F479513

General Info

Members Datasets Scaffolds Average Seq Length
760 576 397 113

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101127111|Ga0070660_1011271112
Length 113
Sequence MISNVFQYVAGGLLVLGACFSLLAALGLLRFPDLYTRLHAATKAGTVGAGFVLLAIAFASFDLSVSLRAIGGVAFIILTSPIAAHLLARAAYLSGEHPSNITVVNELENEKQG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
16 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
17 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
20 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
23 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
27 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
33 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
34 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
35 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
36 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
37 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
40 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
41 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
42 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
43 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
44 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
45 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
46 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
47 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
48 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
49 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
50 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
51 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
52 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
53 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
54 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
55 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
56 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
57 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
58 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
59 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
60 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
61 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
62 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
63 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
64 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
65 2643221557 Ensifer sp. Root558 Isolate Unclassified
66 2643221582 Rhizobium sp. Root651 Isolate Unclassified
67 2643221610 Ensifer sp. Root74 Isolate Unclassified
68 2643221629 Devosia sp. Root105 Isolate Unclassified
69 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
70 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
71 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
72 2643221662 Devosia sp. Root413D1 Isolate Unclassified
73 2643221668 Ensifer sp. Root423 Isolate Unclassified
74 2643221675 Ensifer sp. Root1298 Isolate Unclassified
75 2643221680 Ensifer sp. Root1312 Isolate Unclassified
76 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
77 2643221693 Rhizobium sp. Root491 Isolate Unclassified
78 2643221719 Rhizobium sp. Root274 Isolate Unclassified
79 2643221726 Ensifer sp. Root954 Isolate Unclassified
80 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
81 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
82 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
83 2718217927 Rhizobium sp. N324 Isolate Nodule
84 2718218423 Rhizobium sp. N941 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
87 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
88 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
89 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
90 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
91 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
92 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
93 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
94 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
95 2791355266 Rhizobium sp. L43 Isolate Nodule
96 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
97 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
98 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
99 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
100 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
101 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
102 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
103 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
104 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
105 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
106 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
107 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
108 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
109 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
110 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
111 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
112 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
113 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
114 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
115 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
116 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
117 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
118 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
119 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
120 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
121 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
122 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
123 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
124 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
125 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
126 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
127 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
128 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
129 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
130 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
131 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
132 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
133 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
134 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
135 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
136 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
137 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
138 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
139 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
140 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
141 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
142 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
143 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
144 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
145 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
146 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
147 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
148 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
149 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
150 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
151 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
152 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
153 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
154 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
155 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
156 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
157 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
158 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
159 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
160 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
161 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
162 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
163 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
164 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
165 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
166 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
167 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
168 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
169 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
170 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
171 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
172 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
173 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
174 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
175 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
176 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
177 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
178 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
179 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
180 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
181 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
182 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
183 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
184 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
185 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
186 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
187 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
188 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
189 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
190 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
191 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
192 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
193 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
194 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
195 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
196 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
197 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
198 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
199 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
200 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
201 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
202 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
203 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
204 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
205 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
206 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
207 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
208 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
209 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
210 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
211 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
212 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
213 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
214 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
215 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
216 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
217 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
218 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
219 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
220 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
221 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
222 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
223 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
224 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
225 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
226 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
227 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
228 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
229 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
230 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
231 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
232 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
233 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
234 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
235 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
236 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
237 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
238 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
239 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
240 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
241 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
242 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
243 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
244 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
245 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
246 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
247 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
248 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
249 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
250 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
251 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
252 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
253 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
254 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
255 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
256 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
257 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
258 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
259 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
260 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
261 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
262 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
263 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
264 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
265 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
266 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
267 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
268 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
269 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
270 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
271 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
272 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
273 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
274 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
275 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
276 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
277 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
278 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
279 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
280 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
281 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
282 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
283 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
284 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
285 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
286 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
287 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
288 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
289 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
290 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
291 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
292 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
293 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
294 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
295 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
296 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
297 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
298 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
299 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
300 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
301 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
302 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
303 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
304 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
305 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
306 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
307 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
308 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
309 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
310 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
311 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
312 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
313 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
314 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
315 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
316 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
317 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
318 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
319 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
320 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
321 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
322 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
323 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
324 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
325 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
326 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
327 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
328 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
329 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
330 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
331 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
332 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
333 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
334 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
335 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
336 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
337 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
338 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
339 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
340 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
341 2996893221 Rhizobium sp. R635 Isolate Nodule
342 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
343 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
344 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
345 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
346 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
347 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
348 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
349 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
350 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
351 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
352 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
353 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
354 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
355 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
356 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
357 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
358 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
359 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
360 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
361 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
362 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
363 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
364 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
365 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
366 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
367 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
368 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
369 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
370 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
371 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
372 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
373 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
374 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
375 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
376 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
377 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
378 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
379 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
380 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
381 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
382 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
383 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
384 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
385 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
386 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
387 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
388 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
389 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
390 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
391 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
392 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
393 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
394 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
395 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
396 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
397 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
398 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
399 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
400 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
401 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
402 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
403 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
404 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
405 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
406 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
407 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
408 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
409 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
410 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
411 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
412 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
413 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
414 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
415 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
416 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
417 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
418 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
421 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
422 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
423 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
426 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
428 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
430 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
432 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
433 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
446 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
448 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
449 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
452 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
453 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
454 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
455 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
456 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
457 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
458 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
459 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
460 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
461 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
462 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
463 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
464 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
465 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
466 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
467 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
468 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
469 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
470 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
471 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
472 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
473 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
474 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
475 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
476 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
477 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
478 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
479 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
480 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
481 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
482 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
483 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
484 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
485 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
486 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
487 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
488 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
489 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
490 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
491 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
494 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
495 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
496 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
497 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
498 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
499 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
500 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
501 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
502 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
503 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
504 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
505 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
506 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
507 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
508 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
509 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
510 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
511 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
512 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
513 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
514 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
515 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
516 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
517 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
518 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
519 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
520 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
521 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
522 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
523 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
524 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
525 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
529 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
530 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
531 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
532 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
534 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
535 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
536 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
537 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
538 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
539 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
540 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
541 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
542 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
543 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
544 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
545 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
546 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
547 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
548 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
549 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
550 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
551 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
552 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
553 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
554 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
555 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
556 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
557 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
558 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
559 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
560 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
561 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
562 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
563 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
564 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
565 8005275841 Rhizobium sp. N4311 Isolate Nodule
566 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
567 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
568 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
569 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
570 8018176218 Rhizobium sp. N122 Isolate Nodule
571 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
572 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
573 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
574 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
575 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
576 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.24
Metatranscriptomes 0
Isolates 47.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 17.89
Nodule 37.11
Rhizoplane 1.45
Rhizosphere 25.66
Stem 0
Stem Tuber 0
Unclassified 17.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001010 3300001979 Bacteria 12579
2 JGI25155J39150_1000089 3300002704 Bacteria 51946
3 JGI25156J39149_1000147 3300002705 Bacteria 51946
4 JGI25162J39368_1000243 3300002737 Bacteria 54503
5 JGI25162J39368_1000372 3300002737 Bacteria 38119
6 JGI25154J39366_1000160 3300002738 Bacteria 51946
7 JGI25158J39367_1027174 3300002739 Bacteria 665
8 JGI25157J39369_1000190 3300002741 Bacteria 51946
9 JGI25152J39213_1041177 3300002773 Bacteria 647
10 JGI25150J39212_1002531 3300002774 Bacteria 4512
11 JGI25159J45721_1003582 3300002987 Bacteria 5436
12 JGI25159J45721_1006118 3300002987 Bacteria 3652
13 JGI25151J46595_10005934 3300003187 Bacteria 6231
14 JGI25151J46595_10019059 3300003187 Bacteria 2927
15 JGI25165J46597_1000318 3300003214 Bacteria 57977
16 JGI25165J46597_1000413 3300003214 Bacteria 44960
17 JGI25165J46597_1002553 3300003214 Bacteria 5655
18 JGI25153J46596_10042234 3300003215 Bacteria 1393
19 JGI25153J46596_10107109 3300003215 Bacteria 647
20 JGI25153J46596_10107143 3300003215 Bacteria 647
21 rootH1_10030544 3300003316 Bacteria 2780
22 rootH1_10156606 3300003316 Bacteria 1528
23 rootH2_10130100 3300003320 Bacteria 2125
24 rootH2_10285524 3300003320 Bacteria 1086
25 rootL2_10020846 3300003322 Bacteria 7936
26 rootL2_10021533 3300003322 Bacteria 1579
27 rootL2_10076125 3300003322 Bacteria 1034
28 rootH1_10055995 3300003323 Bacteria 4097
29 rootH1_10281976 3300003323 Bacteria 1154
30 JGI25160J50197_1000047 3300003354 Bacteria 136499
31 JGI25160J50197_1008481 3300003354 Bacteria 3911
32 JGI25160J50197_1060739 3300003354 Bacteria 756
33 JGI25161J50226_1000033 3300003374 Bacteria 136499
34 JGI25161J50226_1000190 3300003374 Bacteria 39988
35 Ga0055539_1008530 3300003752 Bacteria 1281
36 Ga0055526_1000512 3300003771 Bacteria 30921
37 Ga0055524_1008154 3300003775 Bacteria 4377
38 Ga0055536_1009412 3300003781 Bacteria 4039
39 Ga0055528_1009002 3300003790 Bacteria 4213
40 Ga0055530_10010080 3300003791 Bacteria 3544
41 Ga0055540_1002220 3300003792 Bacteria 10537
42 Ga0055540_1026826 3300003792 Bacteria 1388
43 Ga0055540_1085977 3300003792 Bacteria 598
44 Ga0055531_10002384 3300003794 Bacteria 12627
45 Ga0055531_10075456 3300003794 Bacteria 761
46 Ga0058692_1002068 3300003856 Bacteria 6920
47 Ga0058692_1005061 3300003856 Bacteria 3802
48 Ga0055543_1000075 3300004625 Bacteria 87163
49 Ga0055543_1000115 3300004625 Bacteria 68252
50 Ga0065165_1000227 3300005262 Bacteria 98928
51 Ga0065165_1036195 3300005262 Bacteria 1508
52 Ga0065165_1083243 3300005262 Bacteria 826
53 Ga0070660_101127111 3300005339 Unclassified 664
54 Ga0070668_100463199 3300005347 Bacteria 1092
55 Ga0070669_100072844 3300005353 Bacteria 2544
56 Ga0070669_100217048 3300005353 Bacteria 1511
57 Ga0070665_100001300 3300005548 Bacteria 29889
58 Ga0070665_100034062 3300005548 Bacteria 5122
59 Ga0070665_100138823 3300005548 Bacteria 2434
60 Ga0070665_100207161 3300005548 Bacteria 1962
61 Ga0070665_102483401 3300005548 Bacteria 520
62 Ga0068856_100043734 3300005614 Bacteria 4406
63 Ga0068856_100785705 3300005614 Bacteria 972
64 Ga0068852_100123018 3300005616 Bacteria 2378
65 Ga0068852_102831669 3300005616 Bacteria 503
66 Ga0068851_10074413 3300005834 Bacteria 1763
67 Ga0068862_102027788 3300005844 Bacteria 586
68 Ga0075365_10111055 3300006038 Bacteria 1884
69 Ga0075365_10182342 3300006038 Bacteria 1468
70 Ga0075368_10022854 3300006042 Bacteria 2383
71 Ga0075368_10393062 3300006042 Bacteria 608
72 Ga0075364_10015347 3300006051 Bacteria 4748
73 Ga0075364_10087422 3300006051 Bacteria 2066
74 Ga0075364_10410928 3300006051 Bacteria 924
75 Ga0075362_10623112 3300006177 Bacteria 559
76 Ga0075369_10045076 3300006186 Bacteria 1895
77 Ga0075369_10210687 3300006186 Bacteria 898
78 Ga0075366_10032146 3300006195 Bacteria 3089
79 Ga0075370_10042337 3300006353 Bacteria 2573
80 Ga0075370_10370443 3300006353 Bacteria 857
81 Ga0079104_1001803 3300006946 Bacteria 13266
82 Ga0079104_1003024 3300006946 Bacteria 8254
83 Ga0099826_10000030 3300006948 Bacteria 128684
84 Ga0099826_10024903 3300006948 Bacteria 4441
85 Ga0105250_10113286 3300009092 Bacteria 1112
86 Ga0105240_10000027 3300009093 Bacteria 348486
87 Ga0105243_10091334 3300009148 Bacteria 2507
88 Ga0105243_10236332 3300009148 Bacteria 1624
89 Ga0105248_10534503 3300009177 Bacteria 1322
90 Ga0105237_10000091 3300009545 Bacteria 122477
91 Ga0105237_10001067 3300009545 Bacteria 36848
92 Ga0105238_10337348 3300009551 Bacteria 1495
93 Ga0123342_1012996 3300009766 Bacteria 8475
94 Ga0105239_10000793 3300010375 Bacteria 44855
95 Ga0105239_10013845 3300010375 Bacteria 8951
96 Ga0157373_10000402 3300013100 Bacteria 34738
97 Ga0157373_10015734 3300013100 Bacteria 5523
98 Ga0157371_10000294 3300013102 Bacteria 67172
99 Ga0157370_10000090 3300013104 Bacteria 103336
100 Ga0157370_10000223 3300013104 Bacteria 72025
101 Ga0157369_10081524 3300013105 Bacteria 3462
102 Ga0157369_10353922 3300013105 Bacteria 1525
103 Ga0157369_10354205 3300013105 Bacteria 1524
104 Ga0157372_10710546 3300013307 Bacteria 1169
105 Ga0157376_10566406 3300014969 Bacteria 1126
106 Ga0182007_10001781 3300015262 Bacteria 11243
107 Ga0182005_1001567 3300015265 Bacteria 9037
108 Ga0214542_1000010 3300021321 Bacteria 262816
109 Ga0214543_1000003 3300021327 Bacteria 692327
110 Ga0214543_1000004 3300021327 Bacteria 527190
111 Ga0228711_1000001 3300022739 Bacteria 357377
112 Ga0228710_1000001 3300022740 Bacteria 314328
113 Ga0209435_100036 3300025206 Bacteria 126970
114 Ga0209436_100060 3300025208 Bacteria 60450
115 Ga0209437_100033 3300025233 Bacteria 512520
116 Ga0209437_100036 3300025233 Bacteria 469153
117 Ga0207425_1003759 3300025245 Bacteria 4744
118 Ga0207425_1041262 3300025245 Bacteria 878
119 Ga0207425_1046250 3300025245 Bacteria 811
120 Ga0209646_1000132 3300025246 Bacteria 126859
121 Ga0209646_1017381 3300025246 Bacteria 1061
122 Ga0209026_1000313 3300025250 Bacteria 52121
123 Ga0209677_100419 3300025253 Bacteria 25164
124 Ga0209148_1050991 3300025254 Bacteria 533
125 Ga0209759_1000417 3300025256 Bacteria 52121
126 Ga0209759_1024464 3300025256 Bacteria 1308
127 Ga0209129_1014028 3300025258 Bacteria 1727
128 Ga0209129_1015629 3300025258 Bacteria 1554
129 Ga0209129_1026941 3300025258 Bacteria 988
130 Ga0209129_1042208 3300025258 Bacteria 718
131 Ga0209233_1000056 3300025261 Bacteria 438104
132 Ga0209233_1000064 3300025261 Bacteria 392156
133 Ga0209233_1000152 3300025261 Bacteria 175910
134 Ga0209565_1026616 3300025263 Bacteria 1158
135 Ga0209565_1035278 3300025263 Bacteria 955
136 Ga0209673_1001208 3300025273 Bacteria 27505
137 Ga0209130_1000015 3300025284 Bacteria 409631
138 Ga0209130_1000038 3300025284 Bacteria 264226
139 Ga0209676_1005973 3300025292 Bacteria 6155
140 Ga0209025_1000074 3300025294 Bacteria 277445
141 Ga0209025_1000080 3300025294 Bacteria 267244
142 Ga0209025_1007589 3300025294 Bacteria 8035
143 Ga0209025_1047367 3300025294 Bacteria 1756
144 Ga0209025_1048399 3300025294 Bacteria 1724
145 Ga0209564_1001322 3300025295 Bacteria 26525
146 Ga0209564_1027199 3300025295 Bacteria 1864
147 Ga0209564_1082537 3300025295 Bacteria 622
148 Ga0209758_1000121 3300025297 Bacteria 192028
149 Ga0209758_1000148 3300025297 Bacteria 166232
150 Ga0209758_1003230 3300025297 Bacteria 15149
151 Ga0209758_1004114 3300025297 Bacteria 12461
152 Ga0209758_1030705 3300025297 Bacteria 2221
153 Ga0209758_1120326 3300025297 Bacteria 710
154 Ga0209050_1003961 3300025298 Bacteria 10456
155 Ga0209256_1000351 3300025299 Bacteria 74921
156 Ga0209256_1005360 3300025299 Bacteria 7427
157 Ga0207426_1000081 3300025302 Bacteria 304502
158 Ga0207426_1000122 3300025302 Bacteria 218307
159 Ga0209051_1001973 3300025303 Bacteria 15769
160 Ga0209051_1033445 3300025303 Bacteria 1944
161 Ga0209051_1047136 3300025303 Bacteria 1475
162 Ga0209257_1009681 3300025304 Bacteria 5088
163 Ga0209257_1018905 3300025304 Bacteria 2624
164 Ga0207656_10131770 3300025321 Bacteria 1172
165 Ga0207696_1082375 3300025711 Bacteria 887
166 Ga0207695_10000024 3300025913 Bacteria 632311
167 Ga0207695_11526568 3300025913 Unclassified 548
168 Ga0207671_10000095 3300025914 Bacteria 137647
169 Ga0207671_10001277 3300025914 Bacteria 29618
170 Ga0207657_11070635 3300025919 Unclassified 617
171 Ga0207681_10058320 3300025923 Bacteria 2643
172 Ga0207681_10417706 3300025923 Bacteria 1086
173 Ga0207709_10018979 3300025935 Bacteria 3858
174 Ga0207709_10130888 3300025935 Bacteria 1710
175 Ga0207668_10394649 3300025972 Bacteria 1168
176 Ga0207640_10128218 3300025981 Bacteria 1829
177 Ga0207698_10088159 3300026142 Bacteria 2530
178 Ga0209281_1000164 3300027111 Bacteria 157372
179 Ga0209281_1000377 3300027111 Bacteria 71243
180 Ga0209371_1000009 3300027312 Bacteria 963030
181 Ga0209371_1000571 3300027312 Bacteria 33406
182 Ga0209371_1003266 3300027312 Bacteria 8052
183 Ga0209371_1031213 3300027312 Bacteria 1159
184 Ga0209282_1000007 3300027666 Bacteria 254917
185 Ga0209282_1000219 3300027666 Bacteria 29763
186 Ga0209282_1035537 3300027666 Bacteria 3017
187 Ga0209813_10013221 3300027866 Bacteria 2200
188 Ga0268266_10000417 3300028379 Bacteria 64608
189 Ga0268266_10003708 3300028379 Bacteria 15036
190 Ga0268266_10107898 3300028379 Bacteria 2463
191 Ga0268266_10135180 3300028379 Bacteria 2208
192 Ga0268265_10837677 3300028380 Bacteria 899
193 Ga0307515_10018668 3300028794 Bacteria 12526
194 Ga0268256_1000010 3300030500 Bacteria 963034
195 Ga0268256_1002974 3300030500 Bacteria 8029
196 Ga0268256_1009628 3300030500 Bacteria 3186
197 Ga0268256_1015500 3300030500 Bacteria 2221
198 Ga0268256_1035480 3300030500 Bacteria 1159
199 Ga0316182_1099944 3300030745 Bacteria 1049
200 Ga0307408_100090670 3300031548 Bacteria 2307
201 Ga0307408_101805252 3300031548 Bacteria 585
202 Ga0307405_10682941 3300031731 Bacteria 848
203 Ga0307413_10792136 3300031824 Bacteria 796
204 Ga0307410_10175831 3300031852 Bacteria 1617
205 Ga0307412_11334284 3300031911 Bacteria 647
206 Ga0315914_1000006 3300031967 Bacteria 239817
207 Ga0307409_100078385 3300031995 Bacteria 2658
208 Ga0307409_100165909 3300031995 Bacteria 1938
209 Ga0307416_100112706 3300032002 Bacteria 2401
210 Ga0307414_10078293 3300032004 Bacteria 2409
211 Ga0307414_10436127 3300032004 Bacteria 1146
212 Ga0315913_1000002 3300033430 Bacteria 241452
213 Ga0315915_1000001 3300033464 Bacteria 481518
214 Ga0439436_0006782 3300041404 Bacteria 3520
215 Ga0439439_0102307 3300041406 Bacteria 789
216 Ga0439466_0012572 3300041411 Bacteria 3116
217 Ga0439466_0198763 3300041411 Bacteria 610
218 Ga0439465_0000355 3300041413 Bacteria 13112
219 Ga0439465_0005740 3300041413 Bacteria 3949
220 Ga0439465_0045329 3300041413 Bacteria 1430
221 Ga0439465_0134004 3300041413 Bacteria 876
222 Ga0451795_1234607 3300041456 Bacteria 1309
223 Ga0451841_0909818 3300041498 Bacteria 1605
224 Ga0439445_0105752 3300042004 Bacteria 800
225 Ga0439432_097685 3300042006 Bacteria 880
226 Ga0439449_0007498 3300042007 Bacteria 4146
227 Ga0439449_0025875 3300042007 Bacteria 2192
228 Ga0439449_0066791 3300042007 Bacteria 1326
229 Ga0439452_084578 3300042010 Bacteria 689
230 Ga0439462_0052665 3300042015 Bacteria 1095
231 Ga0450920_113986 3300042122 Bacteria 565
232 Ga0450907_008043 3300042146 Bacteria 1756
233 Ga0439434_0024842 3300042435 Bacteria 1808
234 Ga0466963_0086175 3300044694 Bacteria 2134
235 Ga0466964_0249593 3300044706 Bacteria 874
236 Ga0466970_0024757 3300044765 Bacteria 3139
237 Ga0466970_0062628 3300044765 Bacteria 1994
238 Ga0466960_0209290 3300044901 Bacteria 1069
239 Ga0466958_0120906 3300045836 Bacteria 1639
240 Ga0466967_0437960 3300045976 Bacteria 1276
241 Ga0495627_059308 3300046453 Bacteria 1135
242 Ga0495650_0168341 3300046471 Bacteria 777
243 Ga0495605_0332282 3300046474 Bacteria 639
244 Ga0495585_0059601 3300046492 Bacteria 2103
245 Ga0495585_0107147 3300046492 Bacteria 1489
246 Ga0495607_0242523 3300046501 Bacteria 871
247 Ga0495607_0324333 3300046501 Bacteria 717
248 Ga0495583_0078560 3300046506 Bacteria 1437
249 Ga0495606_0001601 3300046507 Bacteria 29530
250 Ga0495606_0059492 3300046507 Bacteria 2451
251 Ga0495606_0147413 3300046507 Bacteria 1384
252 Ga0495606_0163877 3300046507 Bacteria 1295
253 Ga0495610_0000618 3300046512 Bacteria 35134
254 Ga0495610_0021153 3300046512 Bacteria 3584
255 Ga0495610_0107844 3300046512 Bacteria 1237
256 Ga0495616_0247631 3300046513 Bacteria 767
257 Ga0495620_0012939 3300046515 Bacteria 4289
258 Ga0495620_0029299 3300046515 Bacteria 2549
259 Ga0495643_0025986 3300046522 Bacteria 3309
260 Ga0495643_0026977 3300046522 Bacteria 3233
261 Ga0495643_0219857 3300046522 Bacteria 901
262 Ga0495644_0291045 3300046523 Bacteria 638
263 Ga0495663_0148987 3300046525 Bacteria 797
264 Ga0495654_0162300 3300046530 Bacteria 980
265 Ga0495654_0356981 3300046530 Bacteria 587
266 Ga0495609_0070983 3300046538 Bacteria 1530
267 Ga0495622_0264026 3300046557 Bacteria 755
268 Ga0495633_0124151 3300046558 Bacteria 1195
269 Ga0495633_0162565 3300046558 Bacteria 1030
270 Ga0495625_0017921 3300046660 Bacteria 5535
271 Ga0495625_0094836 3300046660 Bacteria 2058
272 Ga0495625_0141837 3300046660 Bacteria 1620
273 Ga0495625_0480183 3300046660 Bacteria 763
274 Ga0495588_0001139 3300046674 Bacteria 11446
275 Ga0495588_0398355 3300046674 Bacteria 723
276 Ga0495588_0411098 3300046674 Bacteria 710
277 Ga0495649_0051376 3300046694 Bacteria 2235
278 Ga0495687_063027 3300047443 Bacteria 1519
279 Ga0495687_158796 3300047443 Bacteria 763
280 Ga0495681_0018565 3300047470 Bacteria 3829
281 Ga0495681_0022800 3300047470 Bacteria 3341
282 Ga0495681_0050496 3300047470 Bacteria 1960
283 Ga0495681_0082886 3300047470 Bacteria 1428
284 Ga0495686_0003970 3300047472 Bacteria 12401
285 Ga0496100_0091210 3300048903 Bacteria 2079
286 Ga0496102_0002635 3300048905 Bacteria 15245
287 Ga0496103_0014923 3300048906 Bacteria 4617
288 Ga0496112_1112220 3300048915 Bacteria 708
289 Ga0496113_0956698 3300048916 Bacteria 676
290 Ga0496116_0018858 3300048919 Bacteria 5300
291 Ga0496116_0127936 3300048919 Bacteria 1454
292 Ga0496116_0235790 3300048919 Bacteria 923
293 Ga0496117_0000002 3300048920 Bacteria 2483758
294 Ga0496117_0000337 3300048920 Bacteria 82874
295 Ga0496117_0023943 3300048920 Bacteria 4847
296 Ga0496117_0312970 3300048920 Bacteria 826
297 Ga0496117_0481259 3300048920 Bacteria 606
298 Ga0496118_0000084 3300048921 Bacteria 181733
299 Ga0496118_0000396 3300048921 Bacteria 73830
300 Ga0496118_0023843 3300048921 Bacteria 5302
301 Ga0496118_0037817 3300048921 Bacteria 3878
302 Ga0496118_0113251 3300048921 Bacteria 1793
303 Ga0496119_0003866 3300048922 Bacteria 15292
304 Ga0496119_0108686 3300048922 Bacteria 1543
305 Ga0496119_0168446 3300048922 Bacteria 1159
306 Ga0496119_0178270 3300048922 Bacteria 1116
307 Ga0496119_0252897 3300048922 Bacteria 888
308 Ga0496119_0298070 3300048922 Bacteria 796
309 Ga0496120_0000087 3300048923 Bacteria 152857
310 Ga0496120_0042526 3300048923 Bacteria 2652
311 Ga0496120_0059386 3300048923 Bacteria 2143
312 Ga0496120_0205426 3300048923 Bacteria 951
313 Ga0496120_0460038 3300048923 Bacteria 552
314 Ga0496121_0000001 3300048924 Bacteria 1830318
315 Ga0496121_0001010 3300048924 Bacteria 50285
316 Ga0496121_0023875 3300048924 Bacteria 5868
317 Ga0496121_0134621 3300048924 Bacteria 1843
318 Ga0496121_0146053 3300048924 Bacteria 1747
319 Ga0496121_0520582 3300048924 Bacteria 750
320 Ga0496121_0540445 3300048924 Bacteria 731
321 Ga0496122_0000001 3300048925 Bacteria 1827766
322 Ga0496122_0005041 3300048925 Bacteria 15970
323 Ga0496122_0006419 3300048925 Bacteria 13506
324 Ga0496122_0009595 3300048925 Bacteria 10140
325 Ga0496122_0013440 3300048925 Bacteria 8012
326 Ga0496122_0090631 3300048925 Bacteria 2085
327 Ga0496123_0000001 3300048926 Bacteria 1831497
328 Ga0496123_0003144 3300048926 Bacteria 18930
329 Ga0496123_0013827 3300048926 Bacteria 6734
330 Ga0496123_0015886 3300048926 Bacteria 6145
331 Ga0496123_0035000 3300048926 Bacteria 3587
332 Ga0496124_0013444 3300048927 Bacteria 7989
333 Ga0496124_0014413 3300048927 Bacteria 7644
334 Ga0496124_0017145 3300048927 Bacteria 6845
335 Ga0496124_0018273 3300048927 Bacteria 6571
336 Ga0496124_0041714 3300048927 Bacteria 3957
337 Ga0496124_0044248 3300048927 Bacteria 3821
338 Ga0496125_0000001 3300048928 Bacteria 1766138
339 Ga0496125_0010798 3300048928 Bacteria 9196
340 Ga0496125_0024115 3300048928 Bacteria 5601
341 Ga0496125_0024997 3300048928 Bacteria 5480
342 Ga0496125_0192517 3300048928 Bacteria 1345
343 Ga0496126_0043168 3300048929 Bacteria 4160
344 Ga0496126_0236009 3300048929 Bacteria 1530
345 Ga0496126_0418650 3300048929 Bacteria 1083
346 Ga0495678_088665 3300049459 Bacteria 1094
347 Ga0501032_0531480 3300049569 Bacteria 750
348 Ga0501033_0000038 3300049570 Bacteria 144438
349 Ga0501039_1486245 3300049575 Bacteria 521
350 Ga0501238_004127 3300049671 Bacteria 1805
351 Ga0501241_005912 3300049758 Bacteria 2271
352 Ga0501263_052826 3300049760 Bacteria 622
353 Ga0501280_004596 3300049776 Bacteria 2016
354 Ga0501035_0000367 3300049822 Bacteria 52067
355 Ga0501226_038683 3300049853 Bacteria 548
356 nmdc:mga03683_12492_c1 3300050489 Bacteria 3104
357 nmdc:mga03683_172654_c1 3300050489 Bacteria 983
358 nmdc:mga03683_584532_c1 3300050489 Bacteria 546
359 nmdc:mga03n38_21202_c1 3300050490 Bacteria 2612
360 nmdc:mga00v17_1089499_c1 3300050491 Bacteria 500
361 nmdc:mga00v17_118470_c1 3300050491 Bacteria 1685
362 nmdc:mga00v17_17687_c1 3300050491 Bacteria 4041
363 nmdc:mga00v17_261752_c1 3300050491 Bacteria 1122
364 nmdc:mga0yw44_12538_c1 3300050492 Bacteria 4424
365 nmdc:mga0yw44_20818_c1 3300050492 Bacteria 3648
366 nmdc:mga0k408_60287_c1 3300050493 Bacteria 2205
367 nmdc:mga0k408_849171_c1 3300050493 Bacteria 531
368 nmdc:mga06z11_190514_c1 3300050494 Bacteria 1187
369 nmdc:mga06z11_85644_c1 3300050494 Bacteria 1701
370 nmdc:mga04h51_14458_c1 3300050495 Bacteria 2256
371 nmdc:mga07m45_326304_c1 3300050496 Bacteria 892
372 nmdc:mga0sz30_2254_c1 3300050516 Bacteria 6900
373 nmdc:mga0sz30_233103_c1 3300050516 Bacteria 819
374 nmdc:mga0sz30_43477_c1 3300050516 Bacteria 1891
375 nmdc:mga0sz30_436456_c1 3300050516 Bacteria 587
376 nmdc:mga0sz30_519472_c1 3300050516 Bacteria 536
377 Ga0500578_0428584 3300053086 Bacteria 757
378 Ga0500654_102319 3300053099 Bacteria 1216
379 Ga0500560_001305 3300053107 Bacteria 4238
380 Ga0500572_009945 3300053111 Bacteria 2261
381 Ga0500572_099014 3300053111 Bacteria 931
382 Ga0500618_003278 3300053125 Bacteria 5623
383 Ga0500618_009376 3300053125 Bacteria 2674
384 Ga0500618_014255 3300053125 Bacteria 2034
385 Ga0500561_0000019 3300053137 Bacteria 39573
386 Ga0500568_0174861 3300053139 Bacteria 790
387 Ga0500604_0053854 3300053151 Bacteria 1248
388 Ga0500616_0000599 3300053153 Bacteria 43738
389 Ga0500622_0000521 3300053156 Bacteria 35694
390 Ga0500624_000619 3300053157 Bacteria 9605
391 Ga0500634_0007251 3300053161 Bacteria 5446
392 Ga0500634_0053809 3300053161 Bacteria 2158
393 Ga0500636_0004687 3300053177 Bacteria 7762
394 Ga0500636_0212226 3300053177 Bacteria 1015
395 Ga0500636_0384134 3300053177 Bacteria 657
396 Ga0500565_005680 3300053734 Bacteria 1113
397 Ga0590075_040593 3300059424 Bacteria 1189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_172654_c1 nmdc:mga03683_172654_c1_657_953 98
2 3300048924 Ga0496121_0134621 Ga0496121_0134621_1528_1833 101
3 iso_pu_bacteria 2643221629 2644169009 104
4 iso_pu_bacteria 2643221662 2644347560 104
5 iso_pu_bacteria 2818991439 2819556184 105
6 iso_pu_bacteria 2818991461 2819685261 105
7 iso_pu_bacteria 2933016740 2933018821 105
8 iso_pu_bacteria 2979100975 2979105519 105
9 iso_pu_bacteria 2984509177 2984512633 105
10 iso_pu_bacteria 2984518228 2984521007 105
11 iso_pu_bacteria 2984537506 2984540300 105
12 iso_pu_bacteria 2984601300 2984602498 105
13 iso_pu_bacteria 8024486573 8024489923 105
14 iso_pu_bacteria 2509276021 2509387891 106
15 iso_pu_bacteria 2510461069 2510839925 106
16 iso_pu_bacteria 2510917030 2511197848 106
17 iso_pu_bacteria 2513237146 2513925544 106
18 iso_pu_bacteria 2537561587 2537875538 106
19 iso_pu_bacteria 2554235003 2554246938 106
20 iso_pu_bacteria 2558860242 2559294164 106
21 iso_pu_bacteria 2582581299 2585230559 106
22 iso_pu_bacteria 2599185170 2599418761 106
23 iso_pu_bacteria 2599185210 2599603507 106
24 iso_pu_bacteria 2600255279 2601608857 106
25 iso_pu_bacteria 2600255308 2601745632 106
26 iso_pu_bacteria 2643221582 2643918535 106
27 iso_pu_bacteria 2643221634 2644191014 106
28 iso_pu_bacteria 2643221643 2644242723 106
29 iso_pu_bacteria 2643221693 2644518920 106
30 iso_pu_bacteria 2718217927 2719384686 106
31 iso_pu_bacteria 2718218423 2721398396 106
32 iso_pu_bacteria 2721755809 2724037209 106
33 iso_pu_bacteria 2791355266 2793358718 106
34 iso_pu_bacteria 2808606387 2808986059 106
35 iso_pu_bacteria 2838035591 2838037550 106
36 iso_pu_bacteria 2838661181 2838663297 106
37 iso_pu_bacteria 2838675328 2838676911 106
38 iso_pu_bacteria 2838714209 2838715797 106
39 iso_pu_bacteria 2838719591 2838720402 106
40 iso_pu_bacteria 2838724970 2838726551 106
41 iso_pu_bacteria 2841846520 2841847334 106
42 iso_pu_bacteria 2841864319 2841870466 106
43 iso_pu_bacteria 2842124991 2842126636 106
44 iso_pu_bacteria 2842130223 2842131804 106
45 iso_pu_bacteria 2842152218 2842153027 106
46 iso_pu_bacteria 2842170452 2842172041 106
47 iso_pu_bacteria 2842175837 2842176646 106
48 iso_pu_bacteria 2842187318 2842188906 106
49 iso_pu_bacteria 2842211629 2842213218 106
50 iso_pu_bacteria 2842224351 2842225164 106
51 iso_pu_bacteria 2842341865 2842343774 106
52 iso_pu_bacteria 2842363717 2842364999 106
53 iso_pu_bacteria 2899792073 2899792197 106
54 iso_pu_bacteria 2899845264 2899846230 106
55 iso_pu_bacteria 2919114240 2919116000 106
56 iso_pu_bacteria 2926754445 2926756953 106
57 iso_pu_bacteria 2926760298 2926761173 106
58 iso_pu_bacteria 2933006813 2933007670 106
59 iso_pu_bacteria 2933594066 2933594882 106
60 iso_pu_bacteria 2979089926 2979093543 106
61 iso_pu_bacteria 2979095461 2979099069 106
62 iso_pu_bacteria 2996893221 2996895343 106
63 iso_pu_bacteria 3005409236 3005412209 106
64 iso_pu_bacteria 650716007 650739356 106
65 iso_pu_bacteria 8003570095 8003570392 106
66 iso_pu_bacteria 8005275841 8005279403 106
67 iso_pu_bacteria 8018176218 8018178087 106
68 3300048929 Ga0496126_0236009 Ga0496126_0236009_39_365 107
69 iso_pu_bacteria 2509276033 2509443506 107
70 iso_pu_bacteria 2582581298 2585225464 107
71 iso_pu_bacteria 2585427529 2585548261 107
72 iso_pu_bacteria 2791355259 2793316977 107
73 iso_pu_bacteria 2841859092 2841860130 107
74 iso_pu_bacteria 2842515876 2842516915 107
75 iso_pu_bacteria 2919100787 2919100860 107
76 iso_pu_bacteria 2929138655 2929139277 107
77 iso_pu_bacteria 2933011516 2933012443 107
78 iso_pu_bacteria 3005445848 3005446563 107
79 3300046501 Ga0495607_0242523 Ga0495607_0242523_467_796 108
80 3300049776 Ga0501280_004596 Ga0501280_004596_691_1020 108
81 3300049853 Ga0501226_038683 Ga0501226_038683_64_393 108
82 3300050492 nmdc:mga0yw44_12538_c1 nmdc:mga0yw44_12538_c1_2322_2651 108
83 3300053125 Ga0500618_014255 Ga0500618_014255_1664_1993 108
84 iso_pu_bacteria 2643221653 2644297063 108
85 iso_pu_bacteria 2643221719 2644655316 108
86 iso_pu_bacteria 2738541317 2738948569 108
87 iso_pu_bacteria 2775507049 2776912532 108
88 iso_pu_bacteria 2818991272 2819242765 108
89 iso_pu_bacteria 2854896431 2854898684 108
90 iso_pu_bacteria 2854916844 2854921712 108
91 iso_pu_bacteria 2891048133 2891052007 108
92 iso_pu_bacteria 2913308742 2913313529 108
93 iso_pu_bacteria 2989776772 2989777954 108
94 iso_pu_bacteria 8005246636 8005246812 108
95 3300002773 JGI25152J39213_1041177 JGI25152J39213_10411772 109
96 3300002987 JGI25159J45721_1006118 JGI25159J45721_10061182 109
97 3300003187 JGI25151J46595_10005934 JGI25151J46595_100059344 109
98 3300003187 JGI25151J46595_10019059 JGI25151J46595_100190595 109
99 3300003215 JGI25153J46596_10042234 JGI25153J46596_100422342 109
100 3300003215 JGI25153J46596_10107143 JGI25153J46596_101071432 109
101 3300003320 rootH2_10285524 rootH2_102855241 109
102 3300003322 rootL2_10076125 rootL2_100761252 109
103 3300003354 JGI25160J50197_1008481 JGI25160J50197_10084815 109
104 3300003354 JGI25160J50197_1060739 JGI25160J50197_10607392 109
105 3300003374 JGI25161J50226_1000190 JGI25161J50226_100019035 109
106 3300003771 Ga0055526_1000512 Ga0055526_10005128 109
107 3300003775 Ga0055524_1008154 Ga0055524_10081545 109
108 3300003790 Ga0055528_1009002 Ga0055528_10090024 109
109 3300003792 Ga0055540_1026826 Ga0055540_10268262 109
110 3300003792 Ga0055540_1085977 Ga0055540_10859771 109
111 3300003794 Ga0055531_10075456 Ga0055531_100754562 109
112 3300003856 Ga0058692_1002068 Ga0058692_10020689 109
113 3300003856 Ga0058692_1005061 Ga0058692_10050616 109
114 3300004625 Ga0055543_1000115 Ga0055543_100011511 109
115 3300005262 Ga0065165_1036195 Ga0065165_10361953 109
116 3300005262 Ga0065165_1083243 Ga0065165_10832432 109
117 3300005347 Ga0070668_100463199 Ga0070668_1004631992 109
118 3300005353 Ga0070669_100072844 Ga0070669_1000728442 109
119 3300005353 Ga0070669_100217048 Ga0070669_1002170482 109
120 3300005548 Ga0070665_100001300 Ga0070665_10000130025 109
121 3300005548 Ga0070665_100207161 Ga0070665_1002071614 109
122 3300005548 Ga0070665_102483401 Ga0070665_1024834012 109
123 3300005616 Ga0068852_102831669 Ga0068852_1028316691 109
124 3300005844 Ga0068862_102027788 Ga0068862_1020277882 109
125 3300006038 Ga0075365_10111055 Ga0075365_101110552 109
126 3300006038 Ga0075365_10182342 Ga0075365_101823422 109
127 3300006042 Ga0075368_10022854 Ga0075368_100228542 109
128 3300006051 Ga0075364_10410928 Ga0075364_104109281 109
129 3300006177 Ga0075362_10623112 Ga0075362_106231122 109
130 3300006186 Ga0075369_10045076 Ga0075369_100450762 109
131 3300006186 Ga0075369_10210687 Ga0075369_102106872 109
132 3300006195 Ga0075366_10032146 Ga0075366_100321462 109
133 3300006948 Ga0099826_10000030 Ga0099826_1000003076 109
134 3300006948 Ga0099826_10024903 Ga0099826_100249034 109
135 3300009092 Ga0105250_10113286 Ga0105250_101132862 109
136 3300009148 Ga0105243_10091334 Ga0105243_100913342 109
137 3300009766 Ga0123342_1012996 Ga0123342_10129966 109
138 3300013100 Ga0157373_10000402 Ga0157373_1000040211 109
139 3300013102 Ga0157371_10000294 Ga0157371_1000029418 109
140 3300013104 Ga0157370_10000090 Ga0157370_1000009019 109
141 3300013307 Ga0157372_10710546 Ga0157372_107105461 109
142 3300025208 Ga0209436_100060 Ga0209436_10006033 109
143 3300025245 Ga0207425_1041262 Ga0207425_10412622 109
144 3300025245 Ga0207425_1046250 Ga0207425_10462502 109
145 3300025258 Ga0209129_1015629 Ga0209129_10156292 109
146 3300025258 Ga0209129_1026941 Ga0209129_10269412 109
147 3300025258 Ga0209129_1042208 Ga0209129_10422082 109
148 3300025263 Ga0209565_1026616 Ga0209565_10266162 109
149 3300025273 Ga0209673_1001208 Ga0209673_100120829 109
150 3300025284 Ga0209130_1000015 Ga0209130_100001567 109
151 3300025294 Ga0209025_1000074 Ga0209025_100007473 109
152 3300025294 Ga0209025_1000080 Ga0209025_1000080220 109
153 3300025294 Ga0209025_1007589 Ga0209025_10075899 109
154 3300025295 Ga0209564_1001322 Ga0209564_100132227 109
155 3300025295 Ga0209564_1082537 Ga0209564_10825372 109
156 3300025297 Ga0209758_1000148 Ga0209758_100014835 109
157 3300025297 Ga0209758_1003230 Ga0209758_100323017 109
158 3300025297 Ga0209758_1120326 Ga0209758_11203261 109
159 3300025299 Ga0209256_1005360 Ga0209256_10053607 109
160 3300025302 Ga0207426_1000122 Ga0207426_1000122165 109
161 3300025303 Ga0209051_1047136 Ga0209051_10471362 109
162 3300025304 Ga0209257_1018905 Ga0209257_10189053 109
163 3300025711 Ga0207696_1082375 Ga0207696_10823752 109
164 3300025923 Ga0207681_10058320 Ga0207681_100583203 109
165 3300025923 Ga0207681_10417706 Ga0207681_104177063 109
166 3300025935 Ga0207709_10018979 Ga0207709_100189792 109
167 3300025972 Ga0207668_10394649 Ga0207668_103946492 109
168 3300027312 Ga0209371_1000009 Ga0209371_1000009112 109
169 3300027312 Ga0209371_1000571 Ga0209371_10005714 109
170 3300027312 Ga0209371_1031213 Ga0209371_10312133 109
171 3300027666 Ga0209282_1000219 Ga0209282_10002197 109
172 3300027666 Ga0209282_1035537 Ga0209282_10355372 109
173 3300027866 Ga0209813_10013221 Ga0209813_100132213 109
174 3300028379 Ga0268266_10003708 Ga0268266_1000370813 109
175 3300028379 Ga0268266_10135180 Ga0268266_101351804 109
176 3300028380 Ga0268265_10837677 Ga0268265_108376772 109
177 3300030500 Ga0268256_1000010 Ga0268256_1000010112 109
178 3300030500 Ga0268256_1009628 Ga0268256_10096282 109
179 3300030500 Ga0268256_1015500 Ga0268256_10155001 109
180 3300030500 Ga0268256_1035480 Ga0268256_10354801 109
181 3300030745 Ga0316182_1099944 Ga0316182_10999441 109
182 3300031995 Ga0307409_100165909 Ga0307409_1001659091 109
183 3300041406 Ga0439439_0102307 Ga0439439_0102307_16_348 109
184 3300041411 Ga0439466_0198763 Ga0439466_0198763_265_597 109
185 3300041413 Ga0439465_0000355 Ga0439465_0000355_12230_12562 109
186 3300041413 Ga0439465_0134004 Ga0439465_0134004_349_678 109
187 3300041456 Ga0451795_1234607 Ga0451795_1234607_70_402 109
188 3300042004 Ga0439445_0105752 Ga0439445_0105752_353_685 109
189 3300042006 Ga0439432_097685 Ga0439432_097685_309_641 109
190 3300042007 Ga0439449_0025875 Ga0439449_0025875_1478_1810 109
191 3300046471 Ga0495650_0168341 Ga0495650_0168341_90_422 109
192 3300046474 Ga0495605_0332282 Ga0495605_0332282_179_511 109
193 3300046492 Ga0495585_0059601 Ga0495585_0059601_16_348 109
194 3300046492 Ga0495585_0107147 Ga0495585_0107147_819_1151 109
195 3300046507 Ga0495606_0001601 Ga0495606_0001601_26639_26971 109
196 3300046507 Ga0495606_0059492 Ga0495606_0059492_1814_2146 109
197 3300046507 Ga0495606_0163877 Ga0495606_0163877_448_783 109
198 3300046512 Ga0495610_0000618 Ga0495610_0000618_22571_22903 109
199 3300046512 Ga0495610_0021153 Ga0495610_0021153_2076_2411 109
200 3300046513 Ga0495616_0247631 Ga0495616_0247631_148_483 109
201 3300046515 Ga0495620_0012939 Ga0495620_0012939_2324_2656 109
202 3300046515 Ga0495620_0029299 Ga0495620_0029299_194_526 109
203 3300046522 Ga0495643_0025986 Ga0495643_0025986_87_419 109
204 3300046522 Ga0495643_0026977 Ga0495643_0026977_2865_3200 109
205 3300046523 Ga0495644_0291045 Ga0495644_0291045_68_400 109
206 3300046530 Ga0495654_0356981 Ga0495654_0356981_226_558 109
207 3300046557 Ga0495622_0264026 Ga0495622_0264026_89_421 109
208 3300046558 Ga0495633_0124151 Ga0495633_0124151_749_1081 109
209 3300046558 Ga0495633_0162565 Ga0495633_0162565_446_778 109
210 3300046660 Ga0495625_0480183 Ga0495625_0480183_332_664 109
211 3300046674 Ga0495588_0001139 Ga0495588_0001139_942_1274 109
212 3300046694 Ga0495649_0051376 Ga0495649_0051376_1675_2010 109
213 3300047470 Ga0495681_0018565 Ga0495681_0018565_2000_2332 109
214 3300047470 Ga0495681_0022800 Ga0495681_0022800_2185_2517 109
215 3300047472 Ga0495686_0003970 Ga0495686_0003970_2605_2937 109
216 3300048916 Ga0496113_0956698 Ga0496113_0956698_129_464 109
217 3300048919 Ga0496116_0018858 Ga0496116_0018858_4824_5156 109
218 3300048919 Ga0496116_0127936 Ga0496116_0127936_1090_1425 109
219 3300048920 Ga0496117_0000002 Ga0496117_0000002_1661308_1661640 109
220 3300048920 Ga0496117_0481259 Ga0496117_0481259_84_419 109
221 3300048921 Ga0496118_0000084 Ga0496118_0000084_101069_101401 109
222 3300048921 Ga0496118_0023843 Ga0496118_0023843_3631_3966 109
223 3300048921 Ga0496118_0037817 Ga0496118_0037817_223_555 109
224 3300048922 Ga0496119_0178270 Ga0496119_0178270_25_357 109
225 3300048922 Ga0496119_0298070 Ga0496119_0298070_109_441 109
226 3300048923 Ga0496120_0000087 Ga0496120_0000087_72966_73298 109
227 3300048923 Ga0496120_0205426 Ga0496120_0205426_408_740 109
228 3300048924 Ga0496121_0023875 Ga0496121_0023875_4781_5113 109
229 3300048924 Ga0496121_0540445 Ga0496121_0540445_121_450 109
230 3300048925 Ga0496122_0000001 Ga0496122_0000001_1032097_1032429 109
231 3300048925 Ga0496122_0013440 Ga0496122_0013440_6551_6886 109
232 3300048926 Ga0496123_0000001 Ga0496123_0000001_1035828_1036160 109
233 3300048926 Ga0496123_0035000 Ga0496123_0035000_1939_2274 109
234 3300048927 Ga0496124_0018273 Ga0496124_0018273_4674_5006 109
235 3300048927 Ga0496124_0041714 Ga0496124_0041714_1194_1526 109
236 3300048927 Ga0496124_0044248 Ga0496124_0044248_2426_2761 109
237 3300048928 Ga0496125_0024115 Ga0496125_0024115_1430_1762 109
238 3300048928 Ga0496125_0024997 Ga0496125_0024997_1068_1403 109
239 3300049459 Ga0495678_088665 Ga0495678_088665_185_517 109
240 3300050489 nmdc:mga03683_12492_c1 nmdc:mga03683_12492_c1_293_625 109
241 3300050489 nmdc:mga03683_584532_c1 nmdc:mga03683_584532_c1_66_398 109
242 3300050490 nmdc:mga03n38_21202_c1 nmdc:mga03n38_21202_c1_1192_1524 109
243 3300050491 nmdc:mga00v17_118470_c1 nmdc:mga00v17_118470_c1_1040_1372 109
244 3300050491 nmdc:mga00v17_261752_c1 nmdc:mga00v17_261752_c1_650_982 109
245 3300050492 nmdc:mga0yw44_20818_c1 nmdc:mga0yw44_20818_c1_1285_1617 109
246 3300050493 nmdc:mga0k408_60287_c1 nmdc:mga0k408_60287_c1_1242_1574 109
247 3300050493 nmdc:mga0k408_849171_c1 nmdc:mga0k408_849171_c1_131_460 109
248 3300050494 nmdc:mga06z11_190514_c1 nmdc:mga06z11_190514_c1_713_1045 109
249 3300050494 nmdc:mga06z11_85644_c1 nmdc:mga06z11_85644_c1_371_703 109
250 3300050495 nmdc:mga04h51_14458_c1 nmdc:mga04h51_14458_c1_749_1081 109
251 3300050516 nmdc:mga0sz30_2254_c1 nmdc:mga0sz30_2254_c1_2454_2786 109
252 3300050516 nmdc:mga0sz30_233103_c1 nmdc:mga0sz30_233103_c1_459_791 109
253 3300050516 nmdc:mga0sz30_43477_c1 nmdc:mga0sz30_43477_c1_541_873 109
254 3300050516 nmdc:mga0sz30_519472_c1 nmdc:mga0sz30_519472_c1_168_500 109
255 3300053107 Ga0500560_001305 Ga0500560_001305_3648_3980 109
256 3300053111 Ga0500572_099014 Ga0500572_099014_463_795 109
257 3300053125 Ga0500618_003278 Ga0500618_003278_1731_2063 109
258 3300053137 Ga0500561_0000019 Ga0500561_0000019_23838_24170 109
259 3300053139 Ga0500568_0174861 Ga0500568_0174861_159_494 109
260 3300053156 Ga0500622_0000521 Ga0500622_0000521_19434_19769 109
261 3300053157 Ga0500624_000619 Ga0500624_000619_6529_6861 109
262 3300053161 Ga0500634_0053809 Ga0500634_0053809_1077_1409 109
263 iso_pu_bacteria 2600254933 2600375048 109
264 iso_pu_bacteria 8054460903 8054461701 109
265 iso_pu_bacteria 8056875544 8056879944 109
266 3300032004 Ga0307414_10078293 Ga0307414_100782933 110
267 iso_pu_bacteria 2510917026 2511171310 110
268 iso_pu_bacteria 2585427633 2585994900 110
269 iso_pu_bacteria 2585427634 2585999442 110
270 iso_pu_bacteria 2919171160 2919171648 110
271 iso_pu_bacteria 8055431914 8055434010 110
272 3300002774 JGI25150J39212_1002531 JGI25150J39212_10025317 111
273 3300003215 JGI25153J46596_10107109 JGI25153J46596_101071091 111
274 3300003316 rootH1_10156606 rootH1_101566062 111
275 3300006051 Ga0075364_10015347 Ga0075364_100153475 111
276 3300025245 Ga0207425_1003759 Ga0207425_10037597 111
277 3300025258 Ga0209129_1014028 Ga0209129_10140282 111
278 3300025294 Ga0209025_1047367 Ga0209025_10473674 111
279 3300025294 Ga0209025_1048399 Ga0209025_10483992 111
280 3300025297 Ga0209758_1004114 Ga0209758_100411415 111
281 3300048920 Ga0496117_0023943 Ga0496117_0023943_1073_1411 111
282 3300048923 Ga0496120_0059386 Ga0496120_0059386_1530_1865 111
283 3300048924 Ga0496121_0000001 Ga0496121_0000001_736394_736729 111
284 3300048924 Ga0496121_0520582 Ga0496121_0520582_40_378 111
285 3300048925 Ga0496122_0090631 Ga0496122_0090631_1209_1544 111
286 3300048926 Ga0496123_0015886 Ga0496123_0015886_2338_2673 111
287 3300048927 Ga0496124_0017145 Ga0496124_0017145_4403_4741 111
288 3300048928 Ga0496125_0000001 Ga0496125_0000001_850362_850697 111
289 3300048929 Ga0496126_0418650 Ga0496126_0418650_736_1071 111
290 3300050491 nmdc:mga00v17_17687_c1 nmdc:mga00v17_17687_c1_675_1010 111
291 3300053153 Ga0500616_0000599 Ga0500616_0000599_16885_17223 111
292 3300053161 Ga0500634_0007251 Ga0500634_0007251_3903_4241 111
293 3300053734 Ga0500565_005680 Ga0500565_005680_436_774 111
294 3300059424 Ga0590075_040593 Ga0590075_040593_392_730 111
295 3300005339 Ga0070660_101127111 Ga0070660_1011271112 112
296 3300005548 Ga0070665_100034062 Ga0070665_1000340627 112
297 3300009545 Ga0105237_10000091 Ga0105237_1000009140 112
298 3300010375 Ga0105239_10000793 Ga0105239_1000079324 112
299 3300014969 Ga0157376_10566406 Ga0157376_105664062 112
300 3300025913 Ga0207695_11526568 Ga0207695_115265682 112
301 3300025914 Ga0207671_10000095 Ga0207671_1000009559 112
302 3300025919 Ga0207657_11070635 Ga0207657_110706351 112
303 3300028379 Ga0268266_10000417 Ga0268266_1000041734 112
304 3300049575 Ga0501039_1486245 Ga0501039_1486245_54_404 112
305 iso_pu_bacteria 2510065057 2510304503 112
306 iso_pu_bacteria 2511231052 2511500879 112
307 iso_pu_bacteria 2512047086 2512532304 112
308 iso_pu_bacteria 2512875026 2512972367 112
309 iso_pu_bacteria 2513237086 2513583583 112
310 iso_pu_bacteria 2513237089 2513603446 112
311 iso_pu_bacteria 2513237091 2513620862 112
312 iso_pu_bacteria 2513237140 2513882796 112
313 iso_pu_bacteria 2513237143 2513905339 112
314 iso_pu_bacteria 2513237156 2513985397 112
315 iso_pu_bacteria 2513237160 2514004901 112
316 iso_pu_bacteria 2515154107 2515608007 112
317 iso_pu_bacteria 2516653046 2516892151 112
318 iso_pu_bacteria 2517487022 2517568968 112
319 iso_pu_bacteria 2524023207 2524450204 112
320 iso_pu_bacteria 2551306084 2551676340 112
321 iso_pu_bacteria 2551306085 2551687447 112
322 iso_pu_bacteria 2551306086 2551696871 112
323 iso_pu_bacteria 2551306087 2551702392 112
324 iso_pu_bacteria 2551306089 2551714753 112
325 iso_pu_bacteria 2551306090 2551719012 112
326 iso_pu_bacteria 2551306091 2551731113 112
327 iso_pu_bacteria 2551306092 2551737492 112
328 iso_pu_bacteria 2551306093 2551741543 112
329 iso_pu_bacteria 2802428858 2802717611 112
330 iso_pu_bacteria 2802428859 2802723462 112
331 iso_pu_bacteria 2802428860 2802731088 112
332 iso_pu_bacteria 2802428861 2802736094 112
333 iso_pu_bacteria 2802428862 2802743695 112
334 iso_pu_bacteria 2802428863 2802750593 112
335 iso_pu_bacteria 2855825444 2855832071 112
336 iso_pu_bacteria 2855839649 2855840355 112
337 iso_pu_bacteria 2858800743 2858800886 112
338 iso_pu_bacteria 2915980308 2915986090 112
339 iso_pu_bacteria 2915986958 2915988201 112
340 iso_pu_bacteria 2915993759 2915997916 112
341 iso_pu_bacteria 2916000859 2916005690 112
342 iso_pu_bacteria 2916007675 2916012811 112
343 iso_pu_bacteria 2916014648 2916015391 112
344 iso_pu_bacteria 2916021584 2916027594 112
345 iso_pu_bacteria 2916028427 2916034579 112
346 iso_pu_bacteria 2916035215 2916035326 112
347 iso_pu_bacteria 2916041962 2916043306 112
348 iso_pu_bacteria 2916048683 2916052466 112
349 iso_pu_bacteria 2916055098 2916057622 112
350 iso_pu_bacteria 2916061851 2916067990 112
351 iso_pu_bacteria 2916068649 2916073716 112
352 iso_pu_bacteria 2916076590 2916076752 112
353 iso_pu_bacteria 2921201388 2921207662 112
354 iso_pu_bacteria 2921208531 2921212478 112
355 iso_pu_bacteria 2921237296 2921243903 112
356 iso_pu_bacteria 2921244191 2921245940 112
357 iso_pu_bacteria 2921250672 2921250874 112
358 iso_pu_bacteria 2921257292 2921261041 112
359 iso_pu_bacteria 2921263974 2921269329 112
360 iso_pu_bacteria 2921282425 2921286435 112
361 iso_pu_bacteria 2921289301 2921294034 112
362 iso_pu_bacteria 2921296804 2921300357 112
363 iso_pu_bacteria 2924144063 2924146948 112
364 iso_pu_bacteria 2924150972 2924156286 112
365 iso_pu_bacteria 2924158325 2924160480 112
366 iso_pu_bacteria 2924165586 2924172358 112
367 iso_pu_bacteria 2924172951 2924178575 112
368 iso_pu_bacteria 2924179722 2924181518 112
369 iso_pu_bacteria 2924186466 2924190265 112
370 iso_pu_bacteria 2924193448 2924195981 112
371 iso_pu_bacteria 2924200457 2924204415 112
372 iso_pu_bacteria 2924207177 2924207451 112
373 iso_pu_bacteria 2924214083 2924215683 112
374 iso_pu_bacteria 2924221636 2924223000 112
375 iso_pu_bacteria 2924228884 2924234845 112
376 iso_pu_bacteria 2936996657 2937000438 112
377 iso_pu_bacteria 2937002841 2937003365 112
378 iso_pu_bacteria 2937009748 2937010668 112
379 iso_pu_bacteria 2937016420 2937020791 112
380 iso_pu_bacteria 2937023124 2937028017 112
381 iso_pu_bacteria 2937029754 2937029948 112
382 iso_pu_bacteria 2937036028 2937038058 112
383 iso_pu_bacteria 2937042894 2937044619 112
384 iso_pu_bacteria 2937049772 2937052670 112
385 iso_pu_bacteria 2937056579 2937061626 112
386 iso_pu_bacteria 2937063883 2937066504 112
387 iso_pu_bacteria 2937071275 2937073787 112
388 iso_pu_bacteria 2937078374 2937083153 112
389 iso_pu_bacteria 2937084907 2937085256 112
390 iso_pu_bacteria 2937091812 2937097932 112
391 iso_pu_bacteria 2937098957 2937103720 112
392 iso_pu_bacteria 2937106411 2937111566 112
393 iso_pu_bacteria 2937113482 2937118265 112
394 iso_pu_bacteria 2937119839 2937120870 112
395 iso_pu_bacteria 2937126314 2937130177 112
396 iso_pu_bacteria 2957375807 2957380107 112
397 iso_pu_bacteria 2957382221 2957385161 112
398 iso_pu_bacteria 2957388812 2957389224 112
399 iso_pu_bacteria 2957395598 2957398613 112
400 iso_pu_bacteria 2957402308 2957402698 112
401 iso_pu_bacteria 2957408893 2957415189 112
402 iso_pu_bacteria 2957415311 2957417994 112
403 iso_pu_bacteria 2957422303 2957425630 112
404 iso_pu_bacteria 2957430029 2957433166 112
405 iso_pu_bacteria 2957437181 2957439896 112
406 iso_pu_bacteria 2957443900 2957449932 112
407 iso_pu_bacteria 2957450854 2957453532 112
408 iso_pu_bacteria 2957457609 2957457852 112
409 iso_pu_bacteria 2957464669 2957466424 112
410 iso_pu_bacteria 2957471148 2957474007 112
411 iso_pu_bacteria 2957478035 2957483755 112
412 iso_pu_bacteria 2957484790 2957485372 112
413 iso_pu_bacteria 2957491536 2957495903 112
414 iso_pu_bacteria 2957498199 2957499786 112
415 iso_pu_bacteria 2957505466 2957510326 112
416 iso_pu_bacteria 2960584000 2960587988 112
417 iso_pu_bacteria 2960591022 2960595490 112
418 iso_pu_bacteria 2960597568 2960600667 112
419 iso_pu_bacteria 2960603979 2960604641 112
420 iso_pu_bacteria 2960610863 2960613823 112
421 iso_pu_bacteria 2960617483 2960617615 112
422 iso_pu_bacteria 2960624210 2960624673 112
423 iso_pu_bacteria 2960631154 2960633310 112
424 iso_pu_bacteria 2960637947 2960642319 112
425 iso_pu_bacteria 2960645483 2960646518 112
426 iso_pu_bacteria 2960652885 2960656821 112
427 iso_pu_bacteria 2960660292 2960662292 112
428 iso_pu_bacteria 2960667422 2960668457 112
429 iso_pu_bacteria 2960674078 2960677543 112
430 iso_pu_bacteria 2960680706 2960684080 112
431 iso_pu_bacteria 2960687367 2960691096 112
432 iso_pu_bacteria 2960693952 2960696291 112
433 iso_pu_bacteria 2964607997 2964612070 112
434 iso_pu_bacteria 2964615318 2964617591 112
435 iso_pu_bacteria 2964621998 2964622903 112
436 iso_pu_bacteria 2964628898 2964633209 112
437 iso_pu_bacteria 2964636051 2964642090 112
438 iso_pu_bacteria 2964643177 2964644431 112
439 iso_pu_bacteria 2964649959 2964653011 112
440 iso_pu_bacteria 2964656573 2964661120 112
441 iso_pu_bacteria 2964663802 2964666065 112
442 iso_pu_bacteria 2964670856 2964671203 112
443 iso_pu_bacteria 2964678106 2964683654 112
444 iso_pu_bacteria 2964685014 2964689179 112
445 iso_pu_bacteria 2964691889 2964693562 112
446 iso_pu_bacteria 2964698721 2964701905 112
447 iso_pu_bacteria 2964705432 2964712414 112
448 iso_pu_bacteria 2964712639 2964713610 112
449 iso_pu_bacteria 2964719344 2964720356 112
450 iso_pu_bacteria 2967664464 2967669684 112
451 iso_pu_bacteria 2967671571 2967673727 112
452 iso_pu_bacteria 2967678726 2967678832 112
453 iso_pu_bacteria 2967686174 2967686333 112
454 iso_pu_bacteria 2967693043 2967693153 112
455 iso_pu_bacteria 2967699805 2967703412 112
456 iso_pu_bacteria 2967706974 2967709258 112
457 iso_pu_bacteria 2967714385 2967716622 112
458 iso_pu_bacteria 2967721400 2967724766 112
459 iso_pu_bacteria 2967728569 2967730648 112
460 iso_pu_bacteria 2967735183 2967740990 112
461 iso_pu_bacteria 2967742019 2967746040 112
462 iso_pu_bacteria 2967748971 2967752197 112
463 iso_pu_bacteria 2967755722 2967757643 112
464 iso_pu_bacteria 2967762386 2967763728 112
465 iso_pu_bacteria 2967769361 2967773147 112
466 iso_pu_bacteria 2967775926 2967777219 112
467 iso_pu_bacteria 2970019648 2970020173 112
468 iso_pu_bacteria 2970026789 2970030403 112
469 iso_pu_bacteria 2970033650 2970039169 112
470 iso_pu_bacteria 2970040964 2970043008 112
471 iso_pu_bacteria 2970047711 2970050011 112
472 iso_pu_bacteria 2970054988 2970059699 112
473 iso_pu_bacteria 2970061556 2970067834 112
474 iso_pu_bacteria 2970068827 2970074929 112
475 iso_pu_bacteria 2970076120 2970076456 112
476 iso_pu_bacteria 2970082768 2970086596 112
477 iso_pu_bacteria 2970088815 2970093495 112
478 iso_pu_bacteria 2970095765 2970102277 112
479 iso_pu_bacteria 2970102677 2970108473 112
480 iso_pu_bacteria 2970109326 2970109910 112
481 iso_pu_bacteria 2970116247 2970118059 112
482 iso_pu_bacteria 2970122695 2970128261 112
483 iso_pu_bacteria 2970129317 2970129426 112
484 iso_pu_bacteria 2970136068 2970136936 112
485 iso_pu_bacteria 2970143518 2970149061 112
486 iso_pu_bacteria 2970149975 2970153906 112
487 iso_pu_bacteria 2970156795 2970164017 112
488 iso_pu_bacteria 2970164137 2970167412 112
489 iso_pu_bacteria 2970170962 2970171513 112
490 iso_pu_bacteria 2970177841 2970182227 112
491 iso_pu_bacteria 2970184632 2970189448 112
492 iso_pu_bacteria 2970191845 2970198416 112
493 iso_pu_bacteria 2977516862 2977518613 112
494 iso_pu_bacteria 2977523885 2977527184 112
495 iso_pu_bacteria 2977530762 2977533336 112
496 iso_pu_bacteria 2977537788 2977537898 112
497 iso_pu_bacteria 2977544691 2977544849 112
498 iso_pu_bacteria 2977551784 2977551894 112
499 iso_pu_bacteria 2977558990 2977563108 112
500 iso_pu_bacteria 2977565890 2977568935 112
501 iso_pu_bacteria 2977572785 2977579052 112
502 iso_pu_bacteria 2977579622 2977581586 112
503 iso_pu_bacteria 648276728 648737768 112
504 iso_pu_bacteria 8003992118 8003992770 112
505 iso_pu_bacteria 8003999396 8004000100 112
506 3300003323 rootH1_10281976 rootH1_102819761 113
507 3300003781 Ga0055536_1009412 Ga0055536_10094126 113
508 3300003791 Ga0055530_10010080 Ga0055530_100100804 113
509 3300003792 Ga0055540_1002220 Ga0055540_100222013 113
510 3300003794 Ga0055531_10002384 Ga0055531_1000238412 113
511 3300006051 Ga0075364_10087422 Ga0075364_100874223 113
512 3300006353 Ga0075370_10370443 Ga0075370_103704431 113
513 3300013100 Ga0157373_10015734 Ga0157373_100157344 113
514 3300013105 Ga0157369_10081524 Ga0157369_100815244 113
515 3300025292 Ga0209676_1005973 Ga0209676_10059732 113
516 3300025297 Ga0209758_1000121 Ga0209758_100012157 113
517 3300025298 Ga0209050_1003961 Ga0209050_100396110 113
518 3300025303 Ga0209051_1001973 Ga0209051_100197317 113
519 3300025304 Ga0209257_1009681 Ga0209257_10096815 113
520 3300031548 Ga0307408_101805252 Ga0307408_1018052521 113
521 3300031824 Ga0307413_10792136 Ga0307413_107921361 113
522 3300032004 Ga0307414_10436127 Ga0307414_104361272 113
523 3300041498 Ga0451841_0909818 Ga0451841_0909818_1218_1559 113
524 3300044765 Ga0466970_0062628 Ga0466970_0062628_912_1256 113
525 3300044901 Ga0466960_0209290 Ga0466960_0209290_50_394 113
526 3300048920 Ga0496117_0312970 Ga0496117_0312970_373_714 113
527 3300048921 Ga0496118_0113251 Ga0496118_0113251_49_390 113
528 3300048922 Ga0496119_0252897 Ga0496119_0252897_451_795 113
529 3300048925 Ga0496122_0009595 Ga0496122_0009595_4739_5080 113
530 3300049671 Ga0501238_004127 Ga0501238_004127_750_1094 113
531 3300049758 Ga0501241_005912 Ga0501241_005912_890_1234 113
532 3300050491 nmdc:mga00v17_1089499_c1 nmdc:mga00v17_1089499_c1_139_480 113
533 3300050496 nmdc:mga07m45_326304_c1 nmdc:mga07m45_326304_c1_466_807 113
534 3300053111 Ga0500572_009945 Ga0500572_009945_55_396 113
535 3300053177 Ga0500636_0004687 Ga0500636_0004687_5782_6123 113
536 3300025303 Ga0209051_1033445 Ga0209051_10334451 114
537 3300050516 nmdc:mga0sz30_436456_c1 nmdc:mga0sz30_436456_c1_143_487 114
538 iso_pu_bacteria 2899803654 2899806060 114
539 iso_pu_bacteria 2989349275 2989354345 114
540 3300006946 Ga0079104_1001803 Ga0079104_10018031 115
541 3300006946 Ga0079104_1003024 Ga0079104_10030242 115
542 3300021321 Ga0214542_1000010 Ga0214542_100001027 115
543 3300021327 Ga0214543_1000003 Ga0214543_1000003350 115
544 3300021327 Ga0214543_1000004 Ga0214543_100000449 115
545 3300022739 Ga0228711_1000001 Ga0228711_1000001198 115
546 3300022740 Ga0228710_1000001 Ga0228710_1000001126 115
547 3300025263 Ga0209565_1035278 Ga0209565_10352782 115
548 3300025295 Ga0209564_1027199 Ga0209564_10271992 115
549 3300025299 Ga0209256_1000351 Ga0209256_100035136 115
550 3300027111 Ga0209281_1000164 Ga0209281_1000164103 115
551 3300027111 Ga0209281_1000377 Ga0209281_100037756 115
552 3300027666 Ga0209282_1000007 Ga0209282_100000753 115
553 3300031548 Ga0307408_100090670 Ga0307408_1000906702 115
554 3300031731 Ga0307405_10682941 Ga0307405_106829411 115
555 3300031852 Ga0307410_10175831 Ga0307410_101758313 115
556 3300031911 Ga0307412_11334284 Ga0307412_113342841 115
557 3300031967 Ga0315914_1000006 Ga0315914_1000006189 115
558 3300031995 Ga0307409_100078385 Ga0307409_1000783852 115
559 3300032002 Ga0307416_100112706 Ga0307416_1001127064 115
560 3300033430 Ga0315913_1000002 Ga0315913_100000253 115
561 3300033464 Ga0315915_1000001 Ga0315915_1000001433 115
562 3300041413 Ga0439465_0045329 Ga0439465_0045329_914_1273 115
563 3300042007 Ga0439449_0007498 Ga0439449_0007498_2309_2659 115
564 3300049569 Ga0501032_0531480 Ga0501032_0531480_201_548 115
565 3300049760 Ga0501263_052826 Ga0501263_052826_145_495 115
566 iso_pu_bacteria 2508501122 2509107426 115
567 iso_pu_bacteria 2509276019 2509374582 115
568 iso_pu_bacteria 2558860100 2558863611 115
569 iso_pu_bacteria 2643221557 2643807333 115
570 iso_pu_bacteria 2643221610 2644069745 115
571 iso_pu_bacteria 2643221668 2644380716 115
572 iso_pu_bacteria 2643221675 2644414621 115
573 iso_pu_bacteria 2643221680 2644448278 115
574 iso_pu_bacteria 2643221726 2644689415 115
575 iso_pu_bacteria 2657244999 2657682195 115
576 iso_pu_bacteria 2690316117 2692316944 115
577 iso_pu_bacteria 2751185821 2753462934 115
578 iso_pu_bacteria 2791355082 2792584041 115
579 iso_pu_bacteria 2791355091 2792622156 115
580 iso_pu_bacteria 2791355092 2792628279 115
581 iso_pu_bacteria 2791355094 2792638463 115
582 iso_pu_bacteria 2802429268 2804751213 115
583 iso_pu_bacteria 2838074704 2838076319 115
584 iso_pu_bacteria 2847417321 2847417987 115
585 iso_pu_bacteria 2848992105 2848992964 115
586 iso_pu_bacteria 2850079185 2850080350 115
587 iso_pu_bacteria 2855872281 2855879026 115
588 iso_pu_bacteria 2896384573 2896386519 115
589 iso_pu_bacteria 2913295892 2913297560 115
590 iso_pu_bacteria 2920760137 2920762995 115
591 iso_pu_bacteria 643692032 643824963 115
592 iso_pu_bacteria 8049293176 8049293794 115
593 3300025297 Ga0209758_1030705 Ga0209758_10307054 116
594 3300028794 Ga0307515_10018668 Ga0307515_100186688 116
595 3300041404 Ga0439436_0006782 Ga0439436_0006782_555_917 116
596 3300041411 Ga0439466_0012572 Ga0439466_0012572_648_1010 116
597 3300041413 Ga0439465_0005740 Ga0439465_0005740_1785_2147 116
598 3300042007 Ga0439449_0066791 Ga0439449_0066791_470_832 116
599 3300042010 Ga0439452_084578 Ga0439452_084578_159_521 116
600 3300042015 Ga0439462_0052665 Ga0439462_0052665_417_779 116
601 3300042122 Ga0450920_113986 Ga0450920_113986_150_512 116
602 3300042146 Ga0450907_008043 Ga0450907_008043_745_1107 116
603 3300042435 Ga0439434_0024842 Ga0439434_0024842_534_896 116
604 3300046660 Ga0495625_0017921 Ga0495625_0017921_2767_3129 116
605 3300046674 Ga0495588_0398355 Ga0495588_0398355_286_648 116
606 3300049570 Ga0501033_0000038 Ga0501033_0000038_109806_110156 116
607 3300049822 Ga0501035_0000367 Ga0501035_0000367_17258_17608 116
608 3300053099 Ga0500654_102319 Ga0500654_102319_130_492 116
609 3300053151 Ga0500604_0053854 Ga0500604_0053854_687_1049 116
610 iso_pu_bacteria 2510917022 2511136868 116
611 iso_pu_bacteria 2513237159 2513999398 116
612 iso_pu_bacteria 2524023209 2524457879 116
613 iso_pu_bacteria 2582581306 2585266368 116
614 iso_pu_bacteria 2582581307 2585275786 116
615 iso_pu_bacteria 2582581308 2585278766 116
616 iso_pu_bacteria 2582581315 2585325619 116
617 iso_pu_bacteria 2582581865 2585387343 116
618 iso_pu_bacteria 2585427527 2585535876 116
619 iso_pu_bacteria 2585427530 2585554041 116
620 iso_pu_bacteria 2585427531 2585559295 116
621 iso_pu_bacteria 2585427608 2585901240 116
622 iso_pu_bacteria 2585427609 2585905329 116
623 iso_pu_bacteria 2585428125 2587979555 116
624 iso_pu_bacteria 2615840626 2616305960 116
625 iso_pu_bacteria 2643221689 2644500851 116
626 iso_pu_bacteria 2818991453 2819639389 116
627 iso_pu_bacteria 2842298080 2842300505 116
628 iso_pu_bacteria 2842357229 2842358377 116
629 iso_pu_bacteria 2842509118 2842509583 116
630 iso_pu_bacteria 2842521101 2842525190 116
631 iso_pu_bacteria 2852387548 2852388922 116
632 iso_pu_bacteria 8057575449 8057581772 116
633 iso_pu_bacteria 2582581316 2585329774 117
634 iso_pu_bacteria 2615840698 2616553796 117
635 iso_pu_bacteria 2617270742 2617381957 117
636 iso_pu_bacteria 2667528174 2671112723 117
637 iso_pu_bacteria 2775507266 2778177327 117
638 iso_pu_bacteria 2818991448 2819612530 117
639 iso_pu_bacteria 2838029111 2838031275 117
640 iso_pu_bacteria 2842475841 2842478130 117
641 iso_pu_bacteria 2842482326 2842482716 117
642 iso_pu_bacteria 2842502639 2842504939 117
643 iso_pu_bacteria 2919408235 2919409162 117
644 iso_pu_bacteria 3005416602 3005417707 117
645 iso_pu_bacteria 8005314921 8005315062 117
646 iso_pu_bacteria 8005484373 8005485766 117
647 iso_pu_bacteria 8005645114 8005645738 117
648 iso_pu_bacteria 8005682033 8005684740 117
649 3300013105 Ga0157369_10353922 Ga0157369_103539224 119
650 3300025206 Ga0209435_100036 Ga0209435_10003642 119
651 3300025233 Ga0209437_100036 Ga0209437_100036390 119
652 3300025246 Ga0209646_1000132 Ga0209646_100013242 119
653 3300025261 Ga0209233_1000056 Ga0209233_1000056201 119
654 3300044694 Ga0466963_0086175 Ga0466963_0086175_126_485 119
655 3300048922 Ga0496119_0003866 Ga0496119_0003866_4861_5220 119
656 3300048923 Ga0496120_0460038 Ga0496120_0460038_173_532 119
657 3300048925 Ga0496122_0006419 Ga0496122_0006419_9548_9907 119
658 3300048926 Ga0496123_0013827 Ga0496123_0013827_754_1113 119
659 3300048927 Ga0496124_0014413 Ga0496124_0014413_7081_7440 119
660 3300002739 JGI25158J39367_1027174 JGI25158J39367_10271741 120
661 3300002987 JGI25159J45721_1003582 JGI25159J45721_10035825 120
662 3300003214 JGI25165J46597_1002553 JGI25165J46597_10025534 120
663 3300003322 rootL2_10021533 rootL2_100215332 120
664 3300003354 JGI25160J50197_1000047 JGI25160J50197_1000047134 120
665 3300003374 JGI25161J50226_1000033 JGI25161J50226_1000033134 120
666 3300003752 Ga0055539_1008530 Ga0055539_10085302 120
667 3300004625 Ga0055543_1000075 Ga0055543_100007523 120
668 3300005262 Ga0065165_1000227 Ga0065165_100022791 120
669 3300005548 Ga0070665_100138823 Ga0070665_1001388232 120
670 3300005614 Ga0068856_100785705 Ga0068856_1007857052 120
671 3300005616 Ga0068852_100123018 Ga0068852_1001230182 120
672 3300005834 Ga0068851_10074413 Ga0068851_100744132 120
673 3300006042 Ga0075368_10393062 Ga0075368_103930621 120
674 3300006353 Ga0075370_10042337 Ga0075370_100423374 120
675 3300009093 Ga0105240_10000027 Ga0105240_10000027273 120
676 3300009148 Ga0105243_10236332 Ga0105243_102363323 120
677 3300009177 Ga0105248_10534503 Ga0105248_105345031 120
678 3300009545 Ga0105237_10001067 Ga0105237_1000106730 120
679 3300009551 Ga0105238_10337348 Ga0105238_103373482 120
680 3300010375 Ga0105239_10013845 Ga0105239_100138457 120
681 3300013104 Ga0157370_10000223 Ga0157370_1000022338 120
682 3300013105 Ga0157369_10354205 Ga0157369_103542052 120
683 3300015262 Ga0182007_10001781 Ga0182007_1000178114 120
684 3300015265 Ga0182005_1001567 Ga0182005_10015678 120
685 3300025253 Ga0209677_100419 Ga0209677_1004197 120
686 3300025256 Ga0209759_1024464 Ga0209759_10244643 120
687 3300025261 Ga0209233_1000064 Ga0209233_1000064288 120
688 3300025284 Ga0209130_1000038 Ga0209130_1000038267 120
689 3300025302 Ga0207426_1000081 Ga0207426_1000081307 120
690 3300025321 Ga0207656_10131770 Ga0207656_101317701 120
691 3300025913 Ga0207695_10000024 Ga0207695_10000024357 120
692 3300025914 Ga0207671_10001277 Ga0207671_100012775 120
693 3300025935 Ga0207709_10130888 Ga0207709_101308882 120
694 3300025981 Ga0207640_10128218 Ga0207640_101282183 120
695 3300026142 Ga0207698_10088159 Ga0207698_100881592 120
696 3300028379 Ga0268266_10107898 Ga0268266_101078981 120
697 3300046453 Ga0495627_059308 Ga0495627_059308_643_1005 120
698 3300046501 Ga0495607_0324333 Ga0495607_0324333_250_612 120
699 3300046506 Ga0495583_0078560 Ga0495583_0078560_511_873 120
700 3300046507 Ga0495606_0147413 Ga0495606_0147413_864_1226 120
701 3300046512 Ga0495610_0107844 Ga0495610_0107844_563_925 120
702 3300046522 Ga0495643_0219857 Ga0495643_0219857_309_671 120
703 3300046525 Ga0495663_0148987 Ga0495663_0148987_249_611 120
704 3300046530 Ga0495654_0162300 Ga0495654_0162300_584_946 120
705 3300046538 Ga0495609_0070983 Ga0495609_0070983_545_907 120
706 3300046660 Ga0495625_0094836 Ga0495625_0094836_1595_1957 120
707 3300046660 Ga0495625_0141837 Ga0495625_0141837_599_961 120
708 3300046674 Ga0495588_0411098 Ga0495588_0411098_23_385 120
709 3300047443 Ga0495687_063027 Ga0495687_063027_652_1014 120
710 3300047443 Ga0495687_158796 Ga0495687_158796_302_664 120
711 3300047470 Ga0495681_0050496 Ga0495681_0050496_1065_1427 120
712 3300047470 Ga0495681_0082886 Ga0495681_0082886_392_754 120
713 3300048903 Ga0496100_0091210 Ga0496100_0091210_1529_1891 120
714 3300048905 Ga0496102_0002635 Ga0496102_0002635_1938_2300 120
715 3300048906 Ga0496103_0014923 Ga0496103_0014923_2313_2675 120
716 3300048915 Ga0496112_1112220 Ga0496112_1112220_98_460 120
717 3300048919 Ga0496116_0235790 Ga0496116_0235790_458_820 120
718 3300048920 Ga0496117_0000337 Ga0496117_0000337_15479_15841 120
719 3300048921 Ga0496118_0000396 Ga0496118_0000396_66198_66560 120
720 3300048922 Ga0496119_0108686 Ga0496119_0108686_270_632 120
721 3300048922 Ga0496119_0168446 Ga0496119_0168446_93_455 120
722 3300048923 Ga0496120_0042526 Ga0496120_0042526_2095_2457 120
723 3300048924 Ga0496121_0001010 Ga0496121_0001010_29075_29437 120
724 3300048924 Ga0496121_0146053 Ga0496121_0146053_473_835 120
725 3300048925 Ga0496122_0005041 Ga0496122_0005041_13646_14008 120
726 3300048926 Ga0496123_0003144 Ga0496123_0003144_13145_13507 120
727 3300048927 Ga0496124_0013444 Ga0496124_0013444_5395_5757 120
728 3300048928 Ga0496125_0010798 Ga0496125_0010798_6371_6733 120
729 3300048928 Ga0496125_0192517 Ga0496125_0192517_626_988 120
730 3300048929 Ga0496126_0043168 Ga0496126_0043168_1521_1883 120
731 3300053086 Ga0500578_0428584 Ga0500578_0428584_278_640 120
732 3300053177 Ga0500636_0384134 Ga0500636_0384134_87_449 120
733 3300001979 JGI24740J21852_10001010 JGI24740J21852_1000101014 121
734 3300002704 JGI25155J39150_1000089 JGI25155J39150_100008923 121
735 3300002705 JGI25156J39149_1000147 JGI25156J39149_100014722 121
736 3300002737 JGI25162J39368_1000243 JGI25162J39368_100024337 121
737 3300002737 JGI25162J39368_1000372 JGI25162J39368_100037226 121
738 3300002738 JGI25154J39366_1000160 JGI25154J39366_100016042 121
739 3300002741 JGI25157J39369_1000190 JGI25157J39369_100019022 121
740 3300003214 JGI25165J46597_1000318 JGI25165J46597_100031830 121
741 3300003214 JGI25165J46597_1000413 JGI25165J46597_100041325 121
742 3300003316 rootH1_10030544 rootH1_100305442 121
743 3300003320 rootH2_10130100 rootH2_101301003 121
744 3300003322 rootL2_10020846 rootL2_100208468 121
745 3300003323 rootH1_10055995 rootH1_100559952 121
746 3300005614 Ga0068856_100043734 Ga0068856_1000437346 121
747 3300025233 Ga0209437_100033 Ga0209437_100033137 121
748 3300025246 Ga0209646_1017381 Ga0209646_10173812 121
749 3300025250 Ga0209026_1000313 Ga0209026_100031321 121
750 3300025254 Ga0209148_1050991 Ga0209148_10509911 121
751 3300025256 Ga0209759_1000417 Ga0209759_100041721 121
752 3300025261 Ga0209233_1000152 Ga0209233_100015243 121
753 3300027312 Ga0209371_1003266 Ga0209371_10032663 121
754 3300030500 Ga0268256_1002974 Ga0268256_10029749 121
755 3300044706 Ga0466964_0249593 Ga0466964_0249593_181_546 121
756 3300044765 Ga0466970_0024757 Ga0466970_0024757_1592_1957 121
757 3300045836 Ga0466958_0120906 Ga0466958_0120906_1182_1547 121
758 3300045976 Ga0466967_0437960 Ga0466967_0437960_393_758 121
759 3300053125 Ga0500618_009376 Ga0500618_009376_674_1039 121
760 3300053177 Ga0500636_0212226 Ga0500636_0212226_619_984 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03334

PhaG_MnhG_YufB

Na+/H+ antiporter subunit

13

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qru-assembly1.cif.gz_G structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8393 5 94
6z16-assembly1.cif.gz_g structure of the mrp antiporter complex 0.8286 8 94
6cfw-assembly1.cif.gz_C cryoem structure of a respiratory membrane-bound hydrogenase 0.8069 8 95
7d3u-assembly1.cif.gz_F structure of mrp complex from dietzia sp. dq12-45-1b 0.7565 7 89
6cfw-assembly1.cif.gz_B cryoem structure of a respiratory membrane-bound hydrogenase 0.7485 13 91
ID Description Score Start End Superfamily
af_Q4DXG6_219_389_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.7579 8 85 1.20.58.390
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7499 11 94 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7449 16 94 1.10.287.3510
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7334 16 91 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7248 11 94 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A4Q6B9N9-F1-model_v4 Na+/H+ antiporter subunit G 0.9349 5 86 GO:0015385
GO:0016020
AF-E6J7C2-F1-model_v4 deleted 0.9315 2 92
AF-A0A3M6QYW5-F1-model_v4 Potassium:proton antiporter 0.9202 3 90 GO:0015385
GO:0016020
AF-A0A7Y9KKT8-F1-model_v4 deleted 0.9177 2 87
AF-A0A651FWW1-F1-model_v4 Monovalent cation/H(+) antiporter subunit G 0.9159 5 90 GO:0015385
GO:0016020

Feature Viewer

pLDDT pTM Quality
81.83 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map