga0466965_0910036 | 3300044683 | Bacteria | 513 |
| 481 | Ga0466966_0003956 | 3300044684 | Bacteria | 9793 |
| 482 | Ga0466966_0092315 | 3300044684 | Bacteria | 1878 |
| 483 | Ga0466966_0161099 | 3300044684 | Bacteria | 1366 |
| 484 | Ga0466961_0005996 | 3300044693 | Bacteria | 7704 |
| 485 | Ga0466961_0009382 | 3300044693 | Bacteria | 6234 |
| 486 | Ga0466961_0040073 | 3300044693 | Unclassified | 3003 |
| 487 | Ga0466961_0121235 | 3300044693 | Bacteria | 1642 |
| 488 | Ga0466961_0154213 | 3300044693 | Bacteria | 1433 |
| 489 | Ga0466961_0339247 | 3300044693 | Bacteria | 915 |
| 490 | Ga0466963_0002420 | 3300044694 | Bacteria | 10436 |
| 491 | Ga0466963_0036624 | 3300044694 | Bacteria | 3200 |
| 492 | Ga0466963_0048450 | 3300044694 | Bacteria | 2807 |
| 493 | Ga0466963_0048828 | 3300044694 | Bacteria | 2798 |
| 494 | Ga0466963_0050262 | 3300044694 | Bacteria | 2760 |
| 495 | Ga0466963_0111156 | 3300044694 | Bacteria | 1881 |
| 496 | Ga0466963_0123051 | 3300044694 | Bacteria | 1786 |
| 497 | Ga0466963_0140991 | 3300044694 | Unclassified | 1670 |
| 498 | Ga0466963_0213584 | 3300044694 | Bacteria | 1350 |
| 499 | Ga0466963_0308607 | 3300044694 | Bacteria | 1113 |
| 500 | Ga0466963_0407045 | 3300044694 | Unclassified | 959 |
| 501 | Ga0466963_0413136 | 3300044694 | Bacteria | 952 |
| 502 | Ga0466963_0799166 | 3300044694 | Bacteria | 665 |
| 503 | Ga0466963_0985788 | 3300044694 | Bacteria | 593 |
| 504 | Ga0466964_0008370 | 3300044706 | Bacteria | 3885 |
| 505 | Ga0466964_0010031 | 3300044706 | Bacteria | 3569 |
| 506 | Ga0466964_0062450 | 3300044706 | Unclassified | 1553 |
| 507 | Ga0466964_0070953 | 3300044706 | Bacteria | 1473 |
| 508 | Ga0466964_0213944 | 3300044706 | Bacteria | 932 |
| 509 | Ga0466971_0004353 | 3300044719 | Bacteria | 6107 |
| 510 | Ga0466971_0290709 | 3300044719 | Unclassified | 783 |
| 511 | Ga0466968_0044226 | 3300044735 | Bacteria | 1887 |
| 512 | Ga0466968_0200168 | 3300044735 | Unclassified | 935 |
| 513 | Ga0466968_0243037 | 3300044735 | Bacteria | 853 |
| 514 | Ga0466968_0398511 | 3300044735 | Bacteria | 674 |
| 515 | Ga0466970_0030291 | 3300044765 | Bacteria | 2853 |
| 516 | Ga0466957_0028618 | 3300044842 | Bacteria | 3318 |
| 517 | Ga0466957_0057833 | 3300044842 | Unclassified | 2374 |
| 518 | Ga0466957_0199668 | 3300044842 | Bacteria | 1313 |
| 519 | Ga0466957_0469450 | 3300044842 | Bacteria | 869 |
| 520 | Ga0466957_0567306 | 3300044842 | Bacteria | 792 |
| 521 | Ga0466957_1371614 | 3300044842 | Bacteria | 514 |
| 522 | Ga0466960_0267229 | 3300044901 | Bacteria | 955 |
| 523 | Ga0466960_0365526 | 3300044901 | Bacteria | 825 |
| 524 | Ga0466959_0004643 | 3300045049 | Bacteria | 9238 |
| 525 | Ga0466959_0119436 | 3300045049 | Bacteria | 1875 |
| 526 | Ga0466959_0121851 | 3300045049 | Bacteria | 1853 |
| 527 | Ga0466959_0180890 | 3300045049 | Bacteria | 1474 |
| 528 | Ga0466959_1111574 | 3300045049 | Bacteria | 525 |
| 529 | Ga0466958_0030145 | 3300045836 | Bacteria | 3219 |
| 530 | Ga0466958_0032559 | 3300045836 | Bacteria | 3102 |
| 531 | Ga0466958_0102735 | 3300045836 | Bacteria | 1779 |
| 532 | Ga0466958_0118664 | 3300045836 | Bacteria | 1655 |
| 533 | Ga0466958_0843850 | 3300045836 | Bacteria | 598 |
| 534 | Ga0466967_0001018 | 3300045976 | Bacteria | 15353 |
| 535 | Ga0466967_0006225 | 3300045976 | Bacteria | 8414 |
| 536 | Ga0466967_0008898 | 3300045976 | Bacteria | 7406 |
| 537 | Ga0466967_0009339 | 3300045976 | Bacteria | 7269 |
| 538 | Ga0466967_0012715 | 3300045976 | Bacteria | 6459 |
| 539 | Ga0466967_0015795 | 3300045976 | Bacteria | 5931 |
| 540 | Ga0466967_0023579 | 3300045976 | Bacteria | 5046 |
| 541 | Ga0466967_0035858 | 3300045976 | Bacteria | 4227 |
| 542 | Ga0466967_0038570 | 3300045976 | Bacteria | 4098 |
| 543 | Ga0466967_0092462 | 3300045976 | Bacteria | 2750 |
| 544 | Ga0466967_0108255 | 3300045976 | Bacteria | 2550 |
| 545 | Ga0466967_0124407 | 3300045976 | Bacteria | 2387 |
| 546 | Ga0466967_0159375 | 3300045976 | Bacteria | 2117 |
| 547 | Ga0466967_0419313 | 3300045976 | Bacteria | 1304 |
| 548 | Ga0466967_0437852 | 3300045976 | Bacteria | 1276 |
| 549 | Ga0466967_0450127 | 3300045976 | Bacteria | 1258 |
| 550 | Ga0466967_0471596 | 3300045976 | Bacteria | 1229 |
| 551 | Ga0466967_0476334 | 3300045976 | Bacteria | 1223 |
| 552 | Ga0466967_0617821 | 3300045976 | Bacteria | 1070 |
| 553 | Ga0466967_0718192 | 3300045976 | Bacteria | 990 |
| 554 | Ga0466967_1028857 | 3300045976 | Bacteria | 820 |
| 555 | Ga0466967_1146669 | 3300045976 | Bacteria | 774 |
| 556 | Ga0466967_1557542 | 3300045976 | Bacteria | 658 |
| 557 | Ga0466967_2236100 | 3300045976 | Unclassified | 543 |
| 558 | Ga0495592_0035896 | 3300046454 | Bacteria | 3735 |
| 559 | Ga0495592_0125821 | 3300046454 | Bacteria | 1799 |
| 560 | Ga0495592_0827436 | 3300046454 | Bacteria | 548 |
| 561 | Ga0495603_0299684 | 3300046455 | Bacteria | 923 |
| 562 | Ga0495629_0001380 | 3300046459 | Bacteria | 19145 |
| 563 | Ga0495629_0753429 | 3300046459 | Bacteria | 644 |
| 564 | Ga0495629_1060800 | 3300046459 | Bacteria | 525 |
| 565 | Ga0495641_0000416 | 3300046461 | Bacteria | 35566 |
| 566 | Ga0495651_0010678 | 3300046462 | Bacteria | 7064 |
| 567 | Ga0495651_0180087 | 3300046462 | Unclassified | 1496 |
| 568 | Ga0495651_0212792 | 3300046462 | Bacteria | 1344 |
| 569 | Ga0495653_0035409 | 3300046463 | Bacteria | 3939 |
| 570 | Ga0495653_0056042 | 3300046463 | Bacteria | 3006 |
| 571 | Ga0495653_0181718 | 3300046463 | Bacteria | 1443 |
| 572 | Ga0495580_0151672 | 3300046472 | Bacteria | 1606 |
| 573 | Ga0495582_0000789 | 3300046473 | Bacteria | 17537 |
| 574 | Ga0495582_0057747 | 3300046473 | Bacteria | 2140 |
| 575 | Ga0495582_0232719 | 3300046473 | Bacteria | 1055 |
| 576 | Ga0495605_0131826 | 3300046474 | Bacteria | 1127 |
| 577 | Ga0495639_0000578 | 3300046475 | Bacteria | 17076 |
| 578 | Ga0495662_0005764 | 3300046476 | Bacteria | 6197 |
| 579 | Ga0495594_0022153 | 3300046499 | Bacteria | 3397 |
| 580 | Ga0495608_0024723 | 3300046511 | Bacteria | 4104 |
| 581 | Ga0495608_0040891 | 3300046511 | Bacteria | 3105 |
| 582 | Ga0495608_0163904 | 3300046511 | Bacteria | 1412 |
| 583 | Ga0495608_0622100 | 3300046511 | Bacteria | 647 |
| 584 | Ga0495618_0143557 | 3300046514 | Unclassified | 1527 |
| 585 | Ga0495618_0222182 | 3300046514 | Bacteria | 1191 |
| 586 | Ga0495628_0041030 | 3300046516 | Unclassified | 3695 |
| 587 | Ga0495628_0097439 | 3300046516 | Bacteria | 2272 |
| 588 | Ga0495628_0213840 | 3300046516 | Bacteria | 1449 |
| 589 | Ga0495630_0002325 | 3300046517 | Bacteria | 13223 |
| 590 | Ga0495630_0018155 | 3300046517 | Bacteria | 5165 |
| 591 | Ga0495630_1067053 | 3300046517 | Bacteria | 613 |
| 592 | Ga0495666_0011112 | 3300046526 | Bacteria | 4493 |
| 593 | Ga0495652_0121723 | 3300046529 | Bacteria | 2079 |
| 594 | Ga0495652_0130168 | 3300046529 | Bacteria | 1993 |
| 595 | Ga0495652_0358173 | 3300046529 | Bacteria | 1043 |
| 596 | Ga0495665_0003246 | 3300046531 | Bacteria | 8801 |
| 597 | Ga0495640_0130128 | 3300046533 | Bacteria | 1629 |
| 598 | Ga0495640_0437820 | 3300046533 | Bacteria | 800 |
| 599 | Ga0495640_0718504 | 3300046533 | Bacteria | 599 |
| 600 | Ga0495586_0915817 | 3300046535 | Unclassified | 505 |
| 601 | Ga0495587_0040358 | 3300046536 | Unclassified | 2790 |
| 602 | Ga0495587_0112719 | 3300046536 | Bacteria | 1561 |
| 603 | Ga0495587_0146927 | 3300046536 | Bacteria | 1344 |
| 604 | Ga0495645_0035525 | 3300046543 | Bacteria | 3633 |
| 605 | Ga0495645_0329754 | 3300046543 | Bacteria | 988 |
| 606 | Ga0495667_0074224 | 3300046559 | Bacteria | 2214 |
| 607 | Ga0495667_0621883 | 3300046559 | Unclassified | 672 |
| 608 | Ga0495667_0885941 | 3300046559 | Bacteria | 548 |
| 609 | Ga0495634_0063605 | 3300046642 | Bacteria | 2448 |
| 610 | Ga0495635_0029513 | 3300046663 | Bacteria | 3814 |
| 611 | Ga0495635_0226529 | 3300046663 | Bacteria | 1263 |
| 612 | Ga0495588_0601541 | 3300046674 | Bacteria | 576 |
| 613 | Ga0495657_0219074 | 3300046675 | Bacteria | 1154 |
| 614 | Ga0495657_0228665 | 3300046675 | Bacteria | 1126 |
| 615 | Ga0495657_0337764 | 3300046675 | Unclassified | 893 |
| 616 | Ga0495657_0840074 | 3300046675 | Bacteria | 524 |
| 617 | Ga0495599_0354271 | 3300046678 | Bacteria | 879 |
| 618 | Ga0495599_0582722 | 3300046678 | Bacteria | 653 |
| 619 | Ga0495599_0807753 | 3300046678 | Bacteria | 535 |
| 620 | Ga0495623_0274003 | 3300046679 | Bacteria | 941 |
| 621 | Ga0495646_0062288 | 3300046680 | Bacteria | 2218 |
| 622 | Ga0495647_0006761 | 3300046681 | Bacteria | 3818 |
| 623 | Ga0495658_0000132 | 3300046683 | Bacteria | 41217 |
| 624 | Ga0495658_0320046 | 3300046683 | Bacteria | 983 |
| 625 | Ga0495613_0004012 | 3300046689 | Bacteria | 11017 |
| 626 | Ga0495624_0300126 | 3300046690 | Bacteria | 969 |
| 627 | Ga0495624_0383471 | 3300046690 | Bacteria | 844 |
| 628 | Ga0495649_0556527 | 3300046694 | Unclassified | 568 |
| 629 | Ga0495600_0040635 | 3300046809 | Bacteria | 3030 |
| 630 | Ga0495600_0479768 | 3300046809 | Unclassified | 766 |
| 631 | Ga0495581_0001376 | 3300047315 | Bacteria | 13467 |
| 632 | Ga0495604_0181196 | 3300047317 | Unclassified | 1473 |
| 633 | Ga0495604_0265292 | 3300047317 | Bacteria | 1166 |
| 634 | Ga0495674_0019479 | 3300047319 | Bacteria | 6298 |
| 635 | Ga0495674_0044638 | 3300047319 | Bacteria | 3939 |
| 636 | Ga0495674_0246689 | 3300047319 | Bacteria | 1470 |
| 637 | Ga0495674_0668644 | 3300047319 | Bacteria | 817 |
| 638 | Ga0495674_1176040 | 3300047319 | Bacteria | 581 |
| 639 | Ga0495676_0002345 | 3300047321 | Bacteria | 16782 |
| 640 | Ga0495680_0026108 | 3300047322 | Bacteria | 4821 |
| 641 | Ga0495680_0028649 | 3300047322 | Bacteria | 4565 |
| 642 | Ga0495680_0604821 | 3300047322 | Bacteria | 733 |
| 643 | Ga0495675_0232018 | 3300047444 | Bacteria | 1113 |
| 644 | Ga0495675_0635373 | 3300047444 | Bacteria | 603 |
| 645 | Ga0495684_0005676 | 3300047471 | Bacteria | 9717 |
| 646 | Ga0495684_0048709 | 3300047471 | Bacteria | 3239 |
| 647 | Ga0495684_0344962 | 3300047471 | Bacteria | 1059 |
| 648 | Ga0495684_0434188 | 3300047471 | Bacteria | 916 |
| 649 | Ga0495602_0046988 | 3300048088 | Bacteria | 3894 |
| 650 | Ga0495602_0127896 | 3300048088 | Bacteria | 2032 |
| 651 | Ga0495602_0995310 | 3300048088 | Bacteria | 553 |
| 652 | Ga0495614_0002864 | 3300048089 | Bacteria | 7673 |
| 653 | Ga0496100_0000648 | 3300048903 | Bacteria | 16518 |
| 654 | Ga0496100_0048836 | 3300048903 | Bacteria | 2733 |
| 655 | Ga0496100_0059199 | 3300048903 | Bacteria | 2516 |
| 656 | Ga0496100_0105108 | 3300048903 | Bacteria | 1952 |
| 657 | Ga0496100_0309614 | 3300048903 | Bacteria | 1184 |
| 658 | Ga0496101_0011052 | 3300048904 | Bacteria | 5980 |
| 659 | Ga0496101_0024175 | 3300048904 | Bacteria | 4202 |
| 660 | Ga0496101_0071232 | 3300048904 | Bacteria | 2548 |
| 661 | Ga0496101_0097899 | 3300048904 | Bacteria | 2191 |
| 662 | Ga0496102_0002063 | 3300048905 | Bacteria | 17305 |
| 663 | Ga0496102_0050984 | 3300048905 | Bacteria | 3770 |
| 664 | Ga0496102_0528552 | 3300048905 | Bacteria | 1102 |
| 665 | Ga0496102_1371433 | 3300048905 | Bacteria | 626 |
| 666 | Ga0496102_1472975 | 3300048905 | Unclassified | 599 |
| 667 | Ga0496103_0115361 | 3300048906 | Bacteria | 1708 |
| 668 | Ga0496103_0127809 | 3300048906 | Bacteria | 1621 |
| 669 | Ga0496103_0320408 | 3300048906 | Unclassified | 997 |
| 670 | Ga0496103_0490921 | 3300048906 | Bacteria | 786 |
| 671 | Ga0496104_0028803 | 3300048907 | Bacteria | 5147 |
| 672 | Ga0496104_0242461 | 3300048907 | Bacteria | 1715 |
| 673 | Ga0496105_1111542 | 3300048908 | Unclassified | 586 |
| 674 | Ga0496106_0000263 | 3300048909 | Bacteria | 36905 |
| 675 | Ga0496106_0038704 | 3300048909 | Bacteria | 3570 |
| 676 | Ga0496106_0275501 | 3300048909 | Bacteria | 1347 |
| 677 | Ga0496106_1300340 | 3300048909 | Unclassified | 564 |
| 678 | Ga0496107_0000712 | 3300048910 | Bacteria | 18973 |
| 679 | Ga0496107_0012908 | 3300048910 | Bacteria | 5839 |
| 680 | Ga0496107_0852532 | 3300048910 | Bacteria | 665 |
| 681 | Ga0496108_0001638 | 3300048911 | Bacteria | 17745 |
| 682 | Ga0496108_0580992 | 3300048911 | Unclassified | 977 |
| 683 | Ga0496108_1049268 | 3300048911 | Bacteria | 694 |
| 684 | Ga0496109_0006975 | 3300048912 | Bacteria | 9535 |
| 685 | Ga0496109_0633258 | 3300048912 | Bacteria | 1006 |
| 686 | Ga0496109_1045894 | 3300048912 | Bacteria | 754 |
| 687 | Ga0496109_1381779 | 3300048912 | Bacteria | 640 |
| 688 | Ga0496110_0003901 | 3300048913 | Bacteria | 11470 |
| 689 | Ga0496111_0046319 | 3300048914 | Bacteria | 3131 |
| 690 | Ga0496112_0003739 | 3300048915 | Bacteria | 12711 |
| 691 | Ga0496112_0008367 | 3300048915 | Bacteria | 9266 |
| 692 | Ga0496112_0156915 | 3300048915 | Bacteria | 2242 |
| 693 | Ga0496112_0157368 | 3300048915 | Bacteria | 2239 |
| 694 | Ga0496112_0256465 | 3300048915 | Bacteria | 1699 |
| 695 | Ga0496113_0243256 | 3300048916 | Bacteria | 1436 |
| 696 | Ga0496113_1238163 | 3300048916 | Unclassified | 582 |
| 697 | Ga0496114_0000444 | 3300048917 | Bacteria | 30383 |
| 698 | Ga0496114_0024082 | 3300048917 | Bacteria | 4968 |
| 699 | Ga0496114_0086660 | 3300048917 | Bacteria | 2654 |
| 700 | Ga0496114_0388756 | 3300048917 | Bacteria | 1235 |
| 701 | Ga0496114_1221790 | 3300048917 | Bacteria | 638 |
| 702 | Ga0496115_0000415 | 3300048918 | Bacteria | 34771 |
| 703 | Ga0496115_0048637 | 3300048918 | Bacteria | 3392 |
| 704 | Ga0496115_0080482 | 3300048918 | Bacteria | 2652 |
| 705 | Ga0496115_0125145 | 3300048918 | Bacteria | 2117 |
| 706 | Ga0496115_0698938 | 3300048918 | Bacteria | 797 |
| 707 | Ga0496115_0708446 | 3300048918 | Bacteria | 791 |
| 708 | Ga0501032_0861741 | 3300049569 | Bacteria | 571 |
| 709 | Ga0501047_0105162 | 3300049581 | Bacteria | 2703 |
| 710 | Ga0501047_0133936 | 3300049581 | Bacteria | 2358 |
| 711 | Ga0501047_0234308 | 3300049581 | Bacteria | 1688 |
| 712 | Ga0501067_0000797 | 3300049583 | Bacteria | 16982 |
| 713 | Ga0501069_0016886 | 3300049585 | Bacteria | 3922 |
| 714 | Ga0501069_0058400 | 3300049585 | Bacteria | 2151 |
| 715 | Ga0501069_0065613 | 3300049585 | Bacteria | 2030 |
| 716 | Ga0501069_0128368 | 3300049585 | Bacteria | 1451 |
| 717 | Ga0501070_0000104 | 3300049586 | Bacteria | 74572 |
| 718 | Ga0501070_0008488 | 3300049586 | Bacteria | 8682 |
| 719 | Ga0501070_0132164 | 3300049586 | Bacteria | 2062 |
| 720 | Ga0501070_0196367 | 3300049586 | Bacteria | 1657 |
| 721 | Ga0501070_0298413 | 3300049586 | Bacteria | 1313 |
| 722 | Ga0501070_1082015 | 3300049586 | Bacteria | 619 |
| 723 | Ga0501070_1548790 | 3300049586 | Bacteria | 501 |
| 724 | Ga0501073_0473153 | 3300049589 | Bacteria | 866 |
| 725 | Ga0501074_0087182 | 3300049590 | Bacteria | 2236 |
| 726 | Ga0501074_0221743 | 3300049590 | Bacteria | 1346 |
| 727 | Ga0501074_0482192 | 3300049590 | Bacteria | 879 |
| 728 | Ga0501074_0798298 | 3300049590 | Bacteria | 665 |
| 729 | Ga0501080_0076970 | 3300049742 | Bacteria | 3102 |
| 730 | Ga0501080_0135077 | 3300049742 | Bacteria | 2283 |
| 731 | Ga0501080_0822349 | 3300049742 | Bacteria | 814 |
| 732 | Ga0501080_0831378 | 3300049742 | Bacteria | 808 |
| 733 | Ga0501083_0107396 | 3300049744 | Bacteria | 1837 |
| 734 | Ga0501035_0735087 | 3300049822 | Bacteria | 793 |
| 735 | Ga0501044_0425251 | 3300049823 | Bacteria | 1238 |
| 736 | Ga0501044_0882832 | 3300049823 | Bacteria | 770 |
| 737 | nmdc:mga0n895_8675_c1 | 3300050512 | Bacteria | 8826 |
| 738 | nmdc:mga0rr50_5288_c1 | 3300050513 | Bacteria | 7679 |
| 739 | nmdc:mga0a205_98546_c1 | 3300050515 | Bacteria | 2822 |
| 740 | Ga0495601_0005477 | 3300053077 | Bacteria | 7398 |
| 741 | Ga0495601_0026953 | 3300053077 | Unclassified | 3551 |
| 742 | Ga0495601_0097224 | 3300053077 | Bacteria | 1899 |
| 743 | Ga0495601_0762136 | 3300053077 | Bacteria | 615 |
| 744 | Ga0495612_0021465 | 3300053078 | Unclassified | 2591 |
| 745 | Ga0495612_0043849 | 3300053078 | Bacteria | 1829 |
| 746 | Ga0495655_0036834 | 3300053083 | Unclassified | 1225 |
| 747 | Ga0495595_0020888 | 3300053084 | Bacteria | 2854 |
| 748 | Ga0495595_0054083 | 3300053084 | Bacteria | 1866 |
| 749 | Ga0495619_0002519 | 3300053085 | Bacteria | 11984 |
| 750 | Ga0495619_0003695 | 3300053085 | Bacteria | 9864 |
| 751 | Ga0495619_0411793 | 3300053085 | Bacteria | 933 |
| 752 | Ga0495619_0622602 | 3300053085 | Unclassified | 737 |
| 753 | Ga0587093_027123 | 3300059478 | Bacteria | 804 |
| 754 | Ga0587066_006475 | 3300059490 | Bacteria | 1547 |
| 755 | Ga0587082_038018 | 3300059504 | Bacteria | 870 |
| 756 | Ga0587130_034850 | 3300059631 | Unclassified | 591 |
| 757 | Ga0466962_0000342 | 3300061719 | Bacteria | 19992 |
| 758 | Ga0466962_0204026 | 3300061719 | Bacteria | 966 |
| 759 | Ga0466962_0390725 | 3300061719 | Bacteria | 696 |
| 760 | Ga0530510_0196621 | 3300061734 | Bacteria | 1497 |
| 761 | Ga0395899_0084462 | |||
| 762 | Ga0058863_10083633 | |||
| 763 | Ga0058862_10021270 | |||
| 764 | Ga0070658_10020999 | |||
| 765 | Ga0070658_10059417 | |||
| 766 | Ga0070658_10231389 | |||
| 767 | Ga0070658_10674831 | |||
| 768 | Ga0070658_10953912 | |||
| 769 | Ga0070683_100010433 | |||
| 770 | Ga0070683_100079772 | |||
| 771 | Ga0070683_100810561 | |||
| 772 | Ga0070680_100000833 | |||
| 773 | Ga0070680_100040065 | |||
| 774 | Ga0070680_100057288 | |||
| 775 | Ga0070680_100126361 | |||
| 776 | Ga0070680_100341399 | |||
| 777 | Ga0070680_101644318 | |||
| 778 | Ga0070682_100834671 | |||
| 779 | Ga0070682_101152528 | |||
| 780 | Ga0070682_101167187 | |||
| 781 | Ga0070660_100002148 | |||
| 782 | Ga0070660_100013910 | |||
| 783 | Ga0070660_100015853 | |||
| 784 | Ga0070660_100057714 | |||
| 785 | Ga0070660_100320209 | |||
| 786 | Ga0070660_100386608 | |||
| 787 | Ga0070660_100395174 | |||
| 788 | Ga0070660_100556798 | |||
| 789 | Ga0070661_100029052 | |||
| 790 | Ga0070661_100081157 | |||
| 791 | Ga0070661_100249055 | |||
| 792 | Ga0070661_101387550 | |||
| 793 | Ga0070668_101565612 | |||
| 794 | Ga0070671_100023681 | |||
| 795 | Ga0070671_100083957 | |||
| 796 | Ga0070659_100023903 | |||
| 797 | Ga0070659_100514255 | |||
| 798 | Ga0070659_100539527 | |||
| 799 | Ga0070659_100885503 | |||
| 800 | Ga0070667_100059094 | |||
| 801 | Ga0070709_10128941 | |||
| 802 | Ga0070709_10657890 | |||
| 803 | Ga0070709_11394692 | |||
| 804 | Ga0070714_100241408 | |||
| 805 | Ga0070714_100244115 | |||
| 806 | Ga0070714_100277554 | |||
| 807 | Ga0070714_100335873 | |||
| 808 | Ga0070714_100397566 | |||
| 809 | Ga0070714_100552532 | |||
| 810 | Ga0070714_101170466 | |||
| 811 | Ga0070714_101703390 | |||
| 812 | Ga0070713_100522356 | |||
| 813 | Ga0070713_101295684 | |||
| 814 | Ga0070713_101819963 | |||
| 815 | Ga0070710_10559794 | |||
| 816 | Ga0070710_11004512 | |||
| 817 | Ga0070710_11259369 | |||
| 818 | Ga0070711_100159468 | |||
| 819 | Ga0070711_100377334 | |||
| 820 | Ga0070711_101422838 | |||
| 821 | Ga0070705_101752906 | |||
| 822 | Ga0070708_100100145 | |||
| 823 | Ga0070708_100954035 | |||
| 824 | Ga0070663_100289570 | |||
| 825 | Ga0070663_100608598 | |||
| 826 | Ga0070678_100213302 | |||
| 827 | Ga0070678_100304861 | |||
| 828 | Ga0070681_10004219 | |||
| 829 | Ga0070681_10008361 | |||
| 830 | Ga0070681_10010829 | |||
| 831 | Ga0070681_10024951 | |||
| 832 | Ga0070681_10026250 | |||
| 833 | Ga0070681_10120338 | |||
| 834 | Ga0070681_10167514 | |||
| 835 | Ga0070681_10205092 | |||
| 836 | Ga0070681_10348761 | |||
| 837 | Ga0070706_101102019 | |||
| 838 | Ga0070707_100580004 | |||
| 839 | Ga0070707_101833300 | |||
| 840 | Ga0070679_100006261 | |||
| 841 | Ga0070679_100030239 | |||
| 842 | Ga0070679_100039019 | |||
| 843 | Ga0070679_100190800 | |||
| 844 | Ga0070679_100445433 | |||
| 845 | Ga0070679_100494959 | |||
| 846 | Ga0070679_100841539 | |||
| 847 | Ga0070679_102212487 | |||
| 848 | Ga0070684_100114310 | |||
| 849 | Ga0070684_100217539 | |||
| 850 | Ga0070684_100218943 | |||
| 851 | Ga0070684_100233370 | |||
| 852 | Ga0070684_100723515 | |||
| 853 | Ga0070684_100944561 | |||
| 854 | Ga0068853_100386015 | |||
| 855 | Ga0068853_100941319 | |||
| 856 | Ga0068853_101118958 | |||
| 857 | Ga0068853_101522794 | |||
| 858 | Ga0068853_101672647 | |||
| 859 | Ga0070686_100547271 | |||
| 860 | Ga0070696_101822211 | |||
| 861 | Ga0070693_100309137 | |||
| 862 | Ga0070665_100087389 | |||
| 863 | Ga0068855_100059100 | |||
| 864 | Ga0068855_100087841 | |||
| 865 | Ga0068855_100118791 | |||
| 866 | Ga0068855_100231315 | |||
| 867 | Ga0068855_100568347 | |||
| 868 | Ga0068855_100655669 | |||
| 869 | Ga0068855_101026155 | |||
| 870 | Ga0068855_102068959 | |||
| 871 | Ga0070664_100663109 | |||
| 872 | Ga0068857_100011065 | |||
| 873 | Ga0068857_100056219 | |||
| 874 | Ga0068857_100277923 | |||
| 875 | Ga0068857_100295501 | |||
| 876 | Ga0068854_100518775 | |||
| 877 | Ga0068854_100590595 | |||
| 878 | Ga0068854_101127868 | |||
| 879 | Ga0068856_100010475 | |||
| 880 | Ga0068856_100072255 | |||
| 881 | Ga0068856_100555044 | |||
| 882 | Ga0068856_100666761 | |||
| 883 | Ga0068856_102007884 | |||
| 884 | Ga0068852_100494264 | |||
| 885 | Ga0068852_101141215 | |||
| 886 | Ga0081455_10051298 | |||
| 887 | Ga0070717_10584475 | |||
| 888 | Ga0070717_10649387 | |||
| 889 | Ga0070717_10674667 | |||
| 890 | Ga0070715_10065620 | |||
| 891 | Ga0070716_100580447 | |||
| 892 | Ga0070716_101118759 | |||
| 893 | Ga0070712_100003082 | |||
| 894 | Ga0070712_100574569 | |||
| 895 | Ga0070712_101304732 | |||
| 896 | Ga0097621_100936512 | |||
| 897 | Ga0068871_100966462 | |||
| 898 | Ga0068871_101225643 | |||
| 899 | Ga0075433_10014776 | |||
| 900 | Ga0075434_100003308 | |||
| 901 | Ga0068865_100213802 | |||
| 902 | Ga0075436_100241875 | |||
| 903 | Ga0075435_100015837 | |||
| 904 | Ga0105240_10082546 | |||
| 905 | Ga0105240_10203145 | |||
| 906 | Ga0105240_10361031 | |||
| 907 | Ga0105240_10429504 | |||
| 908 | Ga0105240_10893224 | |||
| 909 | Ga0105240_11096749 | |||
| 910 | Ga0105240_11341034 | |||
| 911 | Ga0105245_10916525 | |||
| 912 | Ga0105243_10087554 | |||
| 913 | Ga0105241_10079979 | |||
| 914 | Ga0105241_10325800 | |||
| 915 | Ga0105241_10572599 | |||
| 916 | Ga0105241_10901362 | |||
| 917 | Ga0105242_10011407 | |||
| 918 | Ga0105237_10048265 | |||
| 919 | Ga0105237_10118964 | |||
| 920 | Ga0105237_12321929 | |||
| 921 | Ga0105238_10010051 | |||
| 922 | Ga0105238_10025309 | |||
| 923 | Ga0105238_11143761 | |||
| 924 | Ga0105238_11260603 | |||
| 925 | Ga0105238_11656464 | |||
| 926 | Ga0105238_12075972 | |||
| 927 | Ga0105239_10422750 | |||
| 928 | Ga0105239_11352560 | |||
| 929 | Ga0105246_12026032 | |||
| 930 | Ga0157341_1047460 | |||
| 931 | Ga0157345_1007765 | |||
| 932 | Ga0157313_1033403 | |||
| 933 | Ga0157327_1066646 | |||
| 934 | Ga0157373_10194066 | |||
| 935 | Ga0157373_10617204 | |||
| 936 | Ga0157373_10934732 | |||
| 937 | Ga0157371_10509914 | |||
| 938 | Ga0157370_10058957 | |||
| 939 | Ga0157370_10142432 | |||
| 940 | Ga0157370_10197113 | |||
| 941 | Ga0157370_10252193 | |||
| 942 | Ga0157370_10301505 | |||
| 943 | Ga0157370_10640720 | |||
| 944 | Ga0157370_10668342 | |||
| 945 | Ga0157369_10019147 | |||
| 946 | Ga0157369_10056755 | |||
| 947 | Ga0157369_10118792 | |||
| 948 | Ga0157369_10125959 | |||
| 949 | Ga0157369_10372844 | |||
| 950 | Ga0157369_10422519 | |||
| 951 | Ga0157369_11715400 | |||
| 952 | Ga0157374_10074991 | |||
| 953 | Ga0157374_10870492 | |||
| 954 | Ga0157374_11205236 | |||
| 955 | Ga0157374_12101684 | |||
| 956 | Ga0157378_10335642 | |||
| 957 | Ga0157378_12418555 | |||
| 958 | Ga0157372_10061582 | |||
| 959 | Ga0157372_10080718 | |||
| 960 | Ga0157372_10284303 | |||
| 961 | Ga0157372_10308215 | |||
| 962 | Ga0157372_10450416 | |||
| 963 | Ga0157372_10787920 | |||
| 964 | Ga0157372_12321874 | |||
| 965 | Ga0157372_13022580 | |||
| 966 | Ga0157375_11082037 | |||
| 967 | Ga0163163_10739311 | |||
| 968 | Ga0182008_10876576 | |||
| 969 | Ga0157376_10857131 | |||
| 970 | Ga0197907_10173273 | |||
| 971 | Ga0197907_10339535 | |||
| 972 | Ga0197907_10507941 | |||
| 973 | Ga0197907_10595388 | |||
| 974 | Ga0197907_10962352 | |||
| 975 | Ga0197907_11119477 | |||
| 976 | Ga0206356_10578748 | |||
| 977 | Ga0206356_10635958 | |||
| 978 | Ga0206356_10856040 | |||
| 979 | Ga0206356_11498134 | |||
| 980 | Ga0206356_11830929 | |||
| 981 | Ga0206355_1008459 | |||
| 982 | Ga0206355_1041960 | |||
| 983 | Ga0206355_1099827 | |||
| 984 | Ga0206355_1537900 | |||
| 985 | Ga0206351_10843812 | |||
| 986 | Ga0206351_10991913 | |||
| 987 | Ga0206352_10020547 | |||
| 988 | Ga0206350_10753255 | |||
| 989 | Ga0206350_11127130 | |||
| 990 | Ga0206350_11135316 | |||
| 991 | Ga0206350_11574936 | |||
| 992 | Ga0206354_10295361 | |||
| 993 | Ga0206354_10981365 | |||
| 994 | Ga0206354_11022399 | |||
| 995 | Ga0206354_11045379 | |||
| 996 | Ga0206354_11235662 | |||
| 997 | Ga0206354_11282843 | |||
| 998 | Ga0206354_11650944 | |||
| 999 | Ga0206353_10455743 | |||
| 1000 | Ga0206353_11261646 | |||
| 1001 | Ga0206353_11393041 | |||
| 1002 | Ga0206353_11757796 | |||
| 1003 | Ga0206353_11925226 | |||
| 1004 | Ga0206353_11940842 | |||
| 1005 | Ga0154015_1284807 | |||
| 1006 | Ga0213876_10052936 | |||
| 1007 | Ga0224712_10009759 | |||
| 1008 | Ga0224712_10015183 | |||
| 1009 | Ga0224712_10094160 | |||
| 1010 | Ga0224712_10117194 | |||
| 1011 | Ga0224712_10199927 | |||
| 1012 | Ga0224712_10447349 | |||
| 1013 | Ga0207692_10693840 | |||
| 1014 | Ga0207647_10437919 | |||
| 1015 | Ga0207699_10248472 | |||
| 1016 | Ga0207699_10683915 | |||
| 1017 | Ga0207705_10025343 | |||
| 1018 | Ga0207705_10084817 | |||
| 1019 | Ga0207705_10114886 | |||
| 1020 | Ga0207705_10351137 | |||
| 1021 | Ga0207705_10770780 | |||
| 1022 | Ga0207705_10808980 | |||
| 1023 | Ga0207654_10102433 | |||
| 1024 | Ga0207654_11171439 | |||
| 1025 | Ga0207707_10001354 | |||
| 1026 | Ga0207707_10003861 | |||
| 1027 | Ga0207707_10016946 | |||
| 1028 | Ga0207707_10024347 | |||
| 1029 | Ga0207707_10091058 | |||
| 1030 | Ga0207707_10165303 | |||
| 1031 | Ga0207707_10497003 | |||
| 1032 | Ga0207707_10556418 | |||
| 1033 | Ga0207707_10748804 | |||
| 1034 | Ga0207707_11428843 | |||
| 1035 | Ga0207695_10073892 | |||
| 1036 | Ga0207695_10683479 | |||
| 1037 | Ga0207695_10829146 | |||
| 1038 | Ga0207671_10067541 | |||
| 1039 | Ga0207671_10172996 | |||
| 1040 | Ga0207693_10015541 | |||
| 1041 | Ga0207693_10202083 | |||
| 1042 | Ga0207693_10215668 | |||
| 1043 | Ga0207663_10171611 | |||
| 1044 | Ga0207663_10396673 | |||
| 1045 | Ga0207660_10087942 | |||
| 1046 | Ga0207660_10098842 | |||
| 1047 | Ga0207660_10221339 | |||
| 1048 | Ga0207660_10338052 | |||
| 1049 | Ga0207660_10353224 | |||
| 1050 | Ga0207660_10701571 | |||
| 1051 | Ga0207657_10000184 | |||
| 1052 | Ga0207657_10001572 | |||
| 1053 | Ga0207657_10002804 | |||
| 1054 | Ga0207657_10004538 | |||
| 1055 | Ga0207657_10104909 | |||
| 1056 | Ga0207657_10293935 | |||
| 1057 | Ga0207657_10488861 | |||
| 1058 | Ga0207657_11215560 | |||
| 1059 | Ga0207649_10008750 | |||
| 1060 | Ga0207649_10023639 | |||
| 1061 | Ga0207649_10064842 | |||
| 1062 | Ga0207649_10817973 | |||
| 1063 | Ga0207649_11156358 | |||
| 1064 | Ga0207652_10077744 | |||
| 1065 | Ga0207652_10097916 | |||
| 1066 | Ga0207652_10617958 | |||
| 1067 | Ga0207652_10656338 | |||
| 1068 | Ga0207652_11280008 | |||
| 1069 | Ga0207646_10323864 | |||
| 1070 | Ga0207694_10178276 | |||
| 1071 | Ga0207694_10243785 | |||
| 1072 | Ga0207694_10795746 | |||
| 1073 | Ga0207694_11197508 | |||
| 1074 | Ga0207687_10475144 | |||
| 1075 | Ga0207687_11289182 | |||
| 1076 | Ga0207700_10610889 | |||
| 1077 | Ga0207700_11022002 | |||
| 1078 | Ga0207664_10535467 | |||
| 1079 | Ga0207664_10793434 | |||
| 1080 | Ga0207664_10966736 | |||
| 1081 | Ga0207664_11178669 | |||
| 1082 | Ga0207664_11213525 | |||
| 1083 | Ga0207664_11406286 | |||
| 1084 | Ga0207644_10410483 | |||
| 1085 | Ga0207644_10490064 | |||
| 1086 | Ga0207690_10512668 | |||
| 1087 | Ga0207690_10556242 | |||
| 1088 | Ga0207690_11633012 | |||
| 1089 | Ga0207690_11736351 | |||
| 1090 | Ga0207686_10009407 | |||
| 1091 | Ga0207709_10089900 | |||
| 1092 | Ga0207704_10976964 | |||
| 1093 | Ga0207665_10138695 | |||
| 1094 | Ga0207665_10548902 | |||
| 1095 | Ga0207665_11320273 | |||
| 1096 | Ga0207661_10067685 | |||
| 1097 | Ga0207661_11187382 | |||
| 1098 | Ga0207661_11389091 | |||
| 1099 | Ga0207667_10147866 | |||
| 1100 | Ga0207667_10264338 | |||
| 1101 | Ga0207667_10407958 | |||
| 1102 | Ga0207667_10412065 | |||
| 1103 | Ga0207667_11630797 | |||
| 1104 | Ga0207668_11318868 | |||
| 1105 | Ga0207640_10252006 | |||
| 1106 | Ga0207640_11280639 | |||
| 1107 | Ga0207658_10043523 | |||
| 1108 | Ga0207639_10220297 | |||
| 1109 | Ga0207639_10544732 | |||
| 1110 | Ga0207678_10468505 | |||
| 1111 | Ga0207678_10728952 | |||
| 1112 | Ga0207702_10033479 | |||
| 1113 | Ga0207702_10161198 | |||
| 1114 | Ga0207702_10579234 | |||
| 1115 | Ga0207702_11154557 | |||
| 1116 | Ga0207674_10036719 | |||
| 1117 | Ga0207674_10373780 | |||
| 1118 | Ga0207683_10227739 | |||
| 1119 | Ga0207683_10229143 | |||
| 1120 | Ga0207698_10278857 | |||
| 1121 | Ga0207698_12210285 | |||
| 1122 | Ga0268266_10321005 | |||
| 1123 | Ga0265318_10030206 | |||
| 1124 | Ga0265318_10306429 | |||
| 1125 | Ga0265323_10096894 | |||
| 1126 | Ga0265322_10003676 | |||
| 1127 | Ga0265322_10026563 | |||
| 1128 | Ga0265338_10040828 | |||
| 1129 | Ga0265338_10306688 | |||
| 1130 | Ga0265324_10112656 | |||
| 1131 | Ga0265330_10017267 | |||
| 1132 | Ga0265328_10063286 | |||
| 1133 | Ga0265320_10115550 | |||
| 1134 | Ga0265325_10009990 | |||
| 1135 | Ga0265329_10020381 | |||
| 1136 | Ga0265340_10118416 | |||
| 1137 | Ga0265340_10561742 | |||
| 1138 | Ga0265339_10087142 | |||
| 1139 | Ga0265331_10191876 | |||
| 1140 | Ga0265327_10079025 | |||
| 1141 | Ga0265327_10175506 | |||
| 1142 | Ga0265327_10291637 | |||
| 1143 | Ga0265316_10009291 | |||
| 1144 | Ga0265313_10005258 | |||
| 1145 | Ga0265314_10010364 | |||
| 1146 | Ga0265342_10012054 | |||
| 1147 | Ga0307405_10143198 | |||
| 1148 | Ga0307409_100150263 | |||
| 1149 | Ga0307416_100079822 | |||
| 1150 | Ga0373934_0157584 | |||
| 1151 | Ga0373944_0018016 | |||
| 1152 | Ga0373923_0286885 | |||
| 1153 | Ga0373936_0065108 | |||
| 1154 | Ga0373936_0434312 | |||
| 1155 | Ga0373945_0003252 | |||
| 1156 | Ga0373953_0199303 | |||
| 1157 | Ga0373943_0002483 | |||
| 1158 | Ga0373946_0003171 | |||
| 1159 | Ga0373955_0081658 | |||
| 1160 | Ga0373955_0183070 | |||
| 1161 | Ga0373935_0005754 | |||
| 1162 | Ga0373927_0050966 | |||
| 1163 | Ga0373933_0147766 | |||
| 1164 | Ga0373933_0848125 | |||
| 1165 | Ga0373947_0008338 | |||
| 1166 | Ga0373947_1065119 | |||
| 1167 | Ga0373937_0420027 | |||
| 1168 | Ga0373937_1003071 | |||
| 1169 | Ga0373925_0001472 | |||
| 1170 | Ga0395899_0118452 | |||
| 1171 | Ga0395899_0123052 | |||
| 1172 | Ga0395899_0153618 | |||
| 1173 | Ga0395899_0242192 | |||
| 1174 | Ga0395899_0407412 | |||
| 1175 | Ga0395899_0733235 | |||
| 1176 | Ga0395899_0755134 | |||
| 1177 | Ga0395899_0758429 | |||
| 1178 | Ga0395900_0005432 | |||
| 1179 | Ga0395900_0006090 | |||
| 1180 | Ga0395900_0013485 | |||
| 1181 | Ga0395900_0046484 | |||
| 1182 | Ga0395900_0101632 | |||
| 1183 | Ga0395900_0111471 | |||
| 1184 | Ga0395900_0115035 | |||
| 1185 | Ga0395900_0129398 | |||
| 1186 | Ga0395900_0164769 | |||
| 1187 | Ga0395900_0281025 | |||
| 1188 | Ga0395900_0388603 | |||
| 1189 | Ga0395900_0496831 | |||
| 1190 | Ga0395900_0520845 | |||
| 1191 | Ga0395900_0671684 | |||
| 1192 | Ga0395900_0817539 | |||
| 1193 | Ga0395900_0856429 | |||
| 1194 | Ga0395900_1357843 | |||
| 1195 | Ga0395900_1634443 | |||
| 1196 | Ga0395898_0002274 | |||
| 1197 | Ga0395898_0015457 | |||
| 1198 | Ga0395898_0041314 | |||
| 1199 | Ga0395898_0119368 | |||
| 1200 | Ga0395898_0223119 | |||
| 1201 | Ga0395898_0413096 | |||
| 1202 | Ga0395898_0428594 | |||
| 1203 | Ga0395898_0468980 | |||
| 1204 | Ga0395898_0475411 | |||
| 1205 | Ga0395898_0503656 | |||
| 1206 | Ga0395898_0864451 | |||
| 1207 | Ga0395905_0012897 | |||
| 1208 | Ga0395905_0020154 | |||
| 1209 | Ga0395905_0062674 | |||
| 1210 | Ga0395905_0114585 | |||
| 1211 | Ga0395905_0263099 | |||
| 1212 | Ga0395905_0847326 | |||
| 1213 | Ga0395905_1223801 | |||
| 1214 | Ga0395905_1259727 | |||
| 1215 | Ga0395905_1700007 | |||
| 1216 | Ga0436364_1307196 | |||
| 1217 | Ga0395901_0001441 | |||
| 1218 | Ga0395901_0004815 | |||
| 1219 | Ga0395901_0014173 | |||
| 1220 | Ga0395901_0048801 | |||
| 1221 | Ga0395901_0061820 | |||
| 1222 | Ga0395901_0082175 | |||
| 1223 | Ga0395901_0119973 | |||
| 1224 | Ga0395901_0148116 | |||
| 1225 | Ga0395901_0154532 | |||
| 1226 | Ga0395901_0310439 | |||
| 1227 | Ga0395901_0734159 | |||
| 1228 | Ga0395901_1032823 | |||
| 1229 | Ga0395901_1366349 | |||
| 1230 | Ga0436365_0144409 | |||
| 1231 | Ga0436365_0530545 | |||
| 1232 | Ga0436365_0773939 | |||
| 1233 | Ga0436363_0317241 | |||
| 1234 | Ga0439448_0029464 | |||
| 1235 | Ga0466969_0049365 | |||
| 1236 | Ga0466969_0191715 | |||
| 1237 | Ga0466972_0345183 | |||
| 1238 | Ga0466972_0619788 | |||
| 1239 | Ga0466965_0347708 | |||
| 1240 | Ga0466965_0910036 | |||
| 1241 | Ga0466966_0003956 | |||
| 1242 | Ga0466966_0092315 | |||
| 1243 | Ga0466966_0161099 | |||
| 1244 | Ga0466961_0005996 | |||
| 1245 | Ga0466961_0009382 | |||
| 1246 | Ga0466961_0040073 | |||
| 1247 | Ga0466961_0121235 | |||
| 1248 | Ga0466961_0154213 | |||
| 1249 | Ga0466961_0339247 | |||
| 1250 | Ga0466963_0002420 | |||
| 1251 | Ga0466963_0036624 | |||
| 1252 | Ga0466963_0048450 | |||
| 1253 | Ga0466963_0048828 | |||
| 1254 | Ga0466963_0050262 | |||
| 1255 | Ga0466963_0111156 | |||
| 1256 | Ga0466963_0123051 | |||
| 1257 | Ga0466963_0140991 | |||
| 1258 | Ga0466963_0213584 | |||
| 1259 | Ga0466963_0308607 | |||
| 1260 | Ga0466963_0407045 | |||
| 1261 | Ga0466963_0413136 | |||
| 1262 | Ga0466963_0799166 | |||
| 1263 | Ga0466963_0985788 | |||
| 1264 | Ga0466964_0008370 | |||
| 1265 | Ga0466964_0010031 | |||
| 1266 | Ga0466964_0062450 | |||
| 1267 | Ga0466964_0070953 | |||
| 1268 | Ga0466964_0213944 | |||
| 1269 | Ga0466971_0004353 | |||
| 1270 | Ga0466971_0290709 | |||
| 1271 | Ga0466968_0044226 | |||
| 1272 | Ga0466968_0200168 | |||
| 1273 | Ga0466968_0243037 | |||
| 1274 | Ga0466968_0398511 | |||
| 1275 | Ga0466970_0030291 | |||
| 1276 | Ga0466957_0028618 | |||
| 1277 | Ga0466957_0057833 | |||
| 1278 | Ga0466957_0199668 | |||
| 1279 | Ga0466957_0469450 | |||
| 1280 | Ga0466957_0567306 | |||
| 1281 | Ga0466957_1371614 | |||
| 1282 | Ga0466960_0267229 | |||
| 1283 | Ga0466960_0365526 | |||
| 1284 | Ga0466959_0004643 | |||
| 1285 | Ga0466959_0119436 | |||
| 1286 | Ga0466959_0121851 | |||
| 1287 | Ga0466959_0180890 | |||
| 1288 | Ga0466959_1111574 | |||
| 1289 | Ga0466958_0030145 | |||
| 1290 | Ga0466958_0032559 | |||
| 1291 | Ga0466958_0102735 | |||
| 1292 | Ga0466958_0118664 | |||
| 1293 | Ga0466958_0843850 | |||
| 1294 | Ga0466967_0001018 | |||
| 1295 | Ga0466967_0006225 | |||
| 1296 | Ga0466967_0008898 | |||
| 1297 | Ga0466967_0009339 | |||
| 1298 | Ga0466967_0012715 | |||
| 1299 | Ga0466967_0015795 | |||
| 1300 | Ga0466967_0023579 | |||
| 1301 | Ga0466967_0035858 | |||
| 1302 | Ga0466967_0038570 | |||
| 1303 | Ga0466967_0092462 | |||
| 1304 | Ga0466967_0108255 | |||
| 1305 | Ga0466967_0124407 | |||
| 1306 | Ga0466967_0159375 | |||
| 1307 | Ga0466967_0419313 | |||
| 1308 | Ga0466967_0437852 | |||
| 1309 | Ga0466967_0450127 | |||
| 1310 | Ga0466967_0471596 | |||
| 1311 | Ga0466967_0476334 | |||
| 1312 | Ga0466967_0617821 | |||
| 1313 | Ga0466967_0718192 | |||
| 1314 | Ga0466967_1028857 | |||
| 1315 | Ga0466967_1146669 | |||
| 1316 | Ga0466967_1557542 | |||
| 1317 | Ga0466967_2236100 | |||
| 1318 | Ga0495592_0035896 | |||
| 1319 | Ga0495592_0125821 | |||
| 1320 | Ga0495592_0827436 | |||
| 1321 | Ga0495603_0299684 | |||
| 1322 | Ga0495629_0001380 | |||
| 1323 | Ga0495629_0753429 | |||
| 1324 | Ga0495629_1060800 | |||
| 1325 | Ga0495641_0000416 | |||
| 1326 | Ga0495651_0010678 | |||
| 1327 | Ga0495651_0180087 | |||
| 1328 | Ga0495651_0212792 | |||
| 1329 | Ga0495653_0035409 | |||
| 1330 | Ga0495653_0056042 | |||
| 1331 | Ga0495653_0181718 | |||
| 1332 | Ga0495580_0151672 | |||
| 1333 | Ga0495582_0000789 | |||
| 1334 | Ga0495582_0057747 | |||
| 1335 | Ga0495582_0232719 | |||
| 1336 | Ga0495605_0131826 | |||
| 1337 | Ga0495639_0000578 | |||
| 1338 | Ga0495662_0005764 | |||
| 1339 | Ga0495594_0022153 | |||
| 1340 | Ga0495608_0024723 | |||
| 1341 | Ga0495608_0040891 | |||
| 1342 | Ga0495608_0163904 | |||
| 1343 | Ga0495608_0622100 | |||
| 1344 | Ga0495618_0143557 | |||
| 1345 | Ga0495618_0222182 | |||
| 1346 | Ga0495628_0041030 | |||
| 1347 | Ga0495628_0097439 | |||
| 1348 | Ga0495628_0213840 | |||
| 1349 | Ga0495630_0002325 | |||
| 1350 | Ga0495630_0018155 | |||
| 1351 | Ga0495630_1067053 | |||
| 1352 | Ga0495666_0011112 | |||
| 1353 | Ga0495652_0121723 | |||
| 1354 | Ga0495652_0130168 | |||
| 1355 | Ga0495652_0358173 | |||
| 1356 | Ga0495665_0003246 | |||
| 1357 | Ga0495640_0130128 | |||
| 1358 | Ga0495640_0437820 | |||
| 1359 | Ga0495640_0718504 | |||
| 1360 | Ga0495586_0915817 | |||
| 1361 | Ga0495587_0040358 | |||
| 1362 | Ga0495587_0112719 | |||
| 1363 | Ga0495587_0146927 | |||
| 1364 | Ga0495645_0035525 | |||
| 1365 | Ga0495645_0329754 | |||
| 1366 | Ga0495667_0074224 | |||
| 1367 | Ga0495667_0621883 | |||
| 1368 | Ga0495667_0885941 | |||
| 1369 | Ga0495634_0063605 | |||
| 1370 | Ga0495635_0029513 | |||
| 1371 | Ga0495635_0226529 | |||
| 1372 | Ga0495588_0601541 | |||
| 1373 | Ga0495657_0219074 | |||
| 1374 | Ga0495657_0228665 | |||
| 1375 | Ga0495657_0337764 | |||
| 1376 | Ga0495657_0840074 | |||
| 1377 | Ga0495599_0354271 | |||
| 1378 | Ga0495599_0582722 | |||
| 1379 | Ga0495599_0807753 | |||
| 1380 | Ga0495623_0274003 | |||
| 1381 | Ga0495646_0062288 | |||
| 1382 | Ga0495647_0006761 | |||
| 1383 | Ga0495658_0000132 | |||
| 1384 | Ga0495658_0320046 | |||
| 1385 | Ga0495613_0004012 | |||
| 1386 | Ga0495624_0300126 | |||
| 1387 | Ga0495624_0383471 | |||
| 1388 | Ga0495649_0556527 | |||
| 1389 | Ga0495600_0040635 | |||
| 1390 | Ga0495600_0479768 | |||
| 1391 | Ga0495581_0001376 | |||
| 1392 | Ga0495604_0181196 | |||
| 1393 | Ga0495604_0265292 | |||
| 1394 | Ga0495674_0019479 | |||
| 1395 | Ga0495674_0044638 | |||
| 1396 | Ga0495674_0246689 | |||
| 1397 | Ga0495674_0668644 | |||
| 1398 | Ga0495674_1176040 | |||
| 1399 | Ga0495676_0002345 | |||
| 1400 | Ga0495680_0026108 | |||
| 1401 | Ga0495680_0028649 | |||
| 1402 | Ga0495680_0604821 | |||
| 1403 | Ga0495675_0232018 | |||
| 1404 | Ga0495675_0635373 | |||
| 1405 | Ga0495684_0005676 | |||
| 1406 | Ga0495684_0048709 | |||
| 1407 | Ga0495684_0344962 | |||
| 1408 | Ga0495684_0434188 | |||
| 1409 | Ga0495602_0046988 | |||
| 1410 | Ga0495602_0127896 | |||
| 1411 | Ga0495602_0995310 | |||
| 1412 | Ga0495614_0002864 | |||
| 1413 | Ga0496100_0000648 | |||
| 1414 | Ga0496100_0048836 | |||
| 1415 | Ga0496100_0059199 | |||
| 1416 | Ga0496100_0105108 | |||
| 1417 | Ga0496100_0309614 | |||
| 1418 | Ga0496101_0011052 | |||
| 1419 | Ga0496101_0024175 | |||
| 1420 | Ga0496101_0071232 | |||
| 1421 | Ga0496101_0097899 | |||
| 1422 | Ga0496102_0002063 | |||
| 1423 | Ga0496102_0050984 | |||
| 1424 | Ga0496102_0528552 | |||
| 1425 | Ga0496102_1371433 | |||
| 1426 | Ga0496102_1472975 | |||
| 1427 | Ga0496103_0115361 | |||
| 1428 | Ga0496103_0127809 | |||
| 1429 | Ga0496103_0320408 | |||
| 1430 | Ga0496103_0490921 | |||
| 1431 | Ga0496104_0028803 | |||
| 1432 | Ga0496104_0242461 | |||
| 1433 | Ga0496105_1111542 | |||
| 1434 | Ga0496106_0000263 | |||
| 1435 | Ga0496106_0038704 | |||
| 1436 | Ga0496106_0275501 | |||
| 1437 | Ga0496106_1300340 | |||
| 1438 | Ga0496107_0000712 | |||
| 1439 | Ga0496107_0012908 | |||
| 1440 | Ga0496107_0852532 | |||
| 1441 | Ga0496108_0001638 | |||
| 1442 | Ga0496108_0580992 | |||
| 1443 | Ga0496108_1049268 | |||
| 1444 | Ga0496109_0006975 | |||
| 1445 | Ga0496109_0633258 | |||
| 1446 | Ga0496109_1045894 | |||
| 1447 | Ga0496109_1381779 | |||
| 1448 | Ga0496110_0003901 | |||
| 1449 | Ga0496111_0046319 | |||
| 1450 | Ga0496112_0003739 | |||
| 1451 | Ga0496112_0008367 | |||
| 1452 | Ga0496112_0156915 | |||
| 1453 | Ga0496112_0157368 | |||
| 1454 | Ga0496112_0256465 | |||
| 1455 | Ga0496113_0243256 | |||
| 1456 | Ga0496113_1238163 | |||
| 1457 | Ga0496114_0000444 | |||
| 1458 | Ga0496114_0024082 | |||
| 1459 | Ga0496114_0086660 | |||
| 1460 | Ga0496114_0388756 | |||
| 1461 | Ga0496114_1221790 | |||
| 1462 | Ga0496115_0000415 | |||
| 1463 | Ga0496115_0048637 | |||
| 1464 | Ga0496115_0080482 | |||
| 1465 | Ga0496115_0125145 | |||
| 1466 | Ga0496115_0698938 | |||
| 1467 | Ga0496115_0708446 | |||
| 1468 | Ga0501032_0861741 | |||
| 1469 | Ga0501047_0105162 | |||
| 1470 | Ga0501047_0133936 | |||
| 1471 | Ga0501047_0234308 | |||
| 1472 | Ga0501067_0000797 | |||
| 1473 | Ga0501069_0016886 | |||
| 1474 | Ga0501069_0058400 | |||
| 1475 | Ga0501069_0065613 | |||
| 1476 | Ga0501069_0128368 | |||
| 1477 | Ga0501070_0000104 | |||
| 1478 | Ga0501070_0008488 | |||
| 1479 | Ga0501070_0132164 | |||
| 1480 | Ga0501070_0196367 | |||
| 1481 | Ga0501070_0298413 | |||
| 1482 | Ga0501070_1082015 | |||
| 1483 | Ga0501070_1548790 | |||
| 1484 | Ga0501073_0473153 | |||
| 1485 | Ga0501074_0087182 | |||
| 1486 | Ga0501074_0221743 | |||
| 1487 | Ga0501074_0482192 | |||
| 1488 | Ga0501074_0798298 | |||
| 1489 | Ga0501080_0076970 | |||
| 1490 | Ga0501080_0135077 | |||
| 1491 | Ga0501080_0822349 | |||
| 1492 | Ga0501080_0831378 | |||
| 1493 | Ga0501083_0107396 | |||
| 1494 | Ga0501035_0735087 | |||
| 1495 | Ga0501044_0425251 | |||
| 1496 | Ga0501044_0882832 | |||
| 1497 | nmdc:mga0n895_8675_c1 | |||
| 1498 | nmdc:mga0rr50_5288_c1 | |||
| 1499 | nmdc:mga0a205_98546_c1 | |||
| 1500 | Ga0495601_0005477 | |||
| 1501 | Ga0495601_0026953 | |||
| 1502 | Ga0495601_0097224 | |||
| 1503 | Ga0495601_0762136 | |||
| 1504 | Ga0495612_0021465 | |||
| 1505 | Ga0495612_0043849 | |||
| 1506 | Ga0495655_0036834 | |||
| 1507 | Ga0495595_0020888 | |||
| 1508 | Ga0495595_0054083 | |||
| 1509 | Ga0495619_0002519 | |||
| 1510 | Ga0495619_0003695 | |||
| 1511 | Ga0495619_0411793 | |||
| 1512 | Ga0495619_0622602 | |||
| 1513 | Ga0587093_027123 | |||
| 1514 | Ga0587066_006475 | |||
| 1515 | Ga0587082_038018 | |||
| 1516 | Ga0587130_034850 | |||
| 1517 | Ga0466962_0000342 | |||
| 1518 | Ga0466962_0204026 | |||
| 1519 | Ga0466962_0390725 | |||
| 1520 | Ga0530510_0196621 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zhz-assembly1.cif.gz_C | crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis | 0.7817 | 48 | 75 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.752 | 9 | 73 |
| 5wur-assembly1.cif.gz_C | crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form | 0.7468 | 9 | 73 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.7264 | 12 | 66 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.7027 | 9 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7264 | 12 | 66 | 1.10.10.1320 |
| 3hugP00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6954 | 11 | 69 | 1.10.10.1320 |
| 3hugJ00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6798 | 10 | 64 | 1.10.10.1320 |
| 3hugH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6728 | 10 | 72 | 1.10.10.1320 |
| 3hugT00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.668 | 10 | 73 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9KL94-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.9616 | 8 | 59 |
GO:0003677
GO:0006352 GO:0016020 GO:0016987 |
| AF-E8V6V9-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.9444 | 8 | 65 |
GO:0016020
|
| AF-I3ZD40-F1-model_v4 | Zinc-finger | 0.9425 | 8 | 65 |
GO:0016020
|
| AF-A0A3M1DYR8-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.9206 | 6 | 62 |
GO:0016020
|
| AF-E8X1L6-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.9126 | 8 | 65 |
|