F479342

General Info

Members Datasets Scaffolds Average Seq Length
756 277 1512 203

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10017743|Ga0207682_100177434
Length 233
Sequence MVRLYGGGREPRRDWLQYAPDMYEVSLMVRRLLLTAAVLAVAVSVAAQSPQGWKVRIDRSQNAQDPDNTPSLVFKPMGKGLHVKGGPAGTFWNGTTATGSYTLKATFNLQEPSNHTNYYGLVFGGSNLEGASQAYVYFVIAQNGTFLVRQRQGGENVTDVVNRQPNAAVRQPGANGQSSNALEVRVSGDTVSYVVNGTVVHSGPKGGLKTDGLVGVRVNHVLDVEFEGFEVGR

Samples

Sample ID Description Type Environment
1 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 31.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207682_10017743 3300025893 Bacteria 2779
2 JGI24746J21847_1005143 3300001977 Bacteria 2047
3 JGI24035J26624_1004124 3300002126 Bacteria 1375
4 JGI24751J29686_10030048 3300002459 Eukaryota 1127
5 Ga0065714_10093837 3300005288 Bacteria 1817
6 Ga0065714_10174277 3300005288 Bacteria 989
7 Ga0065704_10055006 3300005289 Unclassified 668
8 Ga0065704_10361544 3300005289 Unclassified 796
9 Ga0065704_10368347 3300005289 Unclassified 788
10 Ga0065712_10009205 3300005290 Bacteria 4113
11 Ga0065712_10013386 3300005290 Bacteria 1898
12 Ga0065712_10016779 3300005290 Unclassified 2519
13 Ga0065712_10070342 3300005290 Bacteria 6093
14 Ga0065712_10132431 3300005290 Bacteria 1534
15 Ga0065715_10012859 3300005293 Unclassified 1946
16 Ga0065715_10015982 3300005293 Bacteria 1922
17 Ga0065715_10102841 3300005293 Bacteria 3081
18 Ga0065715_10264685 3300005293 Unclassified 1128
19 Ga0065715_10284814 3300005293 Unclassified 1071
20 Ga0065707_10005743 3300005295 Bacteria 4370
21 Ga0065707_10355891 3300005295 Unclassified 911
22 Ga0070676_10007765 3300005328 Bacteria 5761
23 Ga0070676_10045415 3300005328 Bacteria 2559
24 Ga0070676_10170297 3300005328 Bacteria 1408
25 Ga0070690_100048916 3300005330 Unclassified 2694
26 Ga0070690_100050083 3300005330 Bacteria 2664
27 Ga0070690_100144217 3300005330 Bacteria 1619
28 Ga0070690_100613665 3300005330 Unclassified 827
29 Ga0070670_100006569 3300005331 Bacteria 9853
30 Ga0070670_100021124 3300005331 Bacteria 5599
31 Ga0070677_10001616 3300005333 Bacteria 7121
32 Ga0070677_10126319 3300005333 Bacteria 1161
33 Ga0070677_10161128 3300005333 Bacteria 1053
34 Ga0070677_10354541 3300005333 Unclassified 761
35 Ga0068869_100006910 3300005334 Bacteria 7220
36 Ga0068869_100006925 3300005334 Bacteria 7216
37 Ga0068869_100043783 3300005334 Bacteria 3217
38 Ga0068869_100044472 3300005334 Bacteria 3193
39 Ga0068869_100083639 3300005334 Unclassified 2387
40 Ga0068869_100351782 3300005334 Unclassified 1201
41 Ga0068869_100391082 3300005334 Bacteria 1142
42 Ga0070666_10095528 3300005335 Bacteria 2045
43 Ga0070666_10098278 3300005335 Unclassified 2015
44 Ga0070666_10556244 3300005335 Unclassified 835
45 Ga0070680_100294695 3300005336 Unclassified 1375
46 Ga0070680_100420143 3300005336 Bacteria 1141
47 Ga0068868_100079098 3300005338 Bacteria 2633
48 Ga0068868_100300417 3300005338 Unclassified 1363
49 Ga0070660_100129286 3300005339 Bacteria 2020
50 Ga0070689_100040662 3300005340 Bacteria 3565
51 Ga0070689_100326355 3300005340 Unclassified 1283
52 Ga0070689_100676170 3300005340 Bacteria 900
53 Ga0070687_100035834 3300005343 Unclassified 2468
54 Ga0070687_100087054 3300005343 Bacteria 1719
55 Ga0070687_100111545 3300005343 Unclassified 1549
56 Ga0070661_100053793 3300005344 Unclassified 2947
57 Ga0070661_100254120 3300005344 Unclassified 1357
58 Ga0070661_100376318 3300005344 Bacteria 1119
59 Ga0070692_10362957 3300005345 Bacteria 903
60 Ga0070669_100018916 3300005353 Bacteria 4923
61 Ga0070669_100121457 3300005353 Unclassified 1993
62 Ga0070669_100187033 3300005353 Unclassified 1623
63 Ga0070669_100264451 3300005353 Bacteria 1374
64 Ga0070675_100000983 3300005354 Bacteria 20391
65 Ga0070675_100011628 3300005354 Bacteria 6894
66 Ga0070675_100013860 3300005354 Bacteria 6347
67 Ga0070675_100021025 3300005354 Bacteria 5211
68 Ga0070675_100021973 3300005354 Bacteria 5098
69 Ga0070675_100058314 3300005354 Unclassified 3184
70 Ga0070675_100184277 3300005354 Bacteria 1806
71 Ga0070675_100289822 3300005354 Unclassified 1440
72 Ga0070671_100012127 3300005355 Bacteria 6935
73 Ga0070671_100050797 3300005355 Bacteria 3449
74 Ga0070671_100056380 3300005355 Unclassified 3269
75 Ga0070674_100027380 3300005356 Bacteria 3735
76 Ga0070674_100322014 3300005356 Unclassified 1240
77 Ga0070673_100033030 3300005364 Bacteria 3902
78 Ga0070673_100065688 3300005364 Bacteria 2895
79 Ga0070673_100098035 3300005364 Unclassified 2408
80 Ga0070673_100127761 3300005364 Bacteria 2129
81 Ga0070673_100131809 3300005364 Bacteria 2098
82 Ga0070673_100403016 3300005364 Unclassified 1223
83 Ga0070688_100012564 3300005365 Bacteria 4746
84 Ga0070688_100016818 3300005365 Bacteria 4188
85 Ga0070688_100064200 3300005365 Unclassified 2329
86 Ga0070688_100136776 3300005365 Unclassified 1660
87 Ga0070688_100267772 3300005365 Bacteria 1223
88 Ga0070688_100269758 3300005365 Bacteria 1219
89 Ga0070659_100411613 3300005366 Unclassified 1143
90 Ga0070659_100543507 3300005366 Unclassified 994
91 Ga0070667_100002265 3300005367 Bacteria 16948
92 Ga0070667_100420199 3300005367 Bacteria 1219
93 Ga0070667_100428307 3300005367 Bacteria 1207
94 Ga0070709_10048012 3300005434 Bacteria 2662
95 Ga0070713_100203537 3300005436 Bacteria 1789
96 Ga0070705_100089000 3300005440 Bacteria 1918
97 Ga0070705_100172888 3300005440 Bacteria 1456
98 Ga0070700_100004521 3300005441 Bacteria 7273
99 Ga0070700_100087985 3300005441 Unclassified 2020
100 Ga0070700_100152962 3300005441 Bacteria 1580
101 Ga0070700_100164625 3300005441 Unclassified 1530
102 Ga0070694_100120738 3300005444 Bacteria 1880
103 Ga0070694_100140498 3300005444 Unclassified 1754
104 Ga0070694_100234079 3300005444 Bacteria 1383
105 Ga0070694_100545792 3300005444 Bacteria 927
106 Ga0070708_100035925 3300005445 Unclassified 4320
107 Ga0070708_100120701 3300005445 Bacteria 2418
108 Ga0070708_100239027 3300005445 Bacteria 1705
109 Ga0070708_101016756 3300005445 Unclassified 777
110 Ga0070663_100161851 3300005455 Unclassified 1723
111 Ga0070678_100273902 3300005456 Bacteria 1424
112 Ga0070678_100284080 3300005456 Unclassified 1400
113 Ga0070678_100509568 3300005456 Unclassified 1063
114 Ga0070678_100655796 3300005456 Unclassified 942
115 Ga0070662_100135739 3300005457 Unclassified 1902
116 Ga0070662_100181685 3300005457 Unclassified 1658
117 Ga0070681_10449305 3300005458 Bacteria 1201
118 Ga0068867_100001289 3300005459 Bacteria 17289
119 Ga0068867_100369075 3300005459 Bacteria 1202
120 Ga0070685_10004102 3300005466 Bacteria 7359
121 Ga0070685_10083951 3300005466 Unclassified 1914
122 Ga0070685_10099318 3300005466 Bacteria 1775
123 Ga0070685_10731151 3300005466 Unclassified 724
124 Ga0070706_100140194 3300005467 Unclassified 2257
125 Ga0070707_100183368 3300005468 Bacteria 2041
126 Ga0070707_100289745 3300005468 Bacteria 1591
127 Ga0070707_100944704 3300005468 Bacteria 827
128 Ga0070698_100027533 3300005471 Bacteria 5908
129 Ga0070698_100045614 3300005471 Bacteria 4486
130 Ga0070698_100264511 3300005471 Bacteria 1652
131 Ga0070698_100786221 3300005471 Bacteria 895
132 Ga0070698_100786552 3300005471 Unclassified 895
133 Ga0070699_100000553 3300005518 Bacteria 35310
134 Ga0070699_100016158 3300005518 Bacteria 6407
135 Ga0070699_100117262 3300005518 Bacteria 2340
136 Ga0070699_100541669 3300005518 Unclassified 1059
137 Ga0070699_100657071 3300005518 Bacteria 957
138 Ga0070684_100399232 3300005535 Bacteria 1267
139 Ga0070697_100035947 3300005536 Bacteria 3999
140 Ga0070672_100009529 3300005543 Bacteria 6702
141 Ga0070672_100046546 3300005543 Bacteria 3361
142 Ga0070672_100073097 3300005543 Unclassified 2732
143 Ga0070672_100408526 3300005543 Unclassified 1165
144 Ga0070672_100477852 3300005543 Unclassified 1076
145 Ga0070672_100693163 3300005543 Bacteria 892
146 Ga0070686_100011938 3300005544 Bacteria 4939
147 Ga0070686_100039116 3300005544 Bacteria 2953
148 Ga0070686_100052420 3300005544 Bacteria 2601
149 Ga0070686_100199411 3300005544 Unclassified 1433
150 Ga0070695_100004919 3300005545 Bacteria 7880
151 Ga0070695_100155643 3300005545 Unclassified 1599
152 Ga0070695_100418455 3300005545 Bacteria 1020
153 Ga0070695_100943220 3300005545 Bacteria 699
154 Ga0070696_100117952 3300005546 Bacteria 1918
155 Ga0070696_100245786 3300005546 Unclassified 1351
156 Ga0070696_100274129 3300005546 Unclassified 1284
157 Ga0070696_100424146 3300005546 Bacteria 1045
158 Ga0070665_100153782 3300005548 Unclassified 2302
159 Ga0070665_100186363 3300005548 Bacteria 2076
160 Ga0070665_100203607 3300005548 Bacteria 1979
161 Ga0070665_100353088 3300005548 Bacteria 1476
162 Ga0070704_100058365 3300005549 Bacteria 2749
163 Ga0070704_100081241 3300005549 Bacteria 2387
164 Ga0070704_100091940 3300005549 Bacteria 2264
165 Ga0070704_100114855 3300005549 Bacteria 2056
166 Ga0070704_100134768 3300005549 Bacteria 1920
167 Ga0070704_100448316 3300005549 Archaea 1111
168 Ga0070664_100002078 3300005564 Bacteria 15993
169 Ga0070664_100006815 3300005564 Bacteria 9213
170 Ga0070664_100008738 3300005564 Bacteria 8202
171 Ga0070664_100348862 3300005564 Bacteria 1346
172 Ga0068857_100631551 3300005577 Unclassified 1014
173 Ga0068857_100658257 3300005577 Unclassified 993
174 Ga0068857_101495169 3300005577 Unclassified 658
175 Ga0068854_100130892 3300005578 Bacteria 1916
176 Ga0068854_100941753 3300005578 Unclassified 761
177 Ga0070702_100045329 3300005615 Bacteria 2487
178 Ga0068852_100138628 3300005616 Bacteria 2249
179 Ga0068852_100315924 3300005616 Unclassified 1516
180 Ga0068852_101129328 3300005616 Unclassified 804
181 Ga0068859_100003638 3300005617 Bacteria 15710
182 Ga0068859_100019123 3300005617 Bacteria 6879
183 Ga0068859_100026655 3300005617 Bacteria 5796
184 Ga0068859_100038490 3300005617 Bacteria 4798
185 Ga0068859_100083188 3300005617 Bacteria 3243
186 Ga0068859_100112308 3300005617 Unclassified 2788
187 Ga0068859_100252354 3300005617 Bacteria 1854
188 Ga0068859_100410008 3300005617 Unclassified 1451
189 Ga0068859_101036096 3300005617 Unclassified 902
190 Ga0068864_100056758 3300005618 Bacteria 3383
191 Ga0068864_100076770 3300005618 Bacteria 2920
192 Ga0068864_100092485 3300005618 Unclassified 2670
193 Ga0068864_100128969 3300005618 Bacteria 2270
194 Ga0068864_100156469 3300005618 Unclassified 2069
195 Ga0068864_100179360 3300005618 Bacteria 1936
196 Ga0068866_10489441 3300005718 Unclassified 812
197 Ga0068861_100042322 3300005719 Unclassified 3413
198 Ga0068861_100054615 3300005719 Bacteria 3043
199 Ga0068861_100138615 3300005719 Unclassified 1983
200 Ga0068861_100202315 3300005719 Bacteria 1668
201 Ga0068861_100208121 3300005719 Unclassified 1646
202 Ga0068861_100217839 3300005719 Bacteria 1612
203 Ga0068861_100465516 3300005719 Bacteria 1136
204 Ga0068861_100718317 3300005719 Unclassified 930
205 Ga0068861_100779490 3300005719 Unclassified 895
206 Ga0068851_10001826 3300005834 Bacteria 9320
207 Ga0068870_10003305 3300005840 Bacteria 6813
208 Ga0068870_10009468 3300005840 Bacteria 4434
209 Ga0068870_10016845 3300005840 Unclassified 3502
210 Ga0068870_10048555 3300005840 Unclassified 2236
211 Ga0068863_100020293 3300005841 Bacteria 6356
212 Ga0068863_100022805 3300005841 Bacteria 5980
213 Ga0068863_100155800 3300005841 Bacteria 2187
214 Ga0068858_100034755 3300005842 Bacteria 4675
215 Ga0068858_100066003 3300005842 Unclassified 3349
216 Ga0068858_100081931 3300005842 Bacteria 2999
217 Ga0068858_100145250 3300005842 Unclassified 2228
218 Ga0068858_100147182 3300005842 Bacteria 2212
219 Ga0068858_100193167 3300005842 Unclassified 1923
220 Ga0068858_100786281 3300005842 Bacteria 928
221 Ga0068858_100905990 3300005842 Bacteria 862
222 Ga0068860_100075140 3300005843 Bacteria 3214
223 Ga0068860_100082353 3300005843 Unclassified 3060
224 Ga0068860_100133612 3300005843 Bacteria 2382
225 Ga0068860_100200245 3300005843 Unclassified 1935
226 Ga0068862_100002949 3300005844 Bacteria 14875
227 Ga0068862_100097953 3300005844 Bacteria 2561
228 Ga0068862_100100144 3300005844 Bacteria 2534
229 Ga0068862_100401909 3300005844 Bacteria 1282
230 Ga0068862_100845995 3300005844 Bacteria 896
231 Ga0075432_10035123 3300006058 Bacteria 1742
232 Ga0097621_100025433 3300006237 Bacteria 4633
233 Ga0097621_100191882 3300006237 Unclassified 1769
234 Ga0097621_100195799 3300006237 Unclassified 1752
235 Ga0097621_100226180 3300006237 Unclassified 1632
236 Ga0097621_100265309 3300006237 Bacteria 1507
237 Ga0097621_100535433 3300006237 Bacteria 1065
238 Ga0068871_100022711 3300006358 Bacteria 4841
239 Ga0068871_100153817 3300006358 Unclassified 1963
240 Ga0068871_100572528 3300006358 Unclassified 1025
241 Ga0068871_101281149 3300006358 Unclassified 689
242 Ga0075428_100003057 3300006844 Bacteria 18255
243 Ga0075428_100008922 3300006844 Bacteria 11125
244 Ga0075428_100027522 3300006844 Bacteria 6290
245 Ga0075428_100109979 3300006844 Bacteria 3002
246 Ga0075428_100513291 3300006844 Unclassified 1282
247 Ga0075428_100739475 3300006844 Bacteria 1047
248 Ga0075430_100037605 3300006846 Bacteria 4103
249 Ga0075430_100043472 3300006846 Bacteria 3797
250 Ga0075430_100209404 3300006846 Bacteria 1618
251 Ga0075430_100343578 3300006846 Bacteria 1233
252 Ga0075431_100003702 3300006847 Bacteria 14851
253 Ga0075431_100030624 3300006847 Bacteria 5544
254 Ga0075431_100130018 3300006847 Bacteria 2598
255 Ga0075431_100232041 3300006847 Unclassified 1880
256 Ga0075431_101091997 3300006847 Unclassified 763
257 Ga0075433_10022132 3300006852 Bacteria 5335
258 Ga0075433_10062026 3300006852 Unclassified 3274
259 Ga0075433_10287207 3300006852 Bacteria 1457
260 Ga0075433_10573999 3300006852 Unclassified 991
261 Ga0075433_10881674 3300006852 Bacteria 781
262 Ga0075434_100000990 3300006871 Bacteria 22991
263 Ga0075434_100083144 3300006871 Bacteria 3199
264 Ga0075434_100085003 3300006871 Bacteria 3163
265 Ga0075434_100290133 3300006871 Bacteria 1656
266 Ga0075434_100480118 3300006871 Bacteria 1264
267 Ga0075429_100006962 3300006880 Bacteria 9825
268 Ga0075429_100008937 3300006880 Bacteria 8706
269 Ga0075429_100086124 3300006880 Bacteria 2739
270 Ga0075429_100162639 3300006880 Bacteria 1955
271 Ga0075429_100305615 3300006880 Bacteria 1393
272 Ga0068865_100023277 3300006881 Bacteria 4054
273 Ga0068865_100143530 3300006881 Bacteria 1803
274 Ga0075436_100038488 3300006914 Unclassified 3301
275 Ga0075436_100083659 3300006914 Bacteria 2214
276 Ga0075436_100304782 3300006914 Bacteria 1142
277 Ga0097620_100003638 3300006931 Bacteria 15710
278 Ga0097620_100019123 3300006931 Bacteria 6879
279 Ga0097620_100026654 3300006931 Bacteria 5796
280 Ga0097620_100038490 3300006931 Bacteria 4798
281 Ga0097620_100083190 3300006931 Bacteria 3243
282 Ga0097620_100112310 3300006931 Unclassified 2788
283 Ga0097620_100252353 3300006931 Bacteria 1854
284 Ga0097620_100409948 3300006931 Unclassified 1451
285 Ga0097620_101035943 3300006931 Unclassified 902
286 Ga0075435_100022243 3300007076 Bacteria 4890
287 Ga0075435_100027489 3300007076 Bacteria 4451
288 Ga0075435_100041049 3300007076 Unclassified 3697
289 Ga0105251_10187770 3300009011 Unclassified 931
290 Ga0111539_10004383 3300009094 Bacteria 18467
291 Ga0111539_10011979 3300009094 Bacteria 10874
292 Ga0111539_10072688 3300009094 Bacteria 4055
293 Ga0111539_10103057 3300009094 Bacteria 3349
294 Ga0111539_10146944 3300009094 Bacteria 2760
295 Ga0111539_10245133 3300009094 Bacteria 2086
296 Ga0111539_10387936 3300009094 Bacteria 1626
297 Ga0111539_10834278 3300009094 Bacteria 1072
298 Ga0105245_10365603 3300009098 Bacteria 1433
299 Ga0105245_10633658 3300009098 Bacteria 1098
300 Ga0105247_10050807 3300009101 Bacteria 2552
301 Ga0114129_10001044 3300009147 Bacteria 36277
302 Ga0114129_10003299 3300009147 Bacteria 22658
303 Ga0114129_10003670 3300009147 Bacteria 21598
304 Ga0114129_10003793 3300009147 Bacteria 21307
305 Ga0114129_10006502 3300009147 Bacteria 16577
306 Ga0114129_10014617 3300009147 Bacteria 11186
307 Ga0114129_10081391 3300009147 Bacteria 4501
308 Ga0114129_10099751 3300009147 Bacteria 4019
309 Ga0114129_10105157 3300009147 Unclassified 3901
310 Ga0114129_10132776 3300009147 Bacteria 3418
311 Ga0114129_10150265 3300009147 Unclassified 3188
312 Ga0114129_10741938 3300009147 Bacteria 1258
313 Ga0114129_10980296 3300009147 Unclassified 1066
314 Ga0114129_11119315 3300009147 Unclassified 985
315 Ga0114129_11439881 3300009147 Bacteria 849
316 Ga0114129_12071972 3300009147 Bacteria 687
317 Ga0105243_10017608 3300009148 Bacteria 5403
318 Ga0105243_10955770 3300009148 Bacteria 856
319 Ga0105242_10006778 3300009176 Bacteria 8831
320 Ga0105248_10001169 3300009177 Bacteria 29323
321 Ga0105248_10009576 3300009177 Bacteria 10665
322 Ga0105248_10054099 3300009177 Bacteria 4501
323 Ga0105248_10093960 3300009177 Bacteria 3377
324 Ga0105248_10284351 3300009177 Bacteria 1862
325 Ga0105248_10387103 3300009177 Bacteria 1574
326 Ga0105248_10410464 3300009177 Unclassified 1525
327 Ga0105248_10505597 3300009177 Unclassified 1362
328 Ga0105248_11114920 3300009177 Bacteria 892
329 Ga0105248_11368695 3300009177 Unclassified 801
330 Ga0105238_10010731 3300009551 Bacteria 9200
331 Ga0105249_10006782 3300009553 Bacteria 9978
332 Ga0105249_10131423 3300009553 Bacteria 2391
333 Ga0105249_10478752 3300009553 Unclassified 1287
334 Ga0105249_10790749 3300009553 Bacteria 1012
335 Ga0105246_10066634 3300011119 Bacteria 2521
336 Ga0105246_10072242 3300011119 Unclassified 2432
337 Ga0105246_10147897 3300011119 Unclassified 1775
338 Ga0105246_10529172 3300011119 Bacteria 1006
339 Ga0157369_10027020 3300013105 Bacteria 6364
340 Ga0157374_10072409 3300013296 Bacteria 3251
341 Ga0157374_11398521 3300013296 Unclassified 722
342 Ga0163162_10007414 3300013306 Bacteria 10667
343 Ga0163162_10078594 3300013306 Bacteria 3364
344 Ga0163162_10863684 3300013306 Unclassified 1019
345 Ga0157372_10982968 3300013307 Unclassified 978
346 Ga0157375_10259917 3300013308 Unclassified 1898
347 Ga0157375_10506587 3300013308 Bacteria 1371
348 Ga0157375_10730909 3300013308 Bacteria 1142
349 Ga0163163_10011771 3300014325 Bacteria 7950
350 Ga0163163_10019396 3300014325 Bacteria 6387
351 Ga0163163_10124318 3300014325 Unclassified 2616
352 Ga0163163_10197020 3300014325 Unclassified 2062
353 Ga0163163_10353325 3300014325 Bacteria 1526
354 Ga0157380_10051673 3300014326 Bacteria 3252
355 Ga0157380_10062724 3300014326 Bacteria 2978
356 Ga0157380_10105901 3300014326 Unclassified 2352
357 Ga0157380_10140742 3300014326 Bacteria 2073
358 Ga0157380_10150866 3300014326 Unclassified 2009
359 Ga0157380_10167954 3300014326 Bacteria 1914
360 Ga0157380_10318673 3300014326 Bacteria 1440
361 Ga0157380_10360002 3300014326 Unclassified 1365
362 Ga0157380_10677214 3300014326 Bacteria 1033
363 Ga0157380_10681642 3300014326 Unclassified 1030
364 Ga0157377_10002095 3300014745 Bacteria 8768
365 Ga0157377_10012548 3300014745 Bacteria 4264
366 Ga0157377_10028129 3300014745 Bacteria 3024
367 Ga0157377_10098161 3300014745 Unclassified 1741
368 Ga0157379_10063932 3300014968 Unclassified 3289
369 Ga0157379_10088578 3300014968 Bacteria 2776
370 Ga0157379_10129618 3300014968 Bacteria 2270
371 Ga0157376_10030121 3300014969 Bacteria 4329
372 Ga0157376_10052477 3300014969 Bacteria 3391
373 Ga0157376_10130973 3300014969 Unclassified 2238
374 Ga0157376_10519925 3300014969 Bacteria 1173
375 Ga0157376_10521341 3300014969 Bacteria 1171
376 Ga0163161_10039204 3300017792 Bacteria 3400
377 Ga0163161_10077035 3300017792 Unclassified 2449
378 Ga0163161_10120257 3300017792 Unclassified 1973
379 Ga0207673_1021888 3300025290 Unclassified 866
380 Ga0207697_10000501 3300025315 Bacteria 22026
381 Ga0207697_10004591 3300025315 Bacteria 6564
382 Ga0207682_10001258 3300025893 Bacteria 11722
383 Ga0207682_10049986 3300025893 Unclassified 1727
384 Ga0207682_10129154 3300025893 Bacteria 1127
385 Ga0207642_10017086 3300025899 Bacteria 2750
386 Ga0207688_10000052 3300025901 Bacteria 41714
387 Ga0207688_10002569 3300025901 Bacteria 9821
388 Ga0207688_10019798 3300025901 Bacteria 3669
389 Ga0207688_10181703 3300025901 Bacteria 1255
390 Ga0207680_10048100 3300025903 Unclassified 2531
391 Ga0207645_10002148 3300025907 Bacteria 15760
392 Ga0207645_10006108 3300025907 Bacteria 8658
393 Ga0207645_10055785 3300025907 Bacteria 2523
394 Ga0207645_10374133 3300025907 Unclassified 955
395 Ga0207645_10443193 3300025907 Bacteria 876
396 Ga0207643_10001284 3300025908 Bacteria 14666
397 Ga0207643_10010717 3300025908 Bacteria 4939
398 Ga0207643_10039636 3300025908 Unclassified 2650
399 Ga0207643_10045124 3300025908 Unclassified 2489
400 Ga0207643_10188967 3300025908 Bacteria 1250
401 Ga0207707_10548188 3300025912 Unclassified 983
402 Ga0207660_10135431 3300025917 Bacteria 1879
403 Ga0207660_10226733 3300025917 Bacteria 1468
404 Ga0207660_10455716 3300025917 Bacteria 1035
405 Ga0207662_10025137 3300025918 Bacteria 3429
406 Ga0207662_10052149 3300025918 Bacteria 2434
407 Ga0207662_10104726 3300025918 Unclassified 1757
408 Ga0207649_10034465 3300025920 Bacteria 3033
409 Ga0207649_10798498 3300025920 Bacteria 736
410 Ga0207681_10064737 3300025923 Bacteria 2525
411 Ga0207681_10067802 3300025923 Bacteria 2475
412 Ga0207681_10078345 3300025923 Bacteria 2325
413 Ga0207681_10359954 3300025923 Unclassified 1167
414 Ga0207694_10019700 3300025924 Bacteria 5103
415 Ga0207650_10011470 3300025925 Bacteria 6101
416 Ga0207650_10099244 3300025925 Unclassified 2238
417 Ga0207650_10206460 3300025925 Bacteria 1576
418 Ga0207650_10262658 3300025925 Unclassified 1401
419 Ga0207659_10004384 3300025926 Bacteria 8530
420 Ga0207659_10007125 3300025926 Bacteria 6860
421 Ga0207659_10012117 3300025926 Bacteria 5470
422 Ga0207659_10015893 3300025926 Unclassified 4888
423 Ga0207659_10025119 3300025926 Bacteria 3999
424 Ga0207659_10028129 3300025926 Unclassified 3817
425 Ga0207659_10030553 3300025926 Bacteria 3682
426 Ga0207659_10191241 3300025926 Bacteria 1629
427 Ga0207687_10073654 3300025927 Bacteria 2445
428 Ga0207644_10019395 3300025931 Bacteria 4613
429 Ga0207644_10033680 3300025931 Bacteria 3583
430 Ga0207644_10036672 3300025931 Unclassified 3444
431 Ga0207690_10412734 3300025932 Unclassified 1079
432 Ga0207706_10001919 3300025933 Bacteria 20419
433 Ga0207706_10073766 3300025933 Bacteria 3001
434 Ga0207706_11020472 3300025933 Bacteria 694
435 Ga0207686_10003282 3300025934 Bacteria 8699
436 Ga0207686_10242622 3300025934 Bacteria 1312
437 Ga0207709_10017868 3300025935 Bacteria 3965
438 Ga0207670_10122561 3300025936 Bacteria 1892
439 Ga0207670_10177183 3300025936 Unclassified 1603
440 Ga0207670_10352105 3300025936 Bacteria 1166
441 Ga0207670_10577305 3300025936 Unclassified 921
442 Ga0207669_10030623 3300025937 Bacteria 2992
443 Ga0207704_10002174 3300025938 Bacteria 8787
444 Ga0207704_10059727 3300025938 Bacteria 2355
445 Ga0207704_10265511 3300025938 Unclassified 1296
446 Ga0207665_10100897 3300025939 Bacteria 2015
447 Ga0207691_10005546 3300025940 Bacteria 12185
448 Ga0207691_10119184 3300025940 Bacteria 2341
449 Ga0207691_10208223 3300025940 Bacteria 1700
450 Ga0207691_10747481 3300025940 Unclassified 824
451 Ga0207711_10003302 3300025941 Bacteria 14017
452 Ga0207711_10022338 3300025941 Bacteria 5289
453 Ga0207711_10102873 3300025941 Bacteria 2529
454 Ga0207711_10127332 3300025941 Bacteria 2280
455 Ga0207711_10181785 3300025941 Unclassified 1913
456 Ga0207689_10002550 3300025942 Bacteria 16904
457 Ga0207689_10007329 3300025942 Bacteria 9677
458 Ga0207689_10033535 3300025942 Bacteria 4267
459 Ga0207689_10052265 3300025942 Unclassified 3367
460 Ga0207689_10091494 3300025942 Bacteria 2499
461 Ga0207689_10329881 3300025942 Bacteria 1267
462 Ga0207661_10649963 3300025944 Unclassified 969
463 Ga0207679_10005994 3300025945 Bacteria 7645
464 Ga0207679_10017138 3300025945 Bacteria 4824
465 Ga0207679_10028893 3300025945 Bacteria 3855
466 Ga0207651_10015997 3300025960 Bacteria 4378
467 Ga0207651_10031795 3300025960 Bacteria 3379
468 Ga0207651_10085423 3300025960 Unclassified 2289
469 Ga0207651_10119383 3300025960 Unclassified 1996
470 Ga0207651_10265418 3300025960 Bacteria 1411
471 Ga0207651_10488595 3300025960 Unclassified 1062
472 Ga0207651_10950880 3300025960 Bacteria 766
473 Ga0207712_10020916 3300025961 Unclassified 4292
474 Ga0207712_10155351 3300025961 Bacteria 1772
475 Ga0207712_10457603 3300025961 Bacteria 1083
476 Ga0207668_10237546 3300025972 Bacteria 1473
477 Ga0207668_10282399 3300025972 Bacteria 1362
478 Ga0207640_10073930 3300025981 Bacteria 2305
479 Ga0207658_10111514 3300025986 Bacteria 2163
480 Ga0207658_10140731 3300025986 Bacteria 1952
481 Ga0207658_10425096 3300025986 Bacteria 1172
482 Ga0207677_10028240 3300026023 Bacteria 3545
483 Ga0207677_10061076 3300026023 Bacteria 2608
484 Ga0207703_10019272 3300026035 Bacteria 5329
485 Ga0207703_10053804 3300026035 Bacteria 3272
486 Ga0207703_10239270 3300026035 Bacteria 1631
487 Ga0207703_10646631 3300026035 Unclassified 1003
488 Ga0207703_10888069 3300026035 Unclassified 853
489 Ga0207678_10026307 3300026067 Bacteria 5076
490 Ga0207678_10126371 3300026067 Bacteria 2181
491 Ga0207678_10630669 3300026067 Unclassified 941
492 Ga0207708_10003363 3300026075 Bacteria 11802
493 Ga0207708_10010450 3300026075 Bacteria 6892
494 Ga0207708_10166372 3300026075 Bacteria 1744
495 Ga0207708_10232008 3300026075 Bacteria 1482
496 Ga0207708_10253331 3300026075 Bacteria 1419
497 Ga0207641_10029420 3300026088 Bacteria 4542
498 Ga0207641_10033337 3300026088 Bacteria 4279
499 Ga0207641_10130015 3300026088 Bacteria 2260
500 Ga0207641_10335688 3300026088 Unclassified 1437
501 Ga0207641_11220352 3300026088 Unclassified 752
502 Ga0207648_10001685 3300026089 Bacteria 24225
503 Ga0207648_10052592 3300026089 Unclassified 3562
504 Ga0207648_10099355 3300026089 Bacteria 2549
505 Ga0207648_10121778 3300026089 Bacteria 2294
506 Ga0207676_10026869 3300026095 Unclassified 4282
507 Ga0207676_10048350 3300026095 Bacteria 3302
508 Ga0207676_10092278 3300026095 Unclassified 2490
509 Ga0207676_10141619 3300026095 Unclassified 2059
510 Ga0207676_10250191 3300026095 Unclassified 1595
511 Ga0207674_10599487 3300026116 Unclassified 1064
512 Ga0207674_10950147 3300026116 Bacteria 828
513 Ga0207674_11427633 3300026116 Unclassified 661
514 Ga0207675_100004199 3300026118 Bacteria 13939
515 Ga0207675_100054102 3300026118 Bacteria 3745
516 Ga0207675_100055730 3300026118 Bacteria 3689
517 Ga0207675_100060025 3300026118 Bacteria 3550
518 Ga0207675_100312739 3300026118 Bacteria 1532
519 Ga0207675_100581727 3300026118 Bacteria 1121
520 Ga0207675_101144881 3300026118 Unclassified 798
521 Ga0207683_10009596 3300026121 Bacteria 8249
522 Ga0207683_10037006 3300026121 Bacteria 4250
523 Ga0207683_10273328 3300026121 Unclassified 1544
524 Ga0207683_10436452 3300026121 Unclassified 1207
525 Ga0207683_10517198 3300026121 Unclassified 1103
526 Ga0207698_10197451 3300026142 Bacteria 1798
527 Ga0210002_1002612 3300027617 Bacteria 2606
528 Ga0209998_10086882 3300027717 Unclassified 763
529 Ga0209974_10059799 3300027876 Bacteria 1289
530 Ga0207428_10003471 3300027907 Bacteria 15300
531 Ga0207428_10192767 3300027907 Bacteria 1536
532 Ga0207428_10201014 3300027907 Bacteria 1499
533 Ga0268266_10132031 3300028379 Unclassified 2234
534 Ga0268266_10145067 3300028379 Bacteria 2133
535 Ga0268266_10390650 3300028379 Unclassified 1314
536 Ga0268265_10238972 3300028380 Bacteria 1601
537 Ga0268265_10282026 3300028380 Bacteria 1487
538 Ga0268265_10373866 3300028380 Bacteria 1309
539 Ga0268265_11310726 3300028380 Bacteria 724
540 Ga0268264_10179086 3300028381 Unclassified 1924
541 Ga0268264_10241448 3300028381 Bacteria 1673
542 Ga0268264_10380536 3300028381 Unclassified 1351
543 Ga0268264_10964128 3300028381 Unclassified 858
544 Ga0265332_10037927 3300031238 Unclassified 2089
545 Ga0265320_10000140 3300031240 Bacteria 61452
546 Ga0265329_10051387 3300031242 Unclassified 1312
547 Ga0265340_10017144 3300031247 Unclassified 3746
548 Ga0265339_10007975 3300031249 Bacteria 6792
549 Ga0265331_10000041 3300031250 Bacteria 191831
550 Ga0307408_100161566 3300031548 Bacteria 1780
551 Ga0307408_100192928 3300031548 Unclassified 1643
552 Ga0265313_10003390 3300031595 Bacteria 12939
553 Ga0265314_10010156 3300031711 Bacteria 7890
554 Ga0265314_10109794 3300031711 Bacteria 1755
555 Ga0265342_10001723 3300031712 Bacteria 20008
556 Ga0307405_10129309 3300031731 Bacteria 1742
557 Ga0307405_10423227 3300031731 Bacteria 1049
558 Ga0307409_100395784 3300031995 Unclassified 1318
559 Ga0307416_100013146 3300032002 Bacteria 5615
560 Ga0307416_100105252 3300032002 Bacteria 2469
561 Ga0307415_100138974 3300032126 Bacteria 1852
562 Ga0373945_0051887 3300035116 Bacteria 1510
563 Ga0373954_0201101 3300035118 Unclassified 979
564 Ga0373961_0125214 3300035241 Unclassified 855
565 Ga0373931_0367974 3300035691 Bacteria 903
566 Ga0373935_0231955 3300035692 Bacteria 1286
567 Ga0373927_0516937 3300035695 Unclassified 789
568 Ga0373937_0448888 3300036401 Unclassified 1224
569 Ga0373925_0434394 3300037068 Unclassified 1074
570 Ga0395905_1208952 3300037471 Unclassified 659
571 Ga0436364_1484599 3300037853 Bacteria 2691
572 Ga0439461_0028998 3300041410 Bacteria 1143
573 Ga0451853_2796683 3300041512 Unclassified 915
574 Ga0439431_0020051 3300041997 Bacteria 1594
575 Ga0450923_016337 3300042125 Bacteria 1397
576 Ga0439446_0028639 3300042156 Bacteria 1604
577 Ga0450908_049860 3300042184 Unclassified 728
578 Ga0439435_0012086 3300042436 Bacteria 2083
579 Ga0439435_0081175 3300042436 Unclassified 973
580 Ga0439460_0119313 3300042461 Unclassified 862
581 Ga0450916_004348 3300042530 Bacteria 1594
582 Ga0451577_1088009 3300042876 Unclassified 716
583 Ga0451577_1195997 3300042876 Unclassified 678
584 Ga0439440_0014564 3300042993 Bacteria 1699
585 Ga0466964_0095350 3300044706 Bacteria 1302
586 Ga0451576_0072265 3300045051 Bacteria 3590
587 Ga0451576_0314500 3300045051 Bacteria 1638
588 Ga0495592_0014249 3300046454 Bacteria 6039
589 Ga0495603_0089517 3300046455 Unclassified 1800
590 Ga0495629_0009843 3300046459 Bacteria 6977
591 Ga0495629_0507191 3300046459 Bacteria 813
592 Ga0495641_0191237 3300046461 Unclassified 917
593 Ga0495651_0042435 3300046462 Bacteria 3531
594 Ga0495653_0030476 3300046463 Bacteria 4296
595 Ga0495582_0298015 3300046473 Unclassified 927
596 Ga0495664_0014862 3300046477 Bacteria 4419
597 Ga0495664_0313302 3300046477 Bacteria 947
598 Ga0495618_0195185 3300046514 Unclassified 1282
599 Ga0495628_0025454 3300046516 Bacteria 4834
600 Ga0495628_0115376 3300046516 Bacteria 2063
601 Ga0495630_0055365 3300046517 Bacteria 2972
602 Ga0495630_0260465 3300046517 Unclassified 1325
603 Ga0495665_0158623 3300046531 Unclassified 1180
604 Ga0495640_0039183 3300046533 Bacteria 3327
605 Ga0495586_0309051 3300046535 Unclassified 906
606 Ga0495598_0097864 3300046537 Unclassified 966
607 Ga0495621_0021890 3300046539 Bacteria 2113
608 Ga0495621_0046453 3300046539 Unclassified 1541
609 Ga0495621_0053225 3300046539 Bacteria 1453
610 Ga0495621_0265854 3300046539 Unclassified 704
611 Ga0495645_0016833 3300046543 Bacteria 5232
612 Ga0495667_0018127 3300046559 Bacteria 4756
613 Ga0495656_0169622 3300046615 Unclassified 1066
614 Ga0495634_0036571 3300046642 Bacteria 3357
615 Ga0495635_0106997 3300046663 Unclassified 1910
616 Ga0495635_0245822 3300046663 Bacteria 1207
617 Ga0495659_0053943 3300046664 Bacteria 1470
618 Ga0495657_0217299 3300046675 Unclassified 1160
619 Ga0495623_0036329 3300046679 Bacteria 3157
620 Ga0495646_0019992 3300046680 Bacteria 4234
621 Ga0495647_0209941 3300046681 Unclassified 856
622 Ga0495658_0046228 3300046683 Bacteria 2447
623 Ga0495658_0188003 3300046683 Bacteria 1283
624 Ga0495658_0310939 3300046683 Bacteria 998
625 Ga0495669_0241646 3300046684 Bacteria 867
626 Ga0495613_0609616 3300046689 Unclassified 726
627 Ga0495624_0181337 3300046690 Unclassified 1283
628 Ga0495600_0466134 3300046809 Unclassified 780
629 Ga0495604_0008402 3300047317 Bacteria 8161
630 Ga0495674_0501729 3300047319 Unclassified 970
631 Ga0495676_0013854 3300047321 Bacteria 7231
632 Ga0495680_0038090 3300047322 Bacteria 3846
633 Ga0495675_0041281 3300047444 Unclassified 2941
634 Ga0495684_0567157 3300047471 Unclassified 771
635 Ga0495593_0456038 3300047673 Unclassified 640
636 Ga0495602_0018299 3300048088 Bacteria 7002
637 Ga0496108_0019109 3300048911 Bacteria 5622
638 Ga0496108_0325491 3300048911 Bacteria 1340
639 Ga0496108_0586624 3300048911 Unclassified 972
640 Ga0496108_0625496 3300048911 Unclassified 937
641 Ga0496108_0703655 3300048911 Unclassified 876
642 Ga0496109_0068676 3300048912 Unclassified 3248
643 Ga0496109_0215566 3300048912 Bacteria 1805
644 Ga0496110_0138654 3300048913 Bacteria 2199
645 Ga0496113_0017640 3300048916 Bacteria 4961
646 Ga0496113_0161513 3300048916 Bacteria 1771
647 Ga0496114_0141588 3300048917 Bacteria 2083
648 Ga0501301_020870 3300049524 Unclassified 629
649 Ga0501036_0045365 3300049572 Bacteria 3724
650 Ga0501036_0578963 3300049572 Bacteria 932
651 Ga0501038_0241475 3300049574 Bacteria 1434
652 Ga0501038_0340806 3300049574 Unclassified 1169
653 Ga0501039_0373133 3300049575 Unclassified 1121
654 Ga0501040_0017226 3300049576 Bacteria 4796
655 Ga0501040_0038506 3300049576 Bacteria 3250
656 Ga0501040_0131522 3300049576 Bacteria 1760
657 Ga0501041_0125707 3300049577 Bacteria 1596
658 Ga0501041_0253395 3300049577 Unclassified 1106
659 Ga0501042_0065767 3300049578 Bacteria 2591
660 Ga0501043_0323812 3300049579 Bacteria 1175
661 Ga0501046_0089576 3300049580 Unclassified 2368
662 Ga0501046_0156026 3300049580 Bacteria 1719
663 Ga0501048_0045372 3300049582 Bacteria 3139
664 Ga0501048_0180520 3300049582 Bacteria 1496
665 Ga0501048_0540526 3300049582 Archaea 836
666 Ga0501068_0124377 3300049584 Unclassified 1610
667 Ga0501070_0115142 3300049586 Bacteria 2221
668 Ga0501071_0131229 3300049587 Bacteria 1861
669 Ga0501071_0240706 3300049587 Unclassified 1364
670 Ga0501072_0071343 3300049588 Bacteria 2744
671 Ga0501072_0078622 3300049588 Bacteria 2612
672 Ga0501072_0895799 3300049588 Bacteria 693
673 Ga0501073_0220211 3300049589 Bacteria 1311
674 Ga0501074_0038217 3300049590 Unclassified 3479
675 Ga0501074_0271015 3300049590 Bacteria 1207
676 Ga0501075_0025606 3300049591 Bacteria 4334
677 Ga0501076_0056401 3300049592 Bacteria 3118
678 Ga0501076_0393378 3300049592 Bacteria 1139
679 Ga0501077_0223469 3300049593 Bacteria 1197
680 Ga0501198_036496 3300049649 Bacteria 839
681 Ga0501079_0083582 3300049741 Bacteria 2470
682 Ga0501079_0085489 3300049741 Unclassified 2441
683 Ga0501079_0301288 3300049741 Archaea 1254
684 Ga0501079_0317150 3300049741 Bacteria 1220
685 Ga0501081_0006831 3300049743 Bacteria 7421
686 Ga0501081_0206539 3300049743 Unclassified 1425
687 Ga0501283_012892 3300049779 Bacteria 1262
688 Ga0501035_0524552 3300049822 Bacteria 973
689 Ga0501045_0017042 3300049824 Bacteria 5159
690 Ga0501045_0035195 3300049824 Bacteria 3635
691 Ga0501045_0097079 3300049824 Bacteria 2180
692 Ga0501045_0491999 3300049824 Unclassified 911
693 Ga0501045_0643134 3300049824 Bacteria 784
694 nmdc:mga05p37_100633_c1 3300050507 Bacteria 3560
695 nmdc:mga05p37_117623_c1 3300050507 Bacteria 3266
696 nmdc:mga05p37_122677_c1 3300050507 Bacteria 3192
697 nmdc:mga05p37_1450429_c1 3300050507 Bacteria 687
698 nmdc:mga05p37_19164_c1 3300050507 Bacteria 8275
699 nmdc:mga05p37_240328_c1 3300050507 Bacteria 2178
700 nmdc:mga05p37_467947_c1 3300050507 Bacteria 1455
701 nmdc:mga05p37_54069_c1 3300050507 Bacteria 4940
702 nmdc:mga05p37_74492_c1 3300050507 Bacteria 4178
703 nmdc:mga05p37_76434_c1 3300050507 Unclassified 4123
704 nmdc:mga05p37_86101_c1 3300050507 Bacteria 3873
705 nmdc:mga05p37_882054_c1 3300050507 Unclassified 967
706 nmdc:mga05p37_89096_c1 3300050507 Bacteria 3802
707 nmdc:mga05p37_955681_c1 3300050507 Unclassified 916
708 nmdc:mga09592_274544_c1 3300050508 Bacteria 1462
709 nmdc:mga09592_421484_c1 3300050508 Bacteria 1153
710 nmdc:mga09592_52668_c1 3300050508 Bacteria 3435
711 nmdc:mga09592_58710_c1 3300050508 Unclassified 3253
712 nmdc:mga09592_62040_c1 3300050508 Unclassified 3162
713 nmdc:mga09592_85638_c2 3300050508 Bacteria 2398
714 nmdc:mga0qj67_170112_c1 3300050509 Bacteria 1769
715 nmdc:mga0qj67_206215_c1 3300050509 Bacteria 1597
716 nmdc:mga0qj67_384644_c1 3300050509 Unclassified 1133
717 nmdc:mga0qj67_74910_c1 3300050509 Bacteria 2705
718 nmdc:mga06r32_150671_c1 3300050510 Bacteria 2304
719 nmdc:mga06r32_29750_c1 3300050510 Bacteria 5122
720 nmdc:mga06r32_39753_c1 3300050510 Bacteria 4464
721 nmdc:mga06r32_468937_c1 3300050510 Bacteria 1238
722 nmdc:mga06r32_707777_c1 3300050510 Bacteria 972
723 nmdc:mga06r32_751853_c1 3300050510 Bacteria 938
724 nmdc:mga08y16_127800_c1 3300050511 Unclassified 2644
725 nmdc:mga08y16_1409_c1 3300050511 Bacteria 24098
726 nmdc:mga08y16_148755_c1 3300050511 Bacteria 2434
727 nmdc:mga08y16_3320_c1 3300050511 Bacteria 16654
728 nmdc:mga08y16_677771_c1 3300050511 Bacteria 1033
729 nmdc:mga08y16_7226_c1 3300050511 Bacteria 11654
730 nmdc:mga08y16_8036_c1 3300050511 Bacteria 11038
731 nmdc:mga0n895_1154594_c1 3300050512 Unclassified 750
732 nmdc:mga0n895_1188582_c1 3300050512 Bacteria 737
733 nmdc:mga0n895_31636_c1 3300050512 Bacteria 5069
734 nmdc:mga0n895_80186_c1 3300050512 Bacteria 3252
735 nmdc:mga0rr50_109786_c1 3300050513 Unclassified 2181
736 nmdc:mga0rr50_17703_c1 3300050513 Bacteria 4765
737 nmdc:mga0rr50_633344_c1 3300050513 Bacteria 912
738 nmdc:mga08x19_213252_c1 3300050514 Bacteria 1326
739 nmdc:mga08x19_2645_c1 3300050514 Bacteria 10832
740 nmdc:mga08x19_64328_c1 3300050514 Bacteria 2381
741 nmdc:mga0a205_10138_c1 3300050515 Bacteria 8651
742 nmdc:mga0a205_162636_c1 3300050515 Bacteria 2128
743 nmdc:mga0a205_327787_c1 3300050515 Bacteria 1401
744 nmdc:mga0a205_459945_c1 3300050515 Bacteria 1132
745 nmdc:mga0a205_597834_c1 3300050515 Bacteria 956
746 nmdc:mga0a205_8764_c1 3300050515 Bacteria 9213
747 Ga0495601_0165402 3300053077 Bacteria 1446
748 Ga0495601_0464878 3300053077 Unclassified 818
749 Ga0495619_0092127 3300053085 Bacteria 2053
750 Ga0501084_0002683 3300054114 Bacteria 14322
751 Ga0501084_0262340 3300054114 Unclassified 1458
752 Ga0501082_0079810 3300060353 Bacteria 2824
753 Ga0501082_0093511 3300060353 Bacteria 2598
754 Ga0501082_0128629 3300060353 Bacteria 2197
755 Ga0501082_1048598 3300060353 Bacteria 713
756 Ga0530510_0021645 3300061734 Bacteria 4575
757 Ga0207682_10017743
758 JGI24746J21847_1005143
759 JGI24035J26624_1004124
760 JGI24751J29686_10030048
761 Ga0065714_10093837
762 Ga0065714_10174277
763 Ga0065704_10055006
764 Ga0065704_10361544
765 Ga0065704_10368347
766 Ga0065712_10009205
767 Ga0065712_10013386
768 Ga0065712_10016779
769 Ga0065712_10070342
770 Ga0065712_10132431
771 Ga0065715_10012859
772 Ga0065715_10015982
773 Ga0065715_10102841
774 Ga0065715_10264685
775 Ga0065715_10284814
776 Ga0065707_10005743
777 Ga0065707_10355891
778 Ga0070676_10007765
779 Ga0070676_10045415
780 Ga0070676_10170297
781 Ga0070690_100048916
782 Ga0070690_100050083
783 Ga0070690_100144217
784 Ga0070690_100613665
785 Ga0070670_100006569
786 Ga0070670_100021124
787 Ga0070677_10001616
788 Ga0070677_10126319
789 Ga0070677_10161128
790 Ga0070677_10354541
791 Ga0068869_100006910
792 Ga0068869_100006925
793 Ga0068869_100043783
794 Ga0068869_100044472
795 Ga0068869_100083639
796 Ga0068869_100351782
797 Ga0068869_100391082
798 Ga0070666_10095528
799 Ga0070666_10098278
800 Ga0070666_10556244
801 Ga0070680_100294695
802 Ga0070680_100420143
803 Ga0068868_100079098
804 Ga0068868_100300417
805 Ga0070660_100129286
806 Ga0070689_100040662
807 Ga0070689_100326355
808 Ga0070689_100676170
809 Ga0070687_100035834
810 Ga0070687_100087054
811 Ga0070687_100111545
812 Ga0070661_100053793
813 Ga0070661_100254120
814 Ga0070661_100376318
815 Ga0070692_10362957
816 Ga0070669_100018916
817 Ga0070669_100121457
818 Ga0070669_100187033
819 Ga0070669_100264451
820 Ga0070675_100000983
821 Ga0070675_100011628
822 Ga0070675_100013860
823 Ga0070675_100021025
824 Ga0070675_100021973
825 Ga0070675_100058314
826 Ga0070675_100184277
827 Ga0070675_100289822
828 Ga0070671_100012127
829 Ga0070671_100050797
830 Ga0070671_100056380
831 Ga0070674_100027380
832 Ga0070674_100322014
833 Ga0070673_100033030
834 Ga0070673_100065688
835 Ga0070673_100098035
836 Ga0070673_100127761
837 Ga0070673_100131809
838 Ga0070673_100403016
839 Ga0070688_100012564
840 Ga0070688_100016818
841 Ga0070688_100064200
842 Ga0070688_100136776
843 Ga0070688_100267772
844 Ga0070688_100269758
845 Ga0070659_100411613
846 Ga0070659_100543507
847 Ga0070667_100002265
848 Ga0070667_100420199
849 Ga0070667_100428307
850 Ga0070709_10048012
851 Ga0070713_100203537
852 Ga0070705_100089000
853 Ga0070705_100172888
854 Ga0070700_100004521
855 Ga0070700_100087985
856 Ga0070700_100152962
857 Ga0070700_100164625
858 Ga0070694_100120738
859 Ga0070694_100140498
860 Ga0070694_100234079
861 Ga0070694_100545792
862 Ga0070708_100035925
863 Ga0070708_100120701
864 Ga0070708_100239027
865 Ga0070708_101016756
866 Ga0070663_100161851
867 Ga0070678_100273902
868 Ga0070678_100284080
869 Ga0070678_100509568
870 Ga0070678_100655796
871 Ga0070662_100135739
872 Ga0070662_100181685
873 Ga0070681_10449305
874 Ga0068867_100001289
875 Ga0068867_100369075
876 Ga0070685_10004102
877 Ga0070685_10083951
878 Ga0070685_10099318
879 Ga0070685_10731151
880 Ga0070706_100140194
881 Ga0070707_100183368
882 Ga0070707_100289745
883 Ga0070707_100944704
884 Ga0070698_100027533
885 Ga0070698_100045614
886 Ga0070698_100264511
887 Ga0070698_100786221
888 Ga0070698_100786552
889 Ga0070699_100000553
890 Ga0070699_100016158
891 Ga0070699_100117262
892 Ga0070699_100541669
893 Ga0070699_100657071
894 Ga0070684_100399232
895 Ga0070697_100035947
896 Ga0070672_100009529
897 Ga0070672_100046546
898 Ga0070672_100073097
899 Ga0070672_100408526
900 Ga0070672_100477852
901 Ga0070672_100693163
902 Ga0070686_100011938
903 Ga0070686_100039116
904 Ga0070686_100052420
905 Ga0070686_100199411
906 Ga0070695_100004919
907 Ga0070695_100155643
908 Ga0070695_100418455
909 Ga0070695_100943220
910 Ga0070696_100117952
911 Ga0070696_100245786
912 Ga0070696_100274129
913 Ga0070696_100424146
914 Ga0070665_100153782
915 Ga0070665_100186363
916 Ga0070665_100203607
917 Ga0070665_100353088
918 Ga0070704_100058365
919 Ga0070704_100081241
920 Ga0070704_100091940
921 Ga0070704_100114855
922 Ga0070704_100134768
923 Ga0070704_100448316
924 Ga0070664_100002078
925 Ga0070664_100006815
926 Ga0070664_100008738
927 Ga0070664_100348862
928 Ga0068857_100631551
929 Ga0068857_100658257
930 Ga0068857_101495169
931 Ga0068854_100130892
932 Ga0068854_100941753
933 Ga0070702_100045329
934 Ga0068852_100138628
935 Ga0068852_100315924
936 Ga0068852_101129328
937 Ga0068859_100003638
938 Ga0068859_100019123
939 Ga0068859_100026655
940 Ga0068859_100038490
941 Ga0068859_100083188
942 Ga0068859_100112308
943 Ga0068859_100252354
944 Ga0068859_100410008
945 Ga0068859_101036096
946 Ga0068864_100056758
947 Ga0068864_100076770
948 Ga0068864_100092485
949 Ga0068864_100128969
950 Ga0068864_100156469
951 Ga0068864_100179360
952 Ga0068866_10489441
953 Ga0068861_100042322
954 Ga0068861_100054615
955 Ga0068861_100138615
956 Ga0068861_100202315
957 Ga0068861_100208121
958 Ga0068861_100217839
959 Ga0068861_100465516
960 Ga0068861_100718317
961 Ga0068861_100779490
962 Ga0068851_10001826
963 Ga0068870_10003305
964 Ga0068870_10009468
965 Ga0068870_10016845
966 Ga0068870_10048555
967 Ga0068863_100020293
968 Ga0068863_100022805
969 Ga0068863_100155800
970 Ga0068858_100034755
971 Ga0068858_100066003
972 Ga0068858_100081931
973 Ga0068858_100145250
974 Ga0068858_100147182
975 Ga0068858_100193167
976 Ga0068858_100786281
977 Ga0068858_100905990
978 Ga0068860_100075140
979 Ga0068860_100082353
980 Ga0068860_100133612
981 Ga0068860_100200245
982 Ga0068862_100002949
983 Ga0068862_100097953
984 Ga0068862_100100144
985 Ga0068862_100401909
986 Ga0068862_100845995
987 Ga0075432_10035123
988 Ga0097621_100025433
989 Ga0097621_100191882
990 Ga0097621_100195799
991 Ga0097621_100226180
992 Ga0097621_100265309
993 Ga0097621_100535433
994 Ga0068871_100022711
995 Ga0068871_100153817
996 Ga0068871_100572528
997 Ga0068871_101281149
998 Ga0075428_100003057
999 Ga0075428_100008922
1000 Ga0075428_100027522
1001 Ga0075428_100109979
1002 Ga0075428_100513291
1003 Ga0075428_100739475
1004 Ga0075430_100037605
1005 Ga0075430_100043472
1006 Ga0075430_100209404
1007 Ga0075430_100343578
1008 Ga0075431_100003702
1009 Ga0075431_100030624
1010 Ga0075431_100130018
1011 Ga0075431_100232041
1012 Ga0075431_101091997
1013 Ga0075433_10022132
1014 Ga0075433_10062026
1015 Ga0075433_10287207
1016 Ga0075433_10573999
1017 Ga0075433_10881674
1018 Ga0075434_100000990
1019 Ga0075434_100083144
1020 Ga0075434_100085003
1021 Ga0075434_100290133
1022 Ga0075434_100480118
1023 Ga0075429_100006962
1024 Ga0075429_100008937
1025 Ga0075429_100086124
1026 Ga0075429_100162639
1027 Ga0075429_100305615
1028 Ga0068865_100023277
1029 Ga0068865_100143530
1030 Ga0075436_100038488
1031 Ga0075436_100083659
1032 Ga0075436_100304782
1033 Ga0097620_100003638
1034 Ga0097620_100019123
1035 Ga0097620_100026654
1036 Ga0097620_100038490
1037 Ga0097620_100083190
1038 Ga0097620_100112310
1039 Ga0097620_100252353
1040 Ga0097620_100409948
1041 Ga0097620_101035943
1042 Ga0075435_100022243
1043 Ga0075435_100027489
1044 Ga0075435_100041049
1045 Ga0105251_10187770
1046 Ga0111539_10004383
1047 Ga0111539_10011979
1048 Ga0111539_10072688
1049 Ga0111539_10103057
1050 Ga0111539_10146944
1051 Ga0111539_10245133
1052 Ga0111539_10387936
1053 Ga0111539_10834278
1054 Ga0105245_10365603
1055 Ga0105245_10633658
1056 Ga0105247_10050807
1057 Ga0114129_10001044
1058 Ga0114129_10003299
1059 Ga0114129_10003670
1060 Ga0114129_10003793
1061 Ga0114129_10006502
1062 Ga0114129_10014617
1063 Ga0114129_10081391
1064 Ga0114129_10099751
1065 Ga0114129_10105157
1066 Ga0114129_10132776
1067 Ga0114129_10150265
1068 Ga0114129_10741938
1069 Ga0114129_10980296
1070 Ga0114129_11119315
1071 Ga0114129_11439881
1072 Ga0114129_12071972
1073 Ga0105243_10017608
1074 Ga0105243_10955770
1075 Ga0105242_10006778
1076 Ga0105248_10001169
1077 Ga0105248_10009576
1078 Ga0105248_10054099
1079 Ga0105248_10093960
1080 Ga0105248_10284351
1081 Ga0105248_10387103
1082 Ga0105248_10410464
1083 Ga0105248_10505597
1084 Ga0105248_11114920
1085 Ga0105248_11368695
1086 Ga0105238_10010731
1087 Ga0105249_10006782
1088 Ga0105249_10131423
1089 Ga0105249_10478752
1090 Ga0105249_10790749
1091 Ga0105246_10066634
1092 Ga0105246_10072242
1093 Ga0105246_10147897
1094 Ga0105246_10529172
1095 Ga0157369_10027020
1096 Ga0157374_10072409
1097 Ga0157374_11398521
1098 Ga0163162_10007414
1099 Ga0163162_10078594
1100 Ga0163162_10863684
1101 Ga0157372_10982968
1102 Ga0157375_10259917
1103 Ga0157375_10506587
1104 Ga0157375_10730909
1105 Ga0163163_10011771
1106 Ga0163163_10019396
1107 Ga0163163_10124318
1108 Ga0163163_10197020
1109 Ga0163163_10353325
1110 Ga0157380_10051673
1111 Ga0157380_10062724
1112 Ga0157380_10105901
1113 Ga0157380_10140742
1114 Ga0157380_10150866
1115 Ga0157380_10167954
1116 Ga0157380_10318673
1117 Ga0157380_10360002
1118 Ga0157380_10677214
1119 Ga0157380_10681642
1120 Ga0157377_10002095
1121 Ga0157377_10012548
1122 Ga0157377_10028129
1123 Ga0157377_10098161
1124 Ga0157379_10063932
1125 Ga0157379_10088578
1126 Ga0157379_10129618
1127 Ga0157376_10030121
1128 Ga0157376_10052477
1129 Ga0157376_10130973
1130 Ga0157376_10519925
1131 Ga0157376_10521341
1132 Ga0163161_10039204
1133 Ga0163161_10077035
1134 Ga0163161_10120257
1135 Ga0207673_1021888
1136 Ga0207697_10000501
1137 Ga0207697_10004591
1138 Ga0207682_10001258
1139 Ga0207682_10049986
1140 Ga0207682_10129154
1141 Ga0207642_10017086
1142 Ga0207688_10000052
1143 Ga0207688_10002569
1144 Ga0207688_10019798
1145 Ga0207688_10181703
1146 Ga0207680_10048100
1147 Ga0207645_10002148
1148 Ga0207645_10006108
1149 Ga0207645_10055785
1150 Ga0207645_10374133
1151 Ga0207645_10443193
1152 Ga0207643_10001284
1153 Ga0207643_10010717
1154 Ga0207643_10039636
1155 Ga0207643_10045124
1156 Ga0207643_10188967
1157 Ga0207707_10548188
1158 Ga0207660_10135431
1159 Ga0207660_10226733
1160 Ga0207660_10455716
1161 Ga0207662_10025137
1162 Ga0207662_10052149
1163 Ga0207662_10104726
1164 Ga0207649_10034465
1165 Ga0207649_10798498
1166 Ga0207681_10064737
1167 Ga0207681_10067802
1168 Ga0207681_10078345
1169 Ga0207681_10359954
1170 Ga0207694_10019700
1171 Ga0207650_10011470
1172 Ga0207650_10099244
1173 Ga0207650_10206460
1174 Ga0207650_10262658
1175 Ga0207659_10004384
1176 Ga0207659_10007125
1177 Ga0207659_10012117
1178 Ga0207659_10015893
1179 Ga0207659_10025119
1180 Ga0207659_10028129
1181 Ga0207659_10030553
1182 Ga0207659_10191241
1183 Ga0207687_10073654
1184 Ga0207644_10019395
1185 Ga0207644_10033680
1186 Ga0207644_10036672
1187 Ga0207690_10412734
1188 Ga0207706_10001919
1189 Ga0207706_10073766
1190 Ga0207706_11020472
1191 Ga0207686_10003282
1192 Ga0207686_10242622
1193 Ga0207709_10017868
1194 Ga0207670_10122561
1195 Ga0207670_10177183
1196 Ga0207670_10352105
1197 Ga0207670_10577305
1198 Ga0207669_10030623
1199 Ga0207704_10002174
1200 Ga0207704_10059727
1201 Ga0207704_10265511
1202 Ga0207665_10100897
1203 Ga0207691_10005546
1204 Ga0207691_10119184
1205 Ga0207691_10208223
1206 Ga0207691_10747481
1207 Ga0207711_10003302
1208 Ga0207711_10022338
1209 Ga0207711_10102873
1210 Ga0207711_10127332
1211 Ga0207711_10181785
1212 Ga0207689_10002550
1213 Ga0207689_10007329
1214 Ga0207689_10033535
1215 Ga0207689_10052265
1216 Ga0207689_10091494
1217 Ga0207689_10329881
1218 Ga0207661_10649963
1219 Ga0207679_10005994
1220 Ga0207679_10017138
1221 Ga0207679_10028893
1222 Ga0207651_10015997
1223 Ga0207651_10031795
1224 Ga0207651_10085423
1225 Ga0207651_10119383
1226 Ga0207651_10265418
1227 Ga0207651_10488595
1228 Ga0207651_10950880
1229 Ga0207712_10020916
1230 Ga0207712_10155351
1231 Ga0207712_10457603
1232 Ga0207668_10237546
1233 Ga0207668_10282399
1234 Ga0207640_10073930
1235 Ga0207658_10111514
1236 Ga0207658_10140731
1237 Ga0207658_10425096
1238 Ga0207677_10028240
1239 Ga0207677_10061076
1240 Ga0207703_10019272
1241 Ga0207703_10053804
1242 Ga0207703_10239270
1243 Ga0207703_10646631
1244 Ga0207703_10888069
1245 Ga0207678_10026307
1246 Ga0207678_10126371
1247 Ga0207678_10630669
1248 Ga0207708_10003363
1249 Ga0207708_10010450
1250 Ga0207708_10166372
1251 Ga0207708_10232008
1252 Ga0207708_10253331
1253 Ga0207641_10029420
1254 Ga0207641_10033337
1255 Ga0207641_10130015
1256 Ga0207641_10335688
1257 Ga0207641_11220352
1258 Ga0207648_10001685
1259 Ga0207648_10052592
1260 Ga0207648_10099355
1261 Ga0207648_10121778
1262 Ga0207676_10026869
1263 Ga0207676_10048350
1264 Ga0207676_10092278
1265 Ga0207676_10141619
1266 Ga0207676_10250191
1267 Ga0207674_10599487
1268 Ga0207674_10950147
1269 Ga0207674_11427633
1270 Ga0207675_100004199
1271 Ga0207675_100054102
1272 Ga0207675_100055730
1273 Ga0207675_100060025
1274 Ga0207675_100312739
1275 Ga0207675_100581727
1276 Ga0207675_101144881
1277 Ga0207683_10009596
1278 Ga0207683_10037006
1279 Ga0207683_10273328
1280 Ga0207683_10436452
1281 Ga0207683_10517198
1282 Ga0207698_10197451
1283 Ga0210002_1002612
1284 Ga0209998_10086882
1285 Ga0209974_10059799
1286 Ga0207428_10003471
1287 Ga0207428_10192767
1288 Ga0207428_10201014
1289 Ga0268266_10132031
1290 Ga0268266_10145067
1291 Ga0268266_10390650
1292 Ga0268265_10238972
1293 Ga0268265_10282026
1294 Ga0268265_10373866
1295 Ga0268265_11310726
1296 Ga0268264_10179086
1297 Ga0268264_10241448
1298 Ga0268264_10380536
1299 Ga0268264_10964128
1300 Ga0265332_10037927
1301 Ga0265320_10000140
1302 Ga0265329_10051387
1303 Ga0265340_10017144
1304 Ga0265339_10007975
1305 Ga0265331_10000041
1306 Ga0307408_100161566
1307 Ga0307408_100192928
1308 Ga0265313_10003390
1309 Ga0265314_10010156
1310 Ga0265314_10109794
1311 Ga0265342_10001723
1312 Ga0307405_10129309
1313 Ga0307405_10423227
1314 Ga0307409_100395784
1315 Ga0307416_100013146
1316 Ga0307416_100105252
1317 Ga0307415_100138974
1318 Ga0373945_0051887
1319 Ga0373954_0201101
1320 Ga0373961_0125214
1321 Ga0373931_0367974
1322 Ga0373935_0231955
1323 Ga0373927_0516937
1324 Ga0373937_0448888
1325 Ga0373925_0434394
1326 Ga0395905_1208952
1327 Ga0436364_1484599
1328 Ga0439461_0028998
1329 Ga0451853_2796683
1330 Ga0439431_0020051
1331 Ga0450923_016337
1332 Ga0439446_0028639
1333 Ga0450908_049860
1334 Ga0439435_0012086
1335 Ga0439435_0081175
1336 Ga0439460_0119313
1337 Ga0450916_004348
1338 Ga0451577_1088009
1339 Ga0451577_1195997
1340 Ga0439440_0014564
1341 Ga0466964_0095350
1342 Ga0451576_0072265
1343 Ga0451576_0314500
1344 Ga0495592_0014249
1345 Ga0495603_0089517
1346 Ga0495629_0009843
1347 Ga0495629_0507191
1348 Ga0495641_0191237
1349 Ga0495651_0042435
1350 Ga0495653_0030476
1351 Ga0495582_0298015
1352 Ga0495664_0014862
1353 Ga0495664_0313302
1354 Ga0495618_0195185
1355 Ga0495628_0025454
1356 Ga0495628_0115376
1357 Ga0495630_0055365
1358 Ga0495630_0260465
1359 Ga0495665_0158623
1360 Ga0495640_0039183
1361 Ga0495586_0309051
1362 Ga0495598_0097864
1363 Ga0495621_0021890
1364 Ga0495621_0046453
1365 Ga0495621_0053225
1366 Ga0495621_0265854
1367 Ga0495645_0016833
1368 Ga0495667_0018127
1369 Ga0495656_0169622
1370 Ga0495634_0036571
1371 Ga0495635_0106997
1372 Ga0495635_0245822
1373 Ga0495659_0053943
1374 Ga0495657_0217299
1375 Ga0495623_0036329
1376 Ga0495646_0019992
1377 Ga0495647_0209941
1378 Ga0495658_0046228
1379 Ga0495658_0188003
1380 Ga0495658_0310939
1381 Ga0495669_0241646
1382 Ga0495613_0609616
1383 Ga0495624_0181337
1384 Ga0495600_0466134
1385 Ga0495604_0008402
1386 Ga0495674_0501729
1387 Ga0495676_0013854
1388 Ga0495680_0038090
1389 Ga0495675_0041281
1390 Ga0495684_0567157
1391 Ga0495593_0456038
1392 Ga0495602_0018299
1393 Ga0496108_0019109
1394 Ga0496108_0325491
1395 Ga0496108_0586624
1396 Ga0496108_0625496
1397 Ga0496108_0703655
1398 Ga0496109_0068676
1399 Ga0496109_0215566
1400 Ga0496110_0138654
1401 Ga0496113_0017640
1402 Ga0496113_0161513
1403 Ga0496114_0141588
1404 Ga0501301_020870
1405 Ga0501036_0045365
1406 Ga0501036_0578963
1407 Ga0501038_0241475
1408 Ga0501038_0340806
1409 Ga0501039_0373133
1410 Ga0501040_0017226
1411 Ga0501040_0038506
1412 Ga0501040_0131522
1413 Ga0501041_0125707
1414 Ga0501041_0253395
1415 Ga0501042_0065767
1416 Ga0501043_0323812
1417 Ga0501046_0089576
1418 Ga0501046_0156026
1419 Ga0501048_0045372
1420 Ga0501048_0180520
1421 Ga0501048_0540526
1422 Ga0501068_0124377
1423 Ga0501070_0115142
1424 Ga0501071_0131229
1425 Ga0501071_0240706
1426 Ga0501072_0071343
1427 Ga0501072_0078622
1428 Ga0501072_0895799
1429 Ga0501073_0220211
1430 Ga0501074_0038217
1431 Ga0501074_0271015
1432 Ga0501075_0025606
1433 Ga0501076_0056401
1434 Ga0501076_0393378
1435 Ga0501077_0223469
1436 Ga0501198_036496
1437 Ga0501079_0083582
1438 Ga0501079_0085489
1439 Ga0501079_0301288
1440 Ga0501079_0317150
1441 Ga0501081_0006831
1442 Ga0501081_0206539
1443 Ga0501283_012892
1444 Ga0501035_0524552
1445 Ga0501045_0017042
1446 Ga0501045_0035195
1447 Ga0501045_0097079
1448 Ga0501045_0491999
1449 Ga0501045_0643134
1450 nmdc:mga05p37_100633_c1
1451 nmdc:mga05p37_117623_c1
1452 nmdc:mga05p37_122677_c1
1453 nmdc:mga05p37_1450429_c1
1454 nmdc:mga05p37_19164_c1
1455 nmdc:mga05p37_240328_c1
1456 nmdc:mga05p37_467947_c1
1457 nmdc:mga05p37_54069_c1
1458 nmdc:mga05p37_74492_c1
1459 nmdc:mga05p37_76434_c1
1460 nmdc:mga05p37_86101_c1
1461 nmdc:mga05p37_882054_c1
1462 nmdc:mga05p37_89096_c1
1463 nmdc:mga05p37_955681_c1
1464 nmdc:mga09592_274544_c1
1465 nmdc:mga09592_421484_c1
1466 nmdc:mga09592_52668_c1
1467 nmdc:mga09592_58710_c1
1468 nmdc:mga09592_62040_c1
1469 nmdc:mga09592_85638_c2
1470 nmdc:mga0qj67_170112_c1
1471 nmdc:mga0qj67_206215_c1
1472 nmdc:mga0qj67_384644_c1
1473 nmdc:mga0qj67_74910_c1
1474 nmdc:mga06r32_150671_c1
1475 nmdc:mga06r32_29750_c1
1476 nmdc:mga06r32_39753_c1
1477 nmdc:mga06r32_468937_c1
1478 nmdc:mga06r32_707777_c1
1479 nmdc:mga06r32_751853_c1
1480 nmdc:mga08y16_127800_c1
1481 nmdc:mga08y16_1409_c1
1482 nmdc:mga08y16_148755_c1
1483 nmdc:mga08y16_3320_c1
1484 nmdc:mga08y16_677771_c1
1485 nmdc:mga08y16_7226_c1
1486 nmdc:mga08y16_8036_c1
1487 nmdc:mga0n895_1154594_c1
1488 nmdc:mga0n895_1188582_c1
1489 nmdc:mga0n895_31636_c1
1490 nmdc:mga0n895_80186_c1
1491 nmdc:mga0rr50_109786_c1
1492 nmdc:mga0rr50_17703_c1
1493 nmdc:mga0rr50_633344_c1
1494 nmdc:mga08x19_213252_c1
1495 nmdc:mga08x19_2645_c1
1496 nmdc:mga08x19_64328_c1
1497 nmdc:mga0a205_10138_c1
1498 nmdc:mga0a205_162636_c1
1499 nmdc:mga0a205_327787_c1
1500 nmdc:mga0a205_459945_c1
1501 nmdc:mga0a205_597834_c1
1502 nmdc:mga0a205_8764_c1
1503 Ga0495601_0165402
1504 Ga0495601_0464878
1505 Ga0495619_0092127
1506 Ga0501084_0002683
1507 Ga0501084_0262340
1508 Ga0501082_0079810
1509 Ga0501082_0093511
1510 Ga0501082_0128629
1511 Ga0501082_1048598
1512 Ga0530510_0021645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8152 24 208
6ljp-assembly1.cif.gz_A crystal structure of human galectin-16 0.7857 69 208
6ljr-assembly1.cif.gz_A human galectin-16 r55n/h57r 0.7853 69 209
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7836 24 208
6n44-assembly4.cif.gz_G-3 sheep galectin-11 (lgals11) complex with glycerol 0.7792 69 206
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8152 24 208 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7836 24 208 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7636 43 205 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7463 43 205 2.60.120.560
3ak0A00 Mainly Beta;Sandwich;Jelly Rolls; 0.7177 67 207 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A7C7X854-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9841 57 207
AF-A0A838QID1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9746 59 209
AF-A0A7C7X854-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9713 57 207
AF-A0A2V7RIS3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9686 45 209
AF-A0A432HXR0-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9631 23 206

Map