F479170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 752 | 279 | 1504 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0458282|Ga0436364_0458282_890_1426 |
| Length | 178 |
| Sequence | MSDQLFIPVDFAVPGGLAAGEFQLEPLGPQHNAADYAAWTASIGHIRATPGFTGASWPHQMSLAENLRDLERHAQDFAGRRGFTYTVLSTSTGEVIGCVYIYPLRGGKPGHTSGGGQHAAVRSWVRADHAALDPVLYHAVRAWLERDWPFRSIEYAPRPLPDTACGAALSPPRLGIPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 114 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 117 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 124 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 143 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 144 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 151 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 152 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 153 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 154 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 155 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 158 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 159 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 160 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 161 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 162 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 163 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 164 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0.8 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.98 |
| Rhizosphere | 90.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0458282 | 3300037853 | Bacteria | 2730 |
| 2 | Ga0070658_10029449 | 3300005327 | Bacteria | 4410 |
| 3 | Ga0070683_100008344 | 3300005329 | Bacteria | 8798 |
| 4 | Ga0070683_100669714 | 3300005329 | Unclassified | 994 |
| 5 | Ga0070680_100092427 | 3300005336 | Bacteria | 2505 |
| 6 | Ga0070680_100180989 | 3300005336 | Bacteria | 1775 |
| 7 | Ga0070680_100197355 | 3300005336 | Bacteria | 1696 |
| 8 | Ga0070680_100432210 | 3300005336 | Bacteria | 1124 |
| 9 | Ga0068868_100558505 | 3300005338 | Bacteria | 1010 |
| 10 | Ga0070660_100008122 | 3300005339 | Bacteria | 7335 |
| 11 | Ga0070661_100025917 | 3300005344 | Bacteria | 4214 |
| 12 | Ga0070674_100733305 | 3300005356 | Bacteria | 848 |
| 13 | Ga0070688_101383295 | 3300005365 | Bacteria | 570 |
| 14 | Ga0070659_100156890 | 3300005366 | Bacteria | 1859 |
| 15 | Ga0070659_100587949 | 3300005366 | Bacteria | 956 |
| 16 | Ga0070659_100958223 | 3300005366 | Bacteria | 750 |
| 17 | Ga0070709_10910372 | 3300005434 | Unclassified | 696 |
| 18 | Ga0070713_100017211 | 3300005436 | Bacteria | 5461 |
| 19 | Ga0070713_100635507 | 3300005436 | Bacteria | 1016 |
| 20 | Ga0070710_10122823 | 3300005437 | Bacteria | 1574 |
| 21 | Ga0070710_10136858 | 3300005437 | Bacteria | 1498 |
| 22 | Ga0070710_10385815 | 3300005437 | Unclassified | 935 |
| 23 | Ga0070711_100019629 | 3300005439 | Bacteria | 4340 |
| 24 | Ga0070711_100027531 | 3300005439 | Bacteria | 3733 |
| 25 | Ga0070711_100192452 | 3300005439 | Bacteria | 1569 |
| 26 | Ga0070711_100519762 | 3300005439 | Unclassified | 984 |
| 27 | Ga0070705_100367770 | 3300005440 | Unclassified | 1054 |
| 28 | Ga0070700_100752237 | 3300005441 | Bacteria | 780 |
| 29 | Ga0070708_100358408 | 3300005445 | Bacteria | 1374 |
| 30 | Ga0070678_100790694 | 3300005456 | Bacteria | 861 |
| 31 | Ga0070681_10021809 | 3300005458 | Bacteria | 6423 |
| 32 | Ga0070681_10102947 | 3300005458 | Bacteria | 2800 |
| 33 | Ga0070681_10132409 | 3300005458 | Bacteria | 2425 |
| 34 | Ga0070681_10239167 | 3300005458 | Bacteria | 1729 |
| 35 | Ga0070681_10791058 | 3300005458 | Bacteria | 865 |
| 36 | Ga0068867_100531156 | 3300005459 | Bacteria | 1016 |
| 37 | Ga0070706_100036315 | 3300005467 | Unclassified | 4551 |
| 38 | Ga0070706_100365423 | 3300005467 | Unclassified | 1344 |
| 39 | Ga0070707_100088122 | 3300005468 | Bacteria | 3002 |
| 40 | Ga0070707_100181252 | 3300005468 | Bacteria | 2053 |
| 41 | Ga0070707_100738711 | 3300005468 | Unclassified | 947 |
| 42 | Ga0070707_100958329 | 3300005468 | Unclassified | 821 |
| 43 | Ga0070698_100122382 | 3300005471 | Bacteria | 2560 |
| 44 | Ga0070699_100010266 | 3300005518 | Bacteria | 8099 |
| 45 | Ga0070699_100032770 | 3300005518 | Bacteria | 4487 |
| 46 | Ga0070699_100598040 | 3300005518 | Bacteria | 1006 |
| 47 | Ga0070679_100067576 | 3300005530 | Bacteria | 3564 |
| 48 | Ga0070679_100072003 | 3300005530 | Bacteria | 3448 |
| 49 | Ga0070679_100248215 | 3300005530 | Bacteria | 1736 |
| 50 | Ga0070684_100028374 | 3300005535 | Bacteria | 4735 |
| 51 | Ga0070684_100149217 | 3300005535 | Bacteria | 2117 |
| 52 | Ga0070684_101212842 | 3300005535 | Unclassified | 710 |
| 53 | Ga0070697_100005179 | 3300005536 | Bacteria | 10018 |
| 54 | Ga0070697_100005436 | 3300005536 | Bacteria | 9820 |
| 55 | Ga0068853_100314262 | 3300005539 | Bacteria | 1451 |
| 56 | Ga0068853_100494058 | 3300005539 | Bacteria | 1155 |
| 57 | Ga0070695_100118462 | 3300005545 | Bacteria | 1808 |
| 58 | Ga0070665_100444434 | 3300005548 | Unclassified | 1306 |
| 59 | Ga0068857_100056585 | 3300005577 | Bacteria | 3481 |
| 60 | Ga0068857_100352627 | 3300005577 | Bacteria | 1363 |
| 61 | Ga0068854_100517225 | 3300005578 | Unclassified | 1007 |
| 62 | Ga0068856_100143144 | 3300005614 | Bacteria | 2398 |
| 63 | Ga0068856_100320612 | 3300005614 | Bacteria | 1567 |
| 64 | Ga0068856_100329602 | 3300005614 | Bacteria | 1544 |
| 65 | Ga0081455_10081162 | 3300005937 | Bacteria | 2657 |
| 66 | Ga0081455_10475021 | 3300005937 | Bacteria | 847 |
| 67 | Ga0081540_1205524 | 3300005983 | Bacteria | 712 |
| 68 | Ga0070717_10169286 | 3300006028 | Bacteria | 1899 |
| 69 | Ga0070717_10211171 | 3300006028 | Bacteria | 1703 |
| 70 | Ga0070717_10285468 | 3300006028 | Bacteria | 1465 |
| 71 | Ga0070717_10596693 | 3300006028 | Bacteria | 1002 |
| 72 | Ga0070717_10621181 | 3300006028 | Bacteria | 980 |
| 73 | Ga0070717_11460413 | 3300006028 | Bacteria | 621 |
| 74 | Ga0075432_10048467 | 3300006058 | Bacteria | 1495 |
| 75 | Ga0070715_10029745 | 3300006163 | Bacteria | 2202 |
| 76 | Ga0070715_10353491 | 3300006163 | Unclassified | 803 |
| 77 | Ga0070715_10451581 | 3300006163 | Bacteria | 726 |
| 78 | Ga0070716_100095427 | 3300006173 | Bacteria | 1810 |
| 79 | Ga0070712_100003758 | 3300006175 | Bacteria | 9352 |
| 80 | Ga0070712_100023530 | 3300006175 | Bacteria | 4071 |
| 81 | Ga0070712_100106718 | 3300006175 | Bacteria | 2082 |
| 82 | Ga0070712_100457759 | 3300006175 | Unclassified | 1063 |
| 83 | Ga0075433_10019520 | 3300006852 | Bacteria | 5650 |
| 84 | Ga0075433_10136034 | 3300006852 | Bacteria | 2184 |
| 85 | Ga0075433_10333055 | 3300006852 | Unclassified | 1342 |
| 86 | Ga0075434_100352207 | 3300006871 | Bacteria | 1493 |
| 87 | Ga0075436_100029394 | 3300006914 | Bacteria | 3779 |
| 88 | Ga0075435_100226938 | 3300007076 | Bacteria | 1586 |
| 89 | Ga0075435_100716449 | 3300007076 | Bacteria | 870 |
| 90 | Ga0075435_101401567 | 3300007076 | Unclassified | 612 |
| 91 | Ga0105240_10264969 | 3300009093 | Bacteria | 1981 |
| 92 | Ga0105240_10303951 | 3300009093 | Bacteria | 1824 |
| 93 | Ga0105240_10771158 | 3300009093 | Unclassified | 1044 |
| 94 | Ga0105240_10812314 | 3300009093 | Bacteria | 1012 |
| 95 | Ga0111539_10087422 | 3300009094 | Bacteria | 3662 |
| 96 | Ga0111539_10128424 | 3300009094 | Unclassified | 2969 |
| 97 | Ga0111539_10234832 | 3300009094 | Bacteria | 2135 |
| 98 | Ga0105245_10041686 | 3300009098 | Bacteria | 4092 |
| 99 | Ga0105245_10843995 | 3300009098 | Bacteria | 956 |
| 100 | Ga0105245_10995498 | 3300009098 | Bacteria | 882 |
| 101 | Ga0105245_11425718 | 3300009098 | Bacteria | 743 |
| 102 | Ga0105247_10788889 | 3300009101 | Unclassified | 724 |
| 103 | Ga0105243_10588698 | 3300009148 | Bacteria | 1069 |
| 104 | Ga0105243_10918056 | 3300009148 | Bacteria | 872 |
| 105 | Ga0105241_10943706 | 3300009174 | Unclassified | 804 |
| 106 | Ga0105241_11339433 | 3300009174 | Bacteria | 683 |
| 107 | Ga0105242_10680159 | 3300009176 | Bacteria | 1004 |
| 108 | Ga0105237_10173645 | 3300009545 | Bacteria | 2155 |
| 109 | Ga0105237_10336253 | 3300009545 | Bacteria | 1514 |
| 110 | Ga0105237_10540100 | 3300009545 | Bacteria | 1172 |
| 111 | Ga0105249_10368669 | 3300009553 | Unclassified | 1459 |
| 112 | Ga0105249_11800236 | 3300009553 | Bacteria | 685 |
| 113 | Ga0105239_10357555 | 3300010375 | Bacteria | 1649 |
| 114 | Ga0105239_10514669 | 3300010375 | Bacteria | 1361 |
| 115 | Ga0105246_10526344 | 3300011119 | Bacteria | 1009 |
| 116 | Ga0157338_1078832 | 3300012515 | Bacteria | 529 |
| 117 | Ga0157373_10055526 | 3300013100 | Bacteria | 2813 |
| 118 | Ga0157370_10004652 | 3300013104 | Bacteria | 15680 |
| 119 | Ga0157370_10474537 | 3300013104 | Bacteria | 1150 |
| 120 | Ga0157370_12005301 | 3300013104 | Unclassified | 519 |
| 121 | Ga0157369_10874590 | 3300013105 | Bacteria | 922 |
| 122 | Ga0157369_10985058 | 3300013105 | Unclassified | 863 |
| 123 | Ga0157374_11189823 | 3300013296 | Unclassified | 783 |
| 124 | Ga0163162_11236513 | 3300013306 | Bacteria | 848 |
| 125 | Ga0157372_10171621 | 3300013307 | Bacteria | 2509 |
| 126 | Ga0157372_10562325 | 3300013307 | Bacteria | 1329 |
| 127 | Ga0157375_12338806 | 3300013308 | Bacteria | 637 |
| 128 | Ga0163163_10172619 | 3300014325 | Unclassified | 2209 |
| 129 | Ga0163163_10271834 | 3300014325 | Unclassified | 1746 |
| 130 | Ga0163163_10555380 | 3300014325 | Unclassified | 1211 |
| 131 | Ga0163163_10910127 | 3300014325 | Unclassified | 943 |
| 132 | Ga0157380_10469996 | 3300014326 | Bacteria | 1213 |
| 133 | Ga0182008_10002385 | 3300014497 | Bacteria | 11806 |
| 134 | Ga0157377_10138807 | 3300014745 | Bacteria | 1492 |
| 135 | Ga0157376_10762826 | 3300014969 | Bacteria | 977 |
| 136 | Ga0157376_12091758 | 3300014969 | Unclassified | 604 |
| 137 | Ga0182006_1085570 | 3300015261 | Bacteria | 1143 |
| 138 | Ga0163161_10748039 | 3300017792 | Unclassified | 818 |
| 139 | Ga0197907_11002288 | 3300020069 | Unclassified | 548 |
| 140 | Ga0206356_11160239 | 3300020070 | Unclassified | 721 |
| 141 | Ga0206354_11222688 | 3300020081 | Bacteria | 3599 |
| 142 | Ga0206353_10181333 | 3300020082 | Bacteria | 11098 |
| 143 | Ga0206353_12023555 | 3300020082 | Bacteria | 904 |
| 144 | Ga0213875_10155949 | 3300021388 | Bacteria | 1071 |
| 145 | Ga0207692_10005869 | 3300025898 | Bacteria | 4950 |
| 146 | Ga0207692_10033859 | 3300025898 | Bacteria | 2469 |
| 147 | Ga0207692_10073206 | 3300025898 | Bacteria | 1812 |
| 148 | Ga0207685_10005475 | 3300025905 | Bacteria | 3357 |
| 149 | Ga0207685_10481195 | 3300025905 | Bacteria | 650 |
| 150 | Ga0207705_10063949 | 3300025909 | Bacteria | 2659 |
| 151 | Ga0207684_10018469 | 3300025910 | Bacteria | 5971 |
| 152 | Ga0207684_10036456 | 3300025910 | Unclassified | 4174 |
| 153 | Ga0207684_10144524 | 3300025910 | Unclassified | 2046 |
| 154 | Ga0207707_10081694 | 3300025912 | Bacteria | 2821 |
| 155 | Ga0207707_10184886 | 3300025912 | Bacteria | 1819 |
| 156 | Ga0207695_10375453 | 3300025913 | Bacteria | 1308 |
| 157 | Ga0207671_10025969 | 3300025914 | Bacteria | 4394 |
| 158 | Ga0207671_10104596 | 3300025914 | Bacteria | 2147 |
| 159 | Ga0207693_10002613 | 3300025915 | Bacteria | 15647 |
| 160 | Ga0207693_10013042 | 3300025915 | Bacteria | 6706 |
| 161 | Ga0207693_10018376 | 3300025915 | Bacteria | 5568 |
| 162 | Ga0207693_10130761 | 3300025915 | Bacteria | 1973 |
| 163 | Ga0207693_10200459 | 3300025915 | Bacteria | 1569 |
| 164 | Ga0207663_10008287 | 3300025916 | Bacteria | 5427 |
| 165 | Ga0207663_10109403 | 3300025916 | Bacteria | 1873 |
| 166 | Ga0207663_10331634 | 3300025916 | Unclassified | 1146 |
| 167 | Ga0207663_10385033 | 3300025916 | Bacteria | 1069 |
| 168 | Ga0207663_10397157 | 3300025916 | Bacteria | 1054 |
| 169 | Ga0207663_10414933 | 3300025916 | Unclassified | 1032 |
| 170 | Ga0207660_10075917 | 3300025917 | Bacteria | 2456 |
| 171 | Ga0207657_10000964 | 3300025919 | Bacteria | 30488 |
| 172 | Ga0207649_10032593 | 3300025920 | Bacteria | 3108 |
| 173 | Ga0207646_10007631 | 3300025922 | Bacteria | 10951 |
| 174 | Ga0207646_10047283 | 3300025922 | Unclassified | 3858 |
| 175 | Ga0207681_11231161 | 3300025923 | Unclassified | 629 |
| 176 | Ga0207700_10039434 | 3300025928 | Bacteria | 3439 |
| 177 | Ga0207700_10471696 | 3300025928 | Bacteria | 1108 |
| 178 | Ga0207664_11311797 | 3300025929 | Bacteria | 643 |
| 179 | Ga0207664_11395023 | 3300025929 | Bacteria | 621 |
| 180 | Ga0207690_10276888 | 3300025932 | Bacteria | 1306 |
| 181 | Ga0207665_10699407 | 3300025939 | Bacteria | 797 |
| 182 | Ga0207691_10553542 | 3300025940 | Bacteria | 975 |
| 183 | Ga0207661_10139208 | 3300025944 | Bacteria | 2087 |
| 184 | Ga0207661_10360673 | 3300025944 | Unclassified | 1313 |
| 185 | Ga0207661_10564533 | 3300025944 | Unclassified | 1043 |
| 186 | Ga0207667_10116255 | 3300025949 | Bacteria | 2756 |
| 187 | Ga0207712_10337729 | 3300025961 | Unclassified | 1248 |
| 188 | Ga0207668_11648477 | 3300025972 | Bacteria | 579 |
| 189 | Ga0207702_10072302 | 3300026078 | Bacteria | 2972 |
| 190 | Ga0207702_10247817 | 3300026078 | Unclassified | 1672 |
| 191 | Ga0207648_10128270 | 3300026089 | Bacteria | 2232 |
| 192 | Ga0207674_10070623 | 3300026116 | Bacteria | 3511 |
| 193 | Ga0207674_10381071 | 3300026116 | Bacteria | 1363 |
| 194 | Ga0207683_11087410 | 3300026121 | Unclassified | 742 |
| 195 | Ga0207428_10283271 | 3300027907 | Bacteria | 1230 |
| 196 | Ga0268266_10634242 | 3300028379 | Bacteria | 1028 |
| 197 | Ga0268265_10931211 | 3300028380 | Unclassified | 855 |
| 198 | Ga0265760_10257865 | 3300031090 | Unclassified | 606 |
| 199 | Ga0265340_10116097 | 3300031247 | Bacteria | 1234 |
| 200 | Ga0265314_10336595 | 3300031711 | Unclassified | 835 |
| 201 | Ga0307405_10482313 | 3300031731 | Bacteria | 990 |
| 202 | Ga0307410_11098914 | 3300031852 | Bacteria | 689 |
| 203 | Ga0307409_100816850 | 3300031995 | Bacteria | 941 |
| 204 | Ga0307415_100363188 | 3300032126 | Bacteria | 1223 |
| 205 | Ga0373926_0001987 | 3300035083 | Bacteria | 6411 |
| 206 | Ga0373926_0004338 | 3300035083 | Bacteria | 4649 |
| 207 | Ga0373926_0079196 | 3300035083 | Bacteria | 1213 |
| 208 | Ga0373934_0000196 | 3300035086 | Bacteria | 22202 |
| 209 | Ga0373934_0065260 | 3300035086 | Unclassified | 1453 |
| 210 | Ga0373944_0001293 | 3300035089 | Bacteria | 6296 |
| 211 | Ga0373944_0001729 | 3300035089 | Bacteria | 5521 |
| 212 | Ga0373944_0062118 | 3300035089 | Unclassified | 1200 |
| 213 | Ga0373952_0019633 | 3300035092 | Unclassified | 1410 |
| 214 | Ga0373923_0000096 | 3300035111 | Bacteria | 15433 |
| 215 | Ga0373923_0006540 | 3300035111 | Bacteria | 4037 |
| 216 | Ga0373923_0349978 | 3300035111 | Bacteria | 705 |
| 217 | Ga0373936_0002062 | 3300035113 | Bacteria | 7452 |
| 218 | Ga0373936_0012555 | 3300035113 | Plasmid | 3225 |
| 219 | Ga0373936_0025147 | 3300035113 | Bacteria | 2327 |
| 220 | Ga0373945_0000006 | 3300035116 | Bacteria | 50221 |
| 221 | Ga0373945_0000033 | 3300035116 | Bacteria | 28437 |
| 222 | Ga0373945_0018772 | 3300035116 | Unclassified | 2355 |
| 223 | Ga0373953_0000133 | 3300035117 | Bacteria | 18374 |
| 224 | Ga0373953_0002866 | 3300035117 | Bacteria | 5259 |
| 225 | Ga0373953_0163199 | 3300035117 | Unclassified | 958 |
| 226 | Ga0373954_0101660 | 3300035118 | Unclassified | 1387 |
| 227 | Ga0373954_0102957 | 3300035118 | Unclassified | 1378 |
| 228 | Ga0373954_0299449 | 3300035118 | Bacteria | 793 |
| 229 | Ga0373956_0000537 | 3300035119 | Bacteria | 15481 |
| 230 | Ga0373956_0128730 | 3300035119 | Unclassified | 1184 |
| 231 | Ga0373956_0325362 | 3300035119 | Bacteria | 733 |
| 232 | Ga0373956_0485319 | 3300035119 | Bacteria | 590 |
| 233 | Ga0373957_0000815 | 3300035120 | Bacteria | 8131 |
| 234 | Ga0373957_0004464 | 3300035120 | Unclassified | 4258 |
| 235 | Ga0373957_0004731 | 3300035120 | Bacteria | 4165 |
| 236 | Ga0373957_0171296 | 3300035120 | Unclassified | 897 |
| 237 | Ga0373957_0295655 | 3300035120 | Unclassified | 686 |
| 238 | Ga0373960_0380549 | 3300035121 | Unclassified | 541 |
| 239 | Ga0373943_0000904 | 3300035170 | Bacteria | 13096 |
| 240 | Ga0373943_0001521 | 3300035170 | Bacteria | 10494 |
| 241 | Ga0373946_0000392 | 3300035171 | Bacteria | 14223 |
| 242 | Ga0373946_0011653 | 3300035171 | Bacteria | 3286 |
| 243 | Ga0373946_0027954 | 3300035171 | Unclassified | 2234 |
| 244 | Ga0373955_0000130 | 3300035172 | Bacteria | 29820 |
| 245 | Ga0373955_0004056 | 3300035172 | Bacteria | 6459 |
| 246 | Ga0373955_0011112 | 3300035172 | Bacteria | 4278 |
| 247 | Ga0373955_0131131 | 3300035172 | Bacteria | 1463 |
| 248 | Ga0373955_0303463 | 3300035172 | Unclassified | 963 |
| 249 | Ga0373955_0324325 | 3300035172 | Bacteria | 931 |
| 250 | Ga0373955_0576059 | 3300035172 | Bacteria | 689 |
| 251 | Ga0373961_0046200 | 3300035241 | Unclassified | 1276 |
| 252 | Ga0373924_0000286 | 3300035410 | Bacteria | 15517 |
| 253 | Ga0373924_0015210 | 3300035410 | Bacteria | 2921 |
| 254 | Ga0373924_0017008 | 3300035410 | Bacteria | 2784 |
| 255 | Ga0373931_0030251 | 3300035691 | Unclassified | 2787 |
| 256 | Ga0373935_0001107 | 3300035692 | Bacteria | 14691 |
| 257 | Ga0373935_0057923 | 3300035692 | Bacteria | 2473 |
| 258 | Ga0373935_0128664 | 3300035692 | Bacteria | 1699 |
| 259 | Ga0373935_0295548 | 3300035692 | Unclassified | 1143 |
| 260 | Ga0373935_0369421 | 3300035692 | Bacteria | 1026 |
| 261 | Ga0373935_0492407 | 3300035692 | Bacteria | 889 |
| 262 | Ga0373927_0003915 | 3300035695 | Bacteria | 10552 |
| 263 | Ga0373927_0007610 | 3300035695 | Bacteria | 7336 |
| 264 | Ga0373927_0136070 | 3300035695 | Bacteria | 1606 |
| 265 | Ga0373933_0000121 | 3300035724 | Bacteria | 50773 |
| 266 | Ga0373933_0012868 | 3300035724 | Bacteria | 4627 |
| 267 | Ga0373933_0026106 | 3300035724 | Bacteria | 3352 |
| 268 | Ga0373933_0102060 | 3300035724 | Bacteria | 1780 |
| 269 | Ga0373933_0465492 | 3300035724 | Bacteria | 827 |
| 270 | Ga0373947_0000939 | 3300035725 | Bacteria | 17729 |
| 271 | Ga0373947_0002845 | 3300035725 | Bacteria | 10326 |
| 272 | Ga0373947_0009756 | 3300035725 | Bacteria | 5510 |
| 273 | Ga0373947_0023843 | 3300035725 | Bacteria | 3562 |
| 274 | Ga0373937_0000190 | 3300036401 | Bacteria | 60066 |
| 275 | Ga0373937_0000671 | 3300036401 | Bacteria | 29787 |
| 276 | Ga0373937_0028381 | 3300036401 | Bacteria | 5063 |
| 277 | Ga0373937_0028865 | 3300036401 | Bacteria | 5023 |
| 278 | Ga0373937_0054575 | 3300036401 | Bacteria | 3667 |
| 279 | Ga0373937_0076091 | 3300036401 | Bacteria | 3100 |
| 280 | Ga0373937_0104611 | 3300036401 | Bacteria | 2630 |
| 281 | Ga0373925_0007222 | 3300037068 | Bacteria | 8122 |
| 282 | Ga0373925_0024347 | 3300037068 | Bacteria | 4420 |
| 283 | Ga0373925_0026296 | 3300037068 | Unclassified | 4258 |
| 284 | Ga0373925_0264191 | 3300037068 | Bacteria | 1383 |
| 285 | Ga0373925_0505362 | 3300037068 | Unclassified | 992 |
| 286 | Ga0373925_1520603 | 3300037068 | Bacteria | 548 |
| 287 | Ga0395900_0013258 | 3300037418 | Bacteria | 8424 |
| 288 | Ga0395900_0421033 | 3300037418 | Bacteria | 1296 |
| 289 | Ga0395898_0037444 | 3300037466 | Bacteria | 4812 |
| 290 | Ga0395898_0197852 | 3300037466 | Bacteria | 1920 |
| 291 | Ga0395898_0563540 | 3300037466 | Bacteria | 1081 |
| 292 | Ga0395905_0082224 | 3300037471 | Bacteria | 3018 |
| 293 | Ga0395905_0169589 | 3300037471 | Bacteria | 2050 |
| 294 | Ga0395905_0494174 | 3300037471 | Bacteria | 1123 |
| 295 | Ga0436364_0365242 | 3300037853 | Bacteria | 1402 |
| 296 | Ga0395901_0022032 | 3300038443 | Bacteria | 6530 |
| 297 | Ga0395901_0312714 | 3300038443 | Unclassified | 1626 |
| 298 | Ga0395901_0600939 | 3300038443 | Bacteria | 1109 |
| 299 | Ga0436365_0248728 | 3300039437 | Bacteria | 652 |
| 300 | Ga0436365_1501831 | 3300039437 | Bacteria | 3607 |
| 301 | Ga0436363_1541417 | 3300039450 | Unclassified | 713 |
| 302 | Ga0436362_0236721 | 3300039453 | Bacteria | 1268 |
| 303 | Ga0451789_1217424 | 3300041443 | Bacteria | 1006 |
| 304 | Ga0451793_0887223 | 3300041452 | Unclassified | 2207 |
| 305 | Ga0451795_1713235 | 3300041456 | Bacteria | 931 |
| 306 | Ga0451800_0960620 | 3300041459 | Bacteria | 1496 |
| 307 | Ga0451802_1623103 | 3300041460 | Bacteria | 749 |
| 308 | Ga0451807_1979534 | 3300041486 | Unclassified | 856 |
| 309 | Ga0451833_0893515 | 3300041491 | Bacteria | 1415 |
| 310 | Ga0451835_0620315 | 3300041492 | Unclassified | 2076 |
| 311 | Ga0451839_0751977 | 3300041496 | Unclassified | 3292 |
| 312 | Ga0451841_0626723 | 3300041498 | Unclassified | 707 |
| 313 | Ga0451849_0672841 | 3300041505 | Unclassified | 756 |
| 314 | Ga0451855_1565654 | 3300041511 | Bacteria | 1178 |
| 315 | Ga0451853_2337302 | 3300041512 | Unclassified | 892 |
| 316 | Ga0451853_2571487 | 3300041512 | Bacteria | 1613 |
| 317 | Ga0439448_0141379 | 3300042005 | Bacteria | 833 |
| 318 | Ga0439450_216691 | 3300042008 | Bacteria | 515 |
| 319 | Ga0439458_0132298 | 3300042157 | Unclassified | 661 |
| 320 | Ga0439460_0343140 | 3300042461 | Bacteria | 526 |
| 321 | Ga0450918_023532 | 3300042531 | Bacteria | 1077 |
| 322 | Ga0439440_0197245 | 3300042993 | Unclassified | 596 |
| 323 | Ga0466963_0002216 | 3300044694 | Bacteria | 10754 |
| 324 | Ga0466963_0035889 | 3300044694 | Bacteria | 3230 |
| 325 | Ga0466963_0147959 | 3300044694 | Bacteria | 1630 |
| 326 | Ga0466963_0964451 | 3300044694 | Bacteria | 600 |
| 327 | Ga0466964_0086650 | 3300044706 | Bacteria | 1355 |
| 328 | Ga0466964_0214464 | 3300044706 | Unclassified | 932 |
| 329 | Ga0466964_0610132 | 3300044706 | Bacteria | 599 |
| 330 | Ga0466957_0132348 | 3300044842 | Bacteria | 1599 |
| 331 | Ga0466957_0160110 | 3300044842 | Bacteria | 1461 |
| 332 | Ga0466957_0165010 | 3300044842 | Bacteria | 1440 |
| 333 | Ga0466960_0014177 | 3300044901 | Bacteria | 3405 |
| 334 | Ga0466958_0002307 | 3300045836 | Bacteria | 9518 |
| 335 | Ga0466958_0012372 | 3300045836 | Bacteria | 4833 |
| 336 | Ga0466967_0011663 | 3300045976 | Bacteria | 6675 |
| 337 | Ga0466967_0040251 | 3300045976 | Unclassified | 4023 |
| 338 | Ga0466967_0069312 | 3300045976 | Bacteria | 3151 |
| 339 | Ga0466967_0092643 | 3300045976 | Bacteria | 2748 |
| 340 | Ga0466967_0388563 | 3300045976 | Unclassified | 1356 |
| 341 | Ga0466967_1056651 | 3300045976 | Unclassified | 809 |
| 342 | Ga0466967_1406448 | 3300045976 | Bacteria | 695 |
| 343 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 344 | Ga0495592_0000206 | 3300046454 | Bacteria | 50513 |
| 345 | Ga0495592_0010136 | 3300046454 | Bacteria | 7101 |
| 346 | Ga0495592_0082463 | 3300046454 | Bacteria | 2323 |
| 347 | Ga0495592_0204622 | 3300046454 | Bacteria | 1330 |
| 348 | Ga0495592_0244502 | 3300046454 | Unclassified | 1189 |
| 349 | Ga0495592_0286546 | 3300046454 | Bacteria | 1075 |
| 350 | Ga0495592_0464374 | 3300046454 | Bacteria | 791 |
| 351 | Ga0495603_0000794 | 3300046455 | Bacteria | 18046 |
| 352 | Ga0495603_0106896 | 3300046455 | Bacteria | 1633 |
| 353 | Ga0495603_0197816 | 3300046455 | Bacteria | 1162 |
| 354 | Ga0495629_0001447 | 3300046459 | Bacteria | 18720 |
| 355 | Ga0495629_0001647 | 3300046459 | Bacteria | 17529 |
| 356 | Ga0495629_0016488 | 3300046459 | Bacteria | 5303 |
| 357 | Ga0495629_0113227 | 3300046459 | Bacteria | 1891 |
| 358 | Ga0495629_0134220 | 3300046459 | Bacteria | 1724 |
| 359 | Ga0495641_0003897 | 3300046461 | Bacteria | 10853 |
| 360 | Ga0495641_0010886 | 3300046461 | Bacteria | 5228 |
| 361 | Ga0495641_0013567 | 3300046461 | Bacteria | 4465 |
| 362 | Ga0495641_0191307 | 3300046461 | Unclassified | 917 |
| 363 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 364 | Ga0495651_0000053 | 3300046462 | Bacteria | 85191 |
| 365 | Ga0495651_0024629 | 3300046462 | Bacteria | 4681 |
| 366 | Ga0495651_0040155 | 3300046462 | Unclassified | 3640 |
| 367 | Ga0495651_0339397 | 3300046462 | Bacteria | 996 |
| 368 | Ga0495651_0645968 | 3300046462 | Unclassified | 664 |
| 369 | Ga0495653_0003163 | 3300046463 | Bacteria | 13185 |
| 370 | Ga0495653_0003512 | 3300046463 | Bacteria | 12622 |
| 371 | Ga0495653_0010133 | 3300046463 | Bacteria | 7712 |
| 372 | Ga0495653_0018523 | 3300046463 | Bacteria | 5652 |
| 373 | Ga0495653_0022163 | 3300046463 | Bacteria | 5141 |
| 374 | Ga0495653_0023865 | 3300046463 | Bacteria | 4937 |
| 375 | Ga0495653_0056868 | 3300046463 | Plasmid | 2980 |
| 376 | Ga0495653_0077023 | 3300046463 | Bacteria | 2477 |
| 377 | Ga0495580_0000893 | 3300046472 | Bacteria | 25945 |
| 378 | Ga0495580_0740926 | 3300046472 | Unclassified | 641 |
| 379 | Ga0495582_0000092 | 3300046473 | Bacteria | 46401 |
| 380 | Ga0495582_0004863 | 3300046473 | Bacteria | 7534 |
| 381 | Ga0495582_0011651 | 3300046473 | Bacteria | 4846 |
| 382 | Ga0495582_0050101 | 3300046473 | Bacteria | 2301 |
| 383 | Ga0495582_0120459 | 3300046473 | Bacteria | 1478 |
| 384 | Ga0495582_0154304 | 3300046473 | Bacteria | 1304 |
| 385 | Ga0495639_0000142 | 3300046475 | Bacteria | 37138 |
| 386 | Ga0495639_0005945 | 3300046475 | Bacteria | 5249 |
| 387 | Ga0495639_0048546 | 3300046475 | Bacteria | 1925 |
| 388 | Ga0495662_0001812 | 3300046476 | Bacteria | 10697 |
| 389 | Ga0495662_0007338 | 3300046476 | Bacteria | 5451 |
| 390 | Ga0495662_0057614 | 3300046476 | Bacteria | 1876 |
| 391 | Ga0495662_0090101 | 3300046476 | Unclassified | 1495 |
| 392 | Ga0495662_0107892 | 3300046476 | Bacteria | 1363 |
| 393 | Ga0495662_0209831 | 3300046476 | Unclassified | 960 |
| 394 | Ga0495664_0004862 | 3300046477 | Bacteria | 7348 |
| 395 | Ga0495664_0014410 | 3300046477 | Bacteria | 4482 |
| 396 | Ga0495664_0018021 | 3300046477 | Bacteria | 4038 |
| 397 | Ga0495594_0011460 | 3300046499 | Bacteria | 4609 |
| 398 | Ga0495594_0021566 | 3300046499 | Unclassified | 3438 |
| 399 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 400 | Ga0495608_0002448 | 3300046511 | Bacteria | 13326 |
| 401 | Ga0495608_0012588 | 3300046511 | Bacteria | 5867 |
| 402 | Ga0495608_0020652 | 3300046511 | Bacteria | 4524 |
| 403 | Ga0495608_0062840 | 3300046511 | Bacteria | 2438 |
| 404 | Ga0495608_0149825 | 3300046511 | Bacteria | 1487 |
| 405 | Ga0495608_0282082 | 3300046511 | Unclassified | 1031 |
| 406 | Ga0495608_0291649 | 3300046511 | Unclassified | 1011 |
| 407 | Ga0495608_0322350 | 3300046511 | Bacteria | 954 |
| 408 | Ga0495608_0420729 | 3300046511 | Unclassified | 815 |
| 409 | Ga0495618_0003117 | 3300046514 | Bacteria | 10442 |
| 410 | Ga0495618_0012524 | 3300046514 | Bacteria | 5153 |
| 411 | Ga0495618_0016557 | 3300046514 | Bacteria | 4512 |
| 412 | Ga0495618_0033458 | 3300046514 | Bacteria | 3223 |
| 413 | Ga0495618_0065681 | 3300046514 | Bacteria | 2306 |
| 414 | Ga0495618_0279607 | 3300046514 | Bacteria | 1041 |
| 415 | Ga0495628_0000047 | 3300046516 | Bacteria | 97852 |
| 416 | Ga0495628_0000106 | 3300046516 | Bacteria | 67965 |
| 417 | Ga0495628_0010271 | 3300046516 | Bacteria | 7960 |
| 418 | Ga0495628_0051594 | 3300046516 | Bacteria | 3252 |
| 419 | Ga0495628_0083200 | 3300046516 | Bacteria | 2485 |
| 420 | Ga0495628_0206956 | 3300046516 | Bacteria | 1477 |
| 421 | Ga0495628_0428949 | 3300046516 | Bacteria | 962 |
| 422 | Ga0495628_0647682 | 3300046516 | Unclassified | 750 |
| 423 | Ga0495630_0003384 | 3300046517 | Bacteria | 11110 |
| 424 | Ga0495630_0019551 | 3300046517 | Bacteria | 4980 |
| 425 | Ga0495630_0040697 | 3300046517 | Bacteria | 3473 |
| 426 | Ga0495630_0111053 | 3300046517 | Bacteria | 2076 |
| 427 | Ga0495630_0119196 | 3300046517 | Bacteria | 2002 |
| 428 | Ga0495630_0248721 | 3300046517 | Bacteria | 1358 |
| 429 | Ga0495644_0341821 | 3300046523 | Unclassified | 589 |
| 430 | Ga0495666_0002208 | 3300046526 | Bacteria | 9701 |
| 431 | Ga0495666_0056909 | 3300046526 | Bacteria | 1872 |
| 432 | Ga0495666_0466331 | 3300046526 | Unclassified | 565 |
| 433 | Ga0495652_0000291 | 3300046529 | Bacteria | 59608 |
| 434 | Ga0495652_0012044 | 3300046529 | Bacteria | 7813 |
| 435 | Ga0495652_0013837 | 3300046529 | Bacteria | 7257 |
| 436 | Ga0495652_0029059 | 3300046529 | Bacteria | 4857 |
| 437 | Ga0495652_0041811 | 3300046529 | Bacteria | 3954 |
| 438 | Ga0495652_0086546 | 3300046529 | Plasmid | 2572 |
| 439 | Ga0495652_0130577 | 3300046529 | Bacteria | 1989 |
| 440 | Ga0495652_0571729 | 3300046529 | Unclassified | 774 |
| 441 | Ga0495665_0000679 | 3300046531 | Bacteria | 17435 |
| 442 | Ga0495665_0014908 | 3300046531 | Bacteria | 4185 |
| 443 | Ga0495665_0039831 | 3300046531 | Bacteria | 2502 |
| 444 | Ga0495665_0132573 | 3300046531 | Bacteria | 1304 |
| 445 | Ga0495640_0013511 | 3300046533 | Bacteria | 6207 |
| 446 | Ga0495640_0018628 | 3300046533 | Bacteria | 5141 |
| 447 | Ga0495640_0061462 | 3300046533 | Bacteria | 2551 |
| 448 | Ga0495640_0096261 | 3300046533 | Bacteria | 1948 |
| 449 | Ga0495640_0121671 | 3300046533 | Bacteria | 1696 |
| 450 | Ga0495640_0158769 | 3300046533 | Bacteria | 1450 |
| 451 | Ga0495586_0044616 | 3300046535 | Bacteria | 2388 |
| 452 | Ga0495586_0073448 | 3300046535 | Bacteria | 1871 |
| 453 | Ga0495587_0000119 | 3300046536 | Bacteria | 60244 |
| 454 | Ga0495587_0000756 | 3300046536 | Bacteria | 21566 |
| 455 | Ga0495587_0005073 | 3300046536 | Bacteria | 8610 |
| 456 | Ga0495587_0007941 | 3300046536 | Bacteria | 6854 |
| 457 | Ga0495587_0077122 | 3300046536 | Bacteria | 1935 |
| 458 | Ga0495587_0142677 | 3300046536 | Bacteria | 1366 |
| 459 | Ga0495587_0393103 | 3300046536 | Bacteria | 771 |
| 460 | Ga0495609_0286598 | 3300046538 | Unclassified | 673 |
| 461 | Ga0495645_0000302 | 3300046543 | Bacteria | 35690 |
| 462 | Ga0495645_0049012 | 3300046543 | Plasmid | 3076 |
| 463 | Ga0495645_0084491 | 3300046543 | Bacteria | 2273 |
| 464 | Ga0495645_0172856 | 3300046543 | Bacteria | 1486 |
| 465 | Ga0495645_0250424 | 3300046543 | Unclassified | 1177 |
| 466 | Ga0495667_0000253 | 3300046559 | Bacteria | 34719 |
| 467 | Ga0495667_0001257 | 3300046559 | Bacteria | 16612 |
| 468 | Ga0495667_0014568 | 3300046559 | Bacteria | 5311 |
| 469 | Ga0495667_0018800 | 3300046559 | Bacteria | 4665 |
| 470 | Ga0495667_0020467 | 3300046559 | Bacteria | 4463 |
| 471 | Ga0495667_0030474 | 3300046559 | Bacteria | 3624 |
| 472 | Ga0495667_0044751 | 3300046559 | Unclassified | 2931 |
| 473 | Ga0495667_0098728 | 3300046559 | Bacteria | 1891 |
| 474 | Ga0495667_0210426 | 3300046559 | Bacteria | 1243 |
| 475 | Ga0495634_0013381 | 3300046642 | Bacteria | 5929 |
| 476 | Ga0495634_0015127 | 3300046642 | Bacteria | 5546 |
| 477 | Ga0495634_0028660 | 3300046642 | Bacteria | 3863 |
| 478 | Ga0495634_0030966 | 3300046642 | Bacteria | 3688 |
| 479 | Ga0495634_0070280 | 3300046642 | Bacteria | 2308 |
| 480 | Ga0495611_0303520 | 3300046648 | Bacteria | 736 |
| 481 | Ga0495635_0001972 | 3300046663 | Bacteria | 13953 |
| 482 | Ga0495635_0002434 | 3300046663 | Bacteria | 12698 |
| 483 | Ga0495635_0002435 | 3300046663 | Bacteria | 12698 |
| 484 | Ga0495635_0009108 | 3300046663 | Bacteria | 6931 |
| 485 | Ga0495635_0355529 | 3300046663 | Bacteria | 977 |
| 486 | Ga0495588_0087454 | 3300046674 | Bacteria | 1630 |
| 487 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 488 | Ga0495657_0003973 | 3300046675 | Bacteria | 11866 |
| 489 | Ga0495657_0022269 | 3300046675 | Bacteria | 4542 |
| 490 | Ga0495657_0053709 | 3300046675 | Bacteria | 2695 |
| 491 | Ga0495657_0120503 | 3300046675 | Unclassified | 1652 |
| 492 | Ga0495657_0171193 | 3300046675 | Bacteria | 1337 |
| 493 | Ga0495657_0405778 | 3300046675 | Bacteria | 801 |
| 494 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 495 | Ga0495599_0000063 | 3300046678 | Bacteria | 73690 |
| 496 | Ga0495599_0015920 | 3300046678 | Bacteria | 4667 |
| 497 | Ga0495599_0017126 | 3300046678 | Bacteria | 4502 |
| 498 | Ga0495599_0158477 | 3300046678 | Bacteria | 1400 |
| 499 | Ga0495599_0179996 | 3300046678 | Bacteria | 1303 |
| 500 | Ga0495599_0342330 | 3300046678 | Unclassified | 897 |
| 501 | Ga0495623_0000132 | 3300046679 | Bacteria | 45369 |
| 502 | Ga0495623_0000297 | 3300046679 | Bacteria | 32443 |
| 503 | Ga0495623_0008953 | 3300046679 | Bacteria | 6499 |
| 504 | Ga0495623_0068534 | 3300046679 | Bacteria | 2213 |
| 505 | Ga0495623_0087595 | 3300046679 | Bacteria | 1918 |
| 506 | Ga0495646_0000560 | 3300046680 | Bacteria | 20144 |
| 507 | Ga0495646_0029968 | 3300046680 | Bacteria | 3399 |
| 508 | Ga0495646_0044170 | 3300046680 | Plasmid | 2725 |
| 509 | Ga0495646_0052913 | 3300046680 | Unclassified | 2450 |
| 510 | Ga0495646_0148104 | 3300046680 | Unclassified | 1307 |
| 511 | Ga0495646_0154827 | 3300046680 | Bacteria | 1272 |
| 512 | Ga0495646_0679740 | 3300046680 | Unclassified | 519 |
| 513 | Ga0495647_0001966 | 3300046681 | Bacteria | 6411 |
| 514 | Ga0495647_0004600 | 3300046681 | Unclassified | 4496 |
| 515 | Ga0495647_0174521 | 3300046681 | Bacteria | 932 |
| 516 | Ga0495658_0000245 | 3300046683 | Bacteria | 31102 |
| 517 | Ga0495658_0004873 | 3300046683 | Bacteria | 6585 |
| 518 | Ga0495658_0067271 | 3300046683 | Bacteria | 2072 |
| 519 | Ga0495658_0267989 | 3300046683 | Unclassified | 1076 |
| 520 | Ga0495658_0409863 | 3300046683 | Unclassified | 864 |
| 521 | Ga0495613_0000910 | 3300046689 | Bacteria | 22719 |
| 522 | Ga0495613_0004723 | 3300046689 | Bacteria | 10223 |
| 523 | Ga0495613_0097115 | 3300046689 | Bacteria | 2130 |
| 524 | Ga0495613_0168934 | 3300046689 | Bacteria | 1553 |
| 525 | Ga0495613_0280214 | 3300046689 | Bacteria | 1158 |
| 526 | Ga0495624_0000611 | 3300046690 | Bacteria | 27875 |
| 527 | Ga0495624_0023199 | 3300046690 | Bacteria | 4093 |
| 528 | Ga0495624_0054549 | 3300046690 | Unclassified | 2519 |
| 529 | Ga0495624_0084026 | 3300046690 | Bacteria | 1968 |
| 530 | Ga0495624_0222237 | 3300046690 | Unclassified | 1145 |
| 531 | Ga0495600_0003453 | 3300046809 | Bacteria | 9288 |
| 532 | Ga0495600_0006545 | 3300046809 | Bacteria | 7090 |
| 533 | Ga0495600_0040759 | 3300046809 | Unclassified | 3025 |
| 534 | Ga0495600_0136174 | 3300046809 | Bacteria | 1595 |
| 535 | Ga0495581_0002120 | 3300047315 | Bacteria | 11183 |
| 536 | Ga0495581_0011392 | 3300047315 | Bacteria | 5145 |
| 537 | Ga0495581_0016472 | 3300047315 | Unclassified | 4296 |
| 538 | Ga0495581_0025517 | 3300047315 | Bacteria | 3427 |
| 539 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 540 | Ga0495604_0000749 | 3300047317 | Bacteria | 27290 |
| 541 | Ga0495604_0015660 | 3300047317 | Bacteria | 6052 |
| 542 | Ga0495604_0044615 | 3300047317 | Bacteria | 3462 |
| 543 | Ga0495604_0277873 | 3300047317 | Unclassified | 1132 |
| 544 | Ga0495604_0636213 | 3300047317 | Bacteria | 681 |
| 545 | Ga0495674_0003020 | 3300047319 | Bacteria | 16387 |
| 546 | Ga0495674_0017597 | 3300047319 | Bacteria | 6654 |
| 547 | Ga0495674_0019473 | 3300047319 | Bacteria | 6299 |
| 548 | Ga0495674_0051622 | 3300047319 | Bacteria | 3624 |
| 549 | Ga0495674_0059909 | 3300047319 | Bacteria | 3323 |
| 550 | Ga0495674_0074065 | 3300047319 | Bacteria | 2934 |
| 551 | Ga0495674_0171418 | 3300047319 | Bacteria | 1811 |
| 552 | Ga0495674_0612719 | 3300047319 | Bacteria | 861 |
| 553 | Ga0495674_0688323 | 3300047319 | Unclassified | 803 |
| 554 | Ga0495676_0005393 | 3300047321 | Bacteria | 11722 |
| 555 | Ga0495676_0005787 | 3300047321 | Bacteria | 11339 |
| 556 | Ga0495676_0008262 | 3300047321 | Bacteria | 9547 |
| 557 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 558 | Ga0495680_0001625 | 3300047322 | Bacteria | 23901 |
| 559 | Ga0495680_0008750 | 3300047322 | Bacteria | 9169 |
| 560 | Ga0495680_0012878 | 3300047322 | Bacteria | 7329 |
| 561 | Ga0495680_0031079 | 3300047322 | Bacteria | 4350 |
| 562 | Ga0495680_0036576 | 3300047322 | Bacteria | 3940 |
| 563 | Ga0495680_0114444 | 3300047322 | Bacteria | 1996 |
| 564 | Ga0495675_0000075 | 3300047444 | Bacteria | 69347 |
| 565 | Ga0495675_0031359 | 3300047444 | Bacteria | 3393 |
| 566 | Ga0495675_0066964 | 3300047444 | Bacteria | 2270 |
| 567 | Ga0495677_0258488 | 3300047445 | Bacteria | 682 |
| 568 | Ga0495684_0001323 | 3300047471 | Bacteria | 19950 |
| 569 | Ga0495684_0002467 | 3300047471 | Bacteria | 14745 |
| 570 | Ga0495684_0004368 | 3300047471 | Bacteria | 11045 |
| 571 | Ga0495684_0040159 | 3300047471 | Bacteria | 3587 |
| 572 | Ga0495684_0063140 | 3300047471 | Bacteria | 2816 |
| 573 | Ga0495684_0064877 | 3300047471 | Bacteria | 2775 |
| 574 | Ga0495593_0006744 | 3300047673 | Bacteria | 6720 |
| 575 | Ga0495593_0013851 | 3300047673 | Bacteria | 4594 |
| 576 | Ga0495593_0020301 | 3300047673 | Bacteria | 3721 |
| 577 | Ga0495593_0046619 | 3300047673 | Bacteria | 2308 |
| 578 | Ga0495593_0208198 | 3300047673 | Bacteria | 982 |
| 579 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 580 | Ga0495602_0000524 | 3300048088 | Bacteria | 35765 |
| 581 | Ga0495602_0145081 | 3300048088 | Bacteria | 1874 |
| 582 | Ga0495602_0363618 | 3300048088 | Bacteria | 1041 |
| 583 | Ga0495602_0945225 | 3300048088 | Unclassified | 571 |
| 584 | Ga0495614_0000627 | 3300048089 | Bacteria | 14801 |
| 585 | Ga0495614_0237653 | 3300048089 | Bacteria | 831 |
| 586 | Ga0496100_0168030 | 3300048903 | Bacteria | 1577 |
| 587 | Ga0496100_0168448 | 3300048903 | Bacteria | 1575 |
| 588 | Ga0496100_0486477 | 3300048903 | Bacteria | 949 |
| 589 | Ga0496100_1091687 | 3300048903 | Bacteria | 629 |
| 590 | Ga0496101_0010710 | 3300048904 | Bacteria | 6062 |
| 591 | Ga0496101_0012577 | 3300048904 | Bacteria | 5651 |
| 592 | Ga0496101_0021871 | 3300048904 | Bacteria | 4396 |
| 593 | Ga0496101_0097771 | 3300048904 | Archaea | 2193 |
| 594 | Ga0496102_0030034 | 3300048905 | Bacteria | 4864 |
| 595 | Ga0496102_0689362 | 3300048905 | Unclassified | 945 |
| 596 | Ga0496102_0842711 | 3300048905 | Bacteria | 839 |
| 597 | Ga0496102_0870599 | 3300048905 | Unclassified | 823 |
| 598 | Ga0496103_0808850 | 3300048906 | Unclassified | 591 |
| 599 | Ga0496104_0020586 | 3300048907 | Bacteria | 6048 |
| 600 | Ga0496104_0084495 | 3300048907 | Unclassified | 3029 |
| 601 | Ga0496104_0247106 | 3300048907 | Bacteria | 1697 |
| 602 | Ga0496104_1145667 | 3300048907 | Bacteria | 681 |
| 603 | Ga0496105_0020375 | 3300048908 | Bacteria | 5359 |
| 604 | Ga0496105_0082539 | 3300048908 | Bacteria | 2655 |
| 605 | Ga0496105_0339667 | 3300048908 | Unclassified | 1201 |
| 606 | Ga0496105_0525487 | 3300048908 | Bacteria | 926 |
| 607 | Ga0496106_0306971 | 3300048909 | Bacteria | 1273 |
| 608 | Ga0496106_0432191 | 3300048909 | Bacteria | 1058 |
| 609 | Ga0496106_0730396 | 3300048909 | Unclassified | 788 |
| 610 | Ga0496108_0007624 | 3300048911 | Bacteria | 8766 |
| 611 | Ga0496108_0198479 | 3300048911 | Unclassified | 1741 |
| 612 | Ga0496109_0073074 | 3300048912 | Bacteria | 3151 |
| 613 | Ga0496109_0153915 | 3300048912 | Unclassified | 2154 |
| 614 | Ga0496109_0173614 | 3300048912 | Bacteria | 2023 |
| 615 | Ga0496110_0068794 | 3300048913 | Bacteria | 3134 |
| 616 | Ga0496110_0755706 | 3300048913 | Bacteria | 875 |
| 617 | Ga0496110_0816958 | 3300048913 | Unclassified | 837 |
| 618 | Ga0496111_0016322 | 3300048914 | Bacteria | 5115 |
| 619 | Ga0496111_0056360 | 3300048914 | Archaea | 2843 |
| 620 | Ga0496111_0579586 | 3300048914 | Bacteria | 822 |
| 621 | Ga0496111_0625687 | 3300048914 | Unclassified | 787 |
| 622 | Ga0496112_0048934 | 3300048915 | Bacteria | 4142 |
| 623 | Ga0496112_0160495 | 3300048915 | Bacteria | 2215 |
| 624 | Ga0496112_0267340 | 3300048915 | Unclassified | 1659 |
| 625 | Ga0496112_0639566 | 3300048915 | Unclassified | 994 |
| 626 | Ga0496112_0646597 | 3300048915 | Bacteria | 987 |
| 627 | Ga0496112_1157994 | 3300048915 | Bacteria | 691 |
| 628 | Ga0496113_0034492 | 3300048916 | Bacteria | 3692 |
| 629 | Ga0496113_0307538 | 3300048916 | Bacteria | 1270 |
| 630 | Ga0496114_0006163 | 3300048917 | Bacteria | 9436 |
| 631 | Ga0496114_0180763 | 3300048917 | Bacteria | 1842 |
| 632 | Ga0496114_0187698 | 3300048917 | Unclassified | 1807 |
| 633 | Ga0496114_0366979 | 3300048917 | Unclassified | 1274 |
| 634 | Ga0496114_0648693 | 3300048917 | Bacteria | 929 |
| 635 | Ga0496114_0729899 | 3300048917 | Bacteria | 867 |
| 636 | Ga0496115_0016435 | 3300048918 | Bacteria | 5636 |
| 637 | Ga0496115_0048963 | 3300048918 | Bacteria | 3381 |
| 638 | Ga0496115_0128664 | 3300048918 | Bacteria | 2087 |
| 639 | Ga0496115_0555020 | 3300048918 | Bacteria | 918 |
| 640 | Ga0496126_0869225 | 3300048929 | Bacteria | 686 |
| 641 | Ga0501031_0005545 | 3300049568 | Bacteria | 8216 |
| 642 | Ga0501033_0102724 | 3300049570 | Bacteria | 2085 |
| 643 | Ga0501033_0526520 | 3300049570 | Bacteria | 816 |
| 644 | Ga0501034_0100111 | 3300049571 | Bacteria | 2893 |
| 645 | Ga0501036_0002610 | 3300049572 | Bacteria | 14211 |
| 646 | Ga0501036_0127547 | 3300049572 | Unclassified | 2148 |
| 647 | Ga0501036_0246494 | 3300049572 | Bacteria | 1498 |
| 648 | Ga0501038_0112614 | 3300049574 | Bacteria | 2252 |
| 649 | Ga0501038_0182507 | 3300049574 | Bacteria | 1692 |
| 650 | Ga0501038_0969250 | 3300049574 | Bacteria | 625 |
| 651 | Ga0501039_0022722 | 3300049575 | Bacteria | 4812 |
| 652 | Ga0501039_0086997 | 3300049575 | Bacteria | 2434 |
| 653 | Ga0501040_0027834 | 3300049576 | Bacteria | 3807 |
| 654 | Ga0501041_0011618 | 3300049577 | Bacteria | 5211 |
| 655 | Ga0501041_0232713 | 3300049577 | Bacteria | 1157 |
| 656 | Ga0501042_0046084 | 3300049578 | Bacteria | 3108 |
| 657 | Ga0501042_0073561 | 3300049578 | Bacteria | 2444 |
| 658 | Ga0501043_0024389 | 3300049579 | Bacteria | 4747 |
| 659 | Ga0501046_0081015 | 3300049580 | Bacteria | 2507 |
| 660 | Ga0501046_0173524 | 3300049580 | Bacteria | 1616 |
| 661 | Ga0501048_0012534 | 3300049582 | Bacteria | 6308 |
| 662 | Ga0501048_0289318 | 3300049582 | Bacteria | 1165 |
| 663 | Ga0501067_0041700 | 3300049583 | Bacteria | 2548 |
| 664 | Ga0501067_0044444 | 3300049583 | Bacteria | 2468 |
| 665 | Ga0501068_0131794 | 3300049584 | Unclassified | 1563 |
| 666 | Ga0501069_0079764 | 3300049585 | Unclassified | 1843 |
| 667 | Ga0501070_0048483 | 3300049586 | Bacteria | 3528 |
| 668 | Ga0501070_0076925 | 3300049586 | Bacteria | 2762 |
| 669 | Ga0501070_0179339 | 3300049586 | Unclassified | 1744 |
| 670 | Ga0501070_0794439 | 3300049586 | Bacteria | 743 |
| 671 | Ga0501071_0027044 | 3300049587 | Bacteria | 4033 |
| 672 | Ga0501072_0035928 | 3300049588 | Bacteria | 3883 |
| 673 | Ga0501072_0132572 | 3300049588 | Bacteria | 1986 |
| 674 | Ga0501072_0375294 | 3300049588 | Bacteria | 1128 |
| 675 | Ga0501073_0132128 | 3300049589 | Bacteria | 1730 |
| 676 | Ga0501073_0407267 | 3300049589 | Bacteria | 940 |
| 677 | Ga0501074_0008925 | 3300049590 | Bacteria | 7270 |
| 678 | Ga0501074_0084497 | 3300049590 | Bacteria | 2275 |
| 679 | Ga0501074_0203431 | 3300049590 | Bacteria | 1411 |
| 680 | Ga0501075_0013273 | 3300049591 | Bacteria | 5878 |
| 681 | Ga0501075_0697488 | 3300049591 | Bacteria | 773 |
| 682 | Ga0501076_0019824 | 3300049592 | Bacteria | 5144 |
| 683 | Ga0501076_0118346 | 3300049592 | Unclassified | 2144 |
| 684 | Ga0501077_0013254 | 3300049593 | Bacteria | 5166 |
| 685 | Ga0501077_0024737 | 3300049593 | Bacteria | 3812 |
| 686 | Ga0501079_0008733 | 3300049741 | Bacteria | 7679 |
| 687 | Ga0501079_0017873 | 3300049741 | Bacteria | 5416 |
| 688 | Ga0501080_0011560 | 3300049742 | Bacteria | 8084 |
| 689 | Ga0501080_0188607 | 3300049742 | Bacteria | 1895 |
| 690 | Ga0501080_0486739 | 3300049742 | Bacteria | 1103 |
| 691 | Ga0501080_0637596 | 3300049742 | Bacteria | 943 |
| 692 | Ga0501081_0010332 | 3300049743 | Bacteria | 6092 |
| 693 | Ga0501081_0051741 | 3300049743 | Bacteria | 2832 |
| 694 | Ga0501081_0204610 | 3300049743 | Bacteria | 1432 |
| 695 | Ga0501083_0002073 | 3300049744 | Bacteria | 13795 |
| 696 | Ga0501083_0145013 | 3300049744 | Unclassified | 1554 |
| 697 | Ga0501035_0118682 | 3300049822 | Unclassified | 2314 |
| 698 | Ga0501035_0276210 | 3300049822 | Bacteria | 1421 |
| 699 | Ga0501044_0092185 | 3300049823 | Bacteria | 3056 |
| 700 | Ga0501044_0498229 | 3300049823 | Bacteria | 1120 |
| 701 | Ga0501045_0020852 | 3300049824 | Bacteria | 4684 |
| 702 | Ga0501045_0354847 | 3300049824 | Bacteria | 1091 |
| 703 | nmdc:mga05p37_4173_c1 | 3300050507 | Bacteria | 16876 |
| 704 | nmdc:mga08y16_307245_c1 | 3300050511 | Unclassified | 1634 |
| 705 | nmdc:mga08y16_46468_c1 | 3300050511 | Bacteria | 4545 |
| 706 | nmdc:mga0n895_135749_c1 | 3300050512 | Bacteria | 2487 |
| 707 | nmdc:mga0n895_262827_c1 | 3300050512 | Bacteria | 1751 |
| 708 | nmdc:mga0n895_317217_c1 | 3300050512 | Bacteria | 1580 |
| 709 | nmdc:mga0rr50_135995_c1 | 3300050513 | Bacteria | 1973 |
| 710 | nmdc:mga0rr50_525404_c1 | 3300050513 | Bacteria | 1007 |
| 711 | nmdc:mga08x19_349782_c1 | 3300050514 | Bacteria | 1032 |
| 712 | nmdc:mga08x19_722228_c1 | 3300050514 | Bacteria | 707 |
| 713 | nmdc:mga0a205_131851_c1 | 3300050515 | Unclassified | 2399 |
| 714 | nmdc:mga0a205_35031_c1 | 3300050515 | Bacteria | 4820 |
| 715 | nmdc:mga0a205_507675_c1 | 3300050515 | Bacteria | 1062 |
| 716 | nmdc:mga0a205_540401_c1 | 3300050515 | Bacteria | 1021 |
| 717 | nmdc:mga0a205_589259_c1 | 3300050515 | Bacteria | 965 |
| 718 | Ga0495601_0001003 | 3300053077 | Bacteria | 15450 |
| 719 | Ga0495601_0100744 | 3300053077 | Bacteria | 1865 |
| 720 | Ga0495601_0312007 | 3300053077 | Bacteria | 1024 |
| 721 | Ga0495612_0003375 | 3300053078 | Bacteria | 6613 |
| 722 | Ga0495612_0053481 | 3300053078 | Bacteria | 1663 |
| 723 | Ga0495612_0101886 | 3300053078 | Bacteria | 1223 |
| 724 | Ga0495612_0132155 | 3300053078 | Unclassified | 1079 |
| 725 | Ga0495612_0304652 | 3300053078 | Unclassified | 715 |
| 726 | Ga0495612_0541929 | 3300053078 | Unclassified | 536 |
| 727 | Ga0495595_0010809 | 3300053084 | Bacteria | 3804 |
| 728 | Ga0495595_0140268 | 3300053084 | Bacteria | 1186 |
| 729 | Ga0495595_0299016 | 3300053084 | Unclassified | 809 |
| 730 | Ga0495619_0000648 | 3300053085 | Bacteria | 22843 |
| 731 | Ga0495619_0002217 | 3300053085 | Bacteria | 12867 |
| 732 | Ga0495619_0005526 | 3300053085 | Bacteria | 8021 |
| 733 | Ga0495619_0030751 | 3300053085 | Bacteria | 3476 |
| 734 | Ga0495619_0067818 | 3300053085 | Unclassified | 2382 |
| 735 | Ga0495619_0156100 | 3300053085 | Bacteria | 1575 |
| 736 | Ga0495619_0172616 | 3300053085 | Bacteria | 1495 |
| 737 | Ga0495619_0358339 | 3300053085 | Bacteria | 1009 |
| 738 | Ga0495619_0377177 | 3300053085 | Bacteria | 980 |
| 739 | Ga0501084_0041451 | 3300054114 | Bacteria | 3851 |
| 740 | Ga0501084_0044995 | 3300054114 | Bacteria | 3696 |
| 741 | Ga0501084_0171729 | 3300054114 | Bacteria | 1830 |
| 742 | Ga0501084_0180481 | 3300054114 | Bacteria | 1782 |
| 743 | Ga0590077_032440 | 3300059426 | Bacteria | 1144 |
| 744 | Ga0501082_0091494 | 3300060353 | Bacteria | 2627 |
| 745 | Ga0501082_0344756 | 3300060353 | Bacteria | 1298 |
| 746 | Ga0501082_0399822 | 3300060353 | Bacteria | 1199 |
| 747 | Ga0466962_0042247 | 3300061719 | Bacteria | 2182 |
| 748 | Ga0466962_0334518 | 3300061719 | Bacteria | 752 |
| 749 | Ga0530510_0006433 | 3300061734 | Bacteria | 8184 |
| 750 | Ga0530510_0008590 | 3300061734 | Bacteria | 7134 |
| 751 | Ga0530510_0664043 | 3300061734 | Bacteria | 794 |
| 752 | Ga0530510_0918408 | 3300061734 | Unclassified | 669 |
| 753 | Ga0436364_0458282 | |||
| 754 | Ga0070658_10029449 | |||
| 755 | Ga0070683_100008344 | |||
| 756 | Ga0070683_100669714 | |||
| 757 | Ga0070680_100092427 | |||
| 758 | Ga0070680_100180989 | |||
| 759 | Ga0070680_100197355 | |||
| 760 | Ga0070680_100432210 | |||
| 761 | Ga0068868_100558505 | |||
| 762 | Ga0070660_100008122 | |||
| 763 | Ga0070661_100025917 | |||
| 764 | Ga0070674_100733305 | |||
| 765 | Ga0070688_101383295 | |||
| 766 | Ga0070659_100156890 | |||
| 767 | Ga0070659_100587949 | |||
| 768 | Ga0070659_100958223 | |||
| 769 | Ga0070709_10910372 | |||
| 770 | Ga0070713_100017211 | |||
| 771 | Ga0070713_100635507 | |||
| 772 | Ga0070710_10122823 | |||
| 773 | Ga0070710_10136858 | |||
| 774 | Ga0070710_10385815 | |||
| 775 | Ga0070711_100019629 | |||
| 776 | Ga0070711_100027531 | |||
| 777 | Ga0070711_100192452 | |||
| 778 | Ga0070711_100519762 | |||
| 779 | Ga0070705_100367770 | |||
| 780 | Ga0070700_100752237 | |||
| 781 | Ga0070708_100358408 | |||
| 782 | Ga0070678_100790694 | |||
| 783 | Ga0070681_10021809 | |||
| 784 | Ga0070681_10102947 | |||
| 785 | Ga0070681_10132409 | |||
| 786 | Ga0070681_10239167 | |||
| 787 | Ga0070681_10791058 | |||
| 788 | Ga0068867_100531156 | |||
| 789 | Ga0070706_100036315 | |||
| 790 | Ga0070706_100365423 | |||
| 791 | Ga0070707_100088122 | |||
| 792 | Ga0070707_100181252 | |||
| 793 | Ga0070707_100738711 | |||
| 794 | Ga0070707_100958329 | |||
| 795 | Ga0070698_100122382 | |||
| 796 | Ga0070699_100010266 | |||
| 797 | Ga0070699_100032770 | |||
| 798 | Ga0070699_100598040 | |||
| 799 | Ga0070679_100067576 | |||
| 800 | Ga0070679_100072003 | |||
| 801 | Ga0070679_100248215 | |||
| 802 | Ga0070684_100028374 | |||
| 803 | Ga0070684_100149217 | |||
| 804 | Ga0070684_101212842 | |||
| 805 | Ga0070697_100005179 | |||
| 806 | Ga0070697_100005436 | |||
| 807 | Ga0068853_100314262 | |||
| 808 | Ga0068853_100494058 | |||
| 809 | Ga0070695_100118462 | |||
| 810 | Ga0070665_100444434 | |||
| 811 | Ga0068857_100056585 | |||
| 812 | Ga0068857_100352627 | |||
| 813 | Ga0068854_100517225 | |||
| 814 | Ga0068856_100143144 | |||
| 815 | Ga0068856_100320612 | |||
| 816 | Ga0068856_100329602 | |||
| 817 | Ga0081455_10081162 | |||
| 818 | Ga0081455_10475021 | |||
| 819 | Ga0081540_1205524 | |||
| 820 | Ga0070717_10169286 | |||
| 821 | Ga0070717_10211171 | |||
| 822 | Ga0070717_10285468 | |||
| 823 | Ga0070717_10596693 | |||
| 824 | Ga0070717_10621181 | |||
| 825 | Ga0070717_11460413 | |||
| 826 | Ga0075432_10048467 | |||
| 827 | Ga0070715_10029745 | |||
| 828 | Ga0070715_10353491 | |||
| 829 | Ga0070715_10451581 | |||
| 830 | Ga0070716_100095427 | |||
| 831 | Ga0070712_100003758 | |||
| 832 | Ga0070712_100023530 | |||
| 833 | Ga0070712_100106718 | |||
| 834 | Ga0070712_100457759 | |||
| 835 | Ga0075433_10019520 | |||
| 836 | Ga0075433_10136034 | |||
| 837 | Ga0075433_10333055 | |||
| 838 | Ga0075434_100352207 | |||
| 839 | Ga0075436_100029394 | |||
| 840 | Ga0075435_100226938 | |||
| 841 | Ga0075435_100716449 | |||
| 842 | Ga0075435_101401567 | |||
| 843 | Ga0105240_10264969 | |||
| 844 | Ga0105240_10303951 | |||
| 845 | Ga0105240_10771158 | |||
| 846 | Ga0105240_10812314 | |||
| 847 | Ga0111539_10087422 | |||
| 848 | Ga0111539_10128424 | |||
| 849 | Ga0111539_10234832 | |||
| 850 | Ga0105245_10041686 | |||
| 851 | Ga0105245_10843995 | |||
| 852 | Ga0105245_10995498 | |||
| 853 | Ga0105245_11425718 | |||
| 854 | Ga0105247_10788889 | |||
| 855 | Ga0105243_10588698 | |||
| 856 | Ga0105243_10918056 | |||
| 857 | Ga0105241_10943706 | |||
| 858 | Ga0105241_11339433 | |||
| 859 | Ga0105242_10680159 | |||
| 860 | Ga0105237_10173645 | |||
| 861 | Ga0105237_10336253 | |||
| 862 | Ga0105237_10540100 | |||
| 863 | Ga0105249_10368669 | |||
| 864 | Ga0105249_11800236 | |||
| 865 | Ga0105239_10357555 | |||
| 866 | Ga0105239_10514669 | |||
| 867 | Ga0105246_10526344 | |||
| 868 | Ga0157338_1078832 | |||
| 869 | Ga0157373_10055526 | |||
| 870 | Ga0157370_10004652 | |||
| 871 | Ga0157370_10474537 | |||
| 872 | Ga0157370_12005301 | |||
| 873 | Ga0157369_10874590 | |||
| 874 | Ga0157369_10985058 | |||
| 875 | Ga0157374_11189823 | |||
| 876 | Ga0163162_11236513 | |||
| 877 | Ga0157372_10171621 | |||
| 878 | Ga0157372_10562325 | |||
| 879 | Ga0157375_12338806 | |||
| 880 | Ga0163163_10172619 | |||
| 881 | Ga0163163_10271834 | |||
| 882 | Ga0163163_10555380 | |||
| 883 | Ga0163163_10910127 | |||
| 884 | Ga0157380_10469996 | |||
| 885 | Ga0182008_10002385 | |||
| 886 | Ga0157377_10138807 | |||
| 887 | Ga0157376_10762826 | |||
| 888 | Ga0157376_12091758 | |||
| 889 | Ga0182006_1085570 | |||
| 890 | Ga0163161_10748039 | |||
| 891 | Ga0197907_11002288 | |||
| 892 | Ga0206356_11160239 | |||
| 893 | Ga0206354_11222688 | |||
| 894 | Ga0206353_10181333 | |||
| 895 | Ga0206353_12023555 | |||
| 896 | Ga0213875_10155949 | |||
| 897 | Ga0207692_10005869 | |||
| 898 | Ga0207692_10033859 | |||
| 899 | Ga0207692_10073206 | |||
| 900 | Ga0207685_10005475 | |||
| 901 | Ga0207685_10481195 | |||
| 902 | Ga0207705_10063949 | |||
| 903 | Ga0207684_10018469 | |||
| 904 | Ga0207684_10036456 | |||
| 905 | Ga0207684_10144524 | |||
| 906 | Ga0207707_10081694 | |||
| 907 | Ga0207707_10184886 | |||
| 908 | Ga0207695_10375453 | |||
| 909 | Ga0207671_10025969 | |||
| 910 | Ga0207671_10104596 | |||
| 911 | Ga0207693_10002613 | |||
| 912 | Ga0207693_10013042 | |||
| 913 | Ga0207693_10018376 | |||
| 914 | Ga0207693_10130761 | |||
| 915 | Ga0207693_10200459 | |||
| 916 | Ga0207663_10008287 | |||
| 917 | Ga0207663_10109403 | |||
| 918 | Ga0207663_10331634 | |||
| 919 | Ga0207663_10385033 | |||
| 920 | Ga0207663_10397157 | |||
| 921 | Ga0207663_10414933 | |||
| 922 | Ga0207660_10075917 | |||
| 923 | Ga0207657_10000964 | |||
| 924 | Ga0207649_10032593 | |||
| 925 | Ga0207646_10007631 | |||
| 926 | Ga0207646_10047283 | |||
| 927 | Ga0207681_11231161 | |||
| 928 | Ga0207700_10039434 | |||
| 929 | Ga0207700_10471696 | |||
| 930 | Ga0207664_11311797 | |||
| 931 | Ga0207664_11395023 | |||
| 932 | Ga0207690_10276888 | |||
| 933 | Ga0207665_10699407 | |||
| 934 | Ga0207691_10553542 | |||
| 935 | Ga0207661_10139208 | |||
| 936 | Ga0207661_10360673 | |||
| 937 | Ga0207661_10564533 | |||
| 938 | Ga0207667_10116255 | |||
| 939 | Ga0207712_10337729 | |||
| 940 | Ga0207668_11648477 | |||
| 941 | Ga0207702_10072302 | |||
| 942 | Ga0207702_10247817 | |||
| 943 | Ga0207648_10128270 | |||
| 944 | Ga0207674_10070623 | |||
| 945 | Ga0207674_10381071 | |||
| 946 | Ga0207683_11087410 | |||
| 947 | Ga0207428_10283271 | |||
| 948 | Ga0268266_10634242 | |||
| 949 | Ga0268265_10931211 | |||
| 950 | Ga0265760_10257865 | |||
| 951 | Ga0265340_10116097 | |||
| 952 | Ga0265314_10336595 | |||
| 953 | Ga0307405_10482313 | |||
| 954 | Ga0307410_11098914 | |||
| 955 | Ga0307409_100816850 | |||
| 956 | Ga0307415_100363188 | |||
| 957 | Ga0373926_0001987 | |||
| 958 | Ga0373926_0004338 | |||
| 959 | Ga0373926_0079196 | |||
| 960 | Ga0373934_0000196 | |||
| 961 | Ga0373934_0065260 | |||
| 962 | Ga0373944_0001293 | |||
| 963 | Ga0373944_0001729 | |||
| 964 | Ga0373944_0062118 | |||
| 965 | Ga0373952_0019633 | |||
| 966 | Ga0373923_0000096 | |||
| 967 | Ga0373923_0006540 | |||
| 968 | Ga0373923_0349978 | |||
| 969 | Ga0373936_0002062 | |||
| 970 | Ga0373936_0012555 | |||
| 971 | Ga0373936_0025147 | |||
| 972 | Ga0373945_0000006 | |||
| 973 | Ga0373945_0000033 | |||
| 974 | Ga0373945_0018772 | |||
| 975 | Ga0373953_0000133 | |||
| 976 | Ga0373953_0002866 | |||
| 977 | Ga0373953_0163199 | |||
| 978 | Ga0373954_0101660 | |||
| 979 | Ga0373954_0102957 | |||
| 980 | Ga0373954_0299449 | |||
| 981 | Ga0373956_0000537 | |||
| 982 | Ga0373956_0128730 | |||
| 983 | Ga0373956_0325362 | |||
| 984 | Ga0373956_0485319 | |||
| 985 | Ga0373957_0000815 | |||
| 986 | Ga0373957_0004464 | |||
| 987 | Ga0373957_0004731 | |||
| 988 | Ga0373957_0171296 | |||
| 989 | Ga0373957_0295655 | |||
| 990 | Ga0373960_0380549 | |||
| 991 | Ga0373943_0000904 | |||
| 992 | Ga0373943_0001521 | |||
| 993 | Ga0373946_0000392 | |||
| 994 | Ga0373946_0011653 | |||
| 995 | Ga0373946_0027954 | |||
| 996 | Ga0373955_0000130 | |||
| 997 | Ga0373955_0004056 | |||
| 998 | Ga0373955_0011112 | |||
| 999 | Ga0373955_0131131 | |||
| 1000 | Ga0373955_0303463 | |||
| 1001 | Ga0373955_0324325 | |||
| 1002 | Ga0373955_0576059 | |||
| 1003 | Ga0373961_0046200 | |||
| 1004 | Ga0373924_0000286 | |||
| 1005 | Ga0373924_0015210 | |||
| 1006 | Ga0373924_0017008 | |||
| 1007 | Ga0373931_0030251 | |||
| 1008 | Ga0373935_0001107 | |||
| 1009 | Ga0373935_0057923 | |||
| 1010 | Ga0373935_0128664 | |||
| 1011 | Ga0373935_0295548 | |||
| 1012 | Ga0373935_0369421 | |||
| 1013 | Ga0373935_0492407 | |||
| 1014 | Ga0373927_0003915 | |||
| 1015 | Ga0373927_0007610 | |||
| 1016 | Ga0373927_0136070 | |||
| 1017 | Ga0373933_0000121 | |||
| 1018 | Ga0373933_0012868 | |||
| 1019 | Ga0373933_0026106 | |||
| 1020 | Ga0373933_0102060 | |||
| 1021 | Ga0373933_0465492 | |||
| 1022 | Ga0373947_0000939 | |||
| 1023 | Ga0373947_0002845 | |||
| 1024 | Ga0373947_0009756 | |||
| 1025 | Ga0373947_0023843 | |||
| 1026 | Ga0373937_0000190 | |||
| 1027 | Ga0373937_0000671 | |||
| 1028 | Ga0373937_0028381 | |||
| 1029 | Ga0373937_0028865 | |||
| 1030 | Ga0373937_0054575 | |||
| 1031 | Ga0373937_0076091 | |||
| 1032 | Ga0373937_0104611 | |||
| 1033 | Ga0373925_0007222 | |||
| 1034 | Ga0373925_0024347 | |||
| 1035 | Ga0373925_0026296 | |||
| 1036 | Ga0373925_0264191 | |||
| 1037 | Ga0373925_0505362 | |||
| 1038 | Ga0373925_1520603 | |||
| 1039 | Ga0395900_0013258 | |||
| 1040 | Ga0395900_0421033 | |||
| 1041 | Ga0395898_0037444 | |||
| 1042 | Ga0395898_0197852 | |||
| 1043 | Ga0395898_0563540 | |||
| 1044 | Ga0395905_0082224 | |||
| 1045 | Ga0395905_0169589 | |||
| 1046 | Ga0395905_0494174 | |||
| 1047 | Ga0436364_0365242 | |||
| 1048 | Ga0395901_0022032 | |||
| 1049 | Ga0395901_0312714 | |||
| 1050 | Ga0395901_0600939 | |||
| 1051 | Ga0436365_0248728 | |||
| 1052 | Ga0436365_1501831 | |||
| 1053 | Ga0436363_1541417 | |||
| 1054 | Ga0436362_0236721 | |||
| 1055 | Ga0451789_1217424 | |||
| 1056 | Ga0451793_0887223 | |||
| 1057 | Ga0451795_1713235 | |||
| 1058 | Ga0451800_0960620 | |||
| 1059 | Ga0451802_1623103 | |||
| 1060 | Ga0451807_1979534 | |||
| 1061 | Ga0451833_0893515 | |||
| 1062 | Ga0451835_0620315 | |||
| 1063 | Ga0451839_0751977 | |||
| 1064 | Ga0451841_0626723 | |||
| 1065 | Ga0451849_0672841 | |||
| 1066 | Ga0451855_1565654 | |||
| 1067 | Ga0451853_2337302 | |||
| 1068 | Ga0451853_2571487 | |||
| 1069 | Ga0439448_0141379 | |||
| 1070 | Ga0439450_216691 | |||
| 1071 | Ga0439458_0132298 | |||
| 1072 | Ga0439460_0343140 | |||
| 1073 | Ga0450918_023532 | |||
| 1074 | Ga0439440_0197245 | |||
| 1075 | Ga0466963_0002216 | |||
| 1076 | Ga0466963_0035889 | |||
| 1077 | Ga0466963_0147959 | |||
| 1078 | Ga0466963_0964451 | |||
| 1079 | Ga0466964_0086650 | |||
| 1080 | Ga0466964_0214464 | |||
| 1081 | Ga0466964_0610132 | |||
| 1082 | Ga0466957_0132348 | |||
| 1083 | Ga0466957_0160110 | |||
| 1084 | Ga0466957_0165010 | |||
| 1085 | Ga0466960_0014177 | |||
| 1086 | Ga0466958_0002307 | |||
| 1087 | Ga0466958_0012372 | |||
| 1088 | Ga0466967_0011663 | |||
| 1089 | Ga0466967_0040251 | |||
| 1090 | Ga0466967_0069312 | |||
| 1091 | Ga0466967_0092643 | |||
| 1092 | Ga0466967_0388563 | |||
| 1093 | Ga0466967_1056651 | |||
| 1094 | Ga0466967_1406448 | |||
| 1095 | Ga0495592_0000070 | |||
| 1096 | Ga0495592_0000206 | |||
| 1097 | Ga0495592_0010136 | |||
| 1098 | Ga0495592_0082463 | |||
| 1099 | Ga0495592_0204622 | |||
| 1100 | Ga0495592_0244502 | |||
| 1101 | Ga0495592_0286546 | |||
| 1102 | Ga0495592_0464374 | |||
| 1103 | Ga0495603_0000794 | |||
| 1104 | Ga0495603_0106896 | |||
| 1105 | Ga0495603_0197816 | |||
| 1106 | Ga0495629_0001447 | |||
| 1107 | Ga0495629_0001647 | |||
| 1108 | Ga0495629_0016488 | |||
| 1109 | Ga0495629_0113227 | |||
| 1110 | Ga0495629_0134220 | |||
| 1111 | Ga0495641_0003897 | |||
| 1112 | Ga0495641_0010886 | |||
| 1113 | Ga0495641_0013567 | |||
| 1114 | Ga0495641_0191307 | |||
| 1115 | Ga0495651_0000042 | |||
| 1116 | Ga0495651_0000053 | |||
| 1117 | Ga0495651_0024629 | |||
| 1118 | Ga0495651_0040155 | |||
| 1119 | Ga0495651_0339397 | |||
| 1120 | Ga0495651_0645968 | |||
| 1121 | Ga0495653_0003163 | |||
| 1122 | Ga0495653_0003512 | |||
| 1123 | Ga0495653_0010133 | |||
| 1124 | Ga0495653_0018523 | |||
| 1125 | Ga0495653_0022163 | |||
| 1126 | Ga0495653_0023865 | |||
| 1127 | Ga0495653_0056868 | |||
| 1128 | Ga0495653_0077023 | |||
| 1129 | Ga0495580_0000893 | |||
| 1130 | Ga0495580_0740926 | |||
| 1131 | Ga0495582_0000092 | |||
| 1132 | Ga0495582_0004863 | |||
| 1133 | Ga0495582_0011651 | |||
| 1134 | Ga0495582_0050101 | |||
| 1135 | Ga0495582_0120459 | |||
| 1136 | Ga0495582_0154304 | |||
| 1137 | Ga0495639_0000142 | |||
| 1138 | Ga0495639_0005945 | |||
| 1139 | Ga0495639_0048546 | |||
| 1140 | Ga0495662_0001812 | |||
| 1141 | Ga0495662_0007338 | |||
| 1142 | Ga0495662_0057614 | |||
| 1143 | Ga0495662_0090101 | |||
| 1144 | Ga0495662_0107892 | |||
| 1145 | Ga0495662_0209831 | |||
| 1146 | Ga0495664_0004862 | |||
| 1147 | Ga0495664_0014410 | |||
| 1148 | Ga0495664_0018021 | |||
| 1149 | Ga0495594_0011460 | |||
| 1150 | Ga0495594_0021566 | |||
| 1151 | Ga0495608_0000054 | |||
| 1152 | Ga0495608_0002448 | |||
| 1153 | Ga0495608_0012588 | |||
| 1154 | Ga0495608_0020652 | |||
| 1155 | Ga0495608_0062840 | |||
| 1156 | Ga0495608_0149825 | |||
| 1157 | Ga0495608_0282082 | |||
| 1158 | Ga0495608_0291649 | |||
| 1159 | Ga0495608_0322350 | |||
| 1160 | Ga0495608_0420729 | |||
| 1161 | Ga0495618_0003117 | |||
| 1162 | Ga0495618_0012524 | |||
| 1163 | Ga0495618_0016557 | |||
| 1164 | Ga0495618_0033458 | |||
| 1165 | Ga0495618_0065681 | |||
| 1166 | Ga0495618_0279607 | |||
| 1167 | Ga0495628_0000047 | |||
| 1168 | Ga0495628_0000106 | |||
| 1169 | Ga0495628_0010271 | |||
| 1170 | Ga0495628_0051594 | |||
| 1171 | Ga0495628_0083200 | |||
| 1172 | Ga0495628_0206956 | |||
| 1173 | Ga0495628_0428949 | |||
| 1174 | Ga0495628_0647682 | |||
| 1175 | Ga0495630_0003384 | |||
| 1176 | Ga0495630_0019551 | |||
| 1177 | Ga0495630_0040697 | |||
| 1178 | Ga0495630_0111053 | |||
| 1179 | Ga0495630_0119196 | |||
| 1180 | Ga0495630_0248721 | |||
| 1181 | Ga0495644_0341821 | |||
| 1182 | Ga0495666_0002208 | |||
| 1183 | Ga0495666_0056909 | |||
| 1184 | Ga0495666_0466331 | |||
| 1185 | Ga0495652_0000291 | |||
| 1186 | Ga0495652_0012044 | |||
| 1187 | Ga0495652_0013837 | |||
| 1188 | Ga0495652_0029059 | |||
| 1189 | Ga0495652_0041811 | |||
| 1190 | Ga0495652_0086546 | |||
| 1191 | Ga0495652_0130577 | |||
| 1192 | Ga0495652_0571729 | |||
| 1193 | Ga0495665_0000679 | |||
| 1194 | Ga0495665_0014908 | |||
| 1195 | Ga0495665_0039831 | |||
| 1196 | Ga0495665_0132573 | |||
| 1197 | Ga0495640_0013511 | |||
| 1198 | Ga0495640_0018628 | |||
| 1199 | Ga0495640_0061462 | |||
| 1200 | Ga0495640_0096261 | |||
| 1201 | Ga0495640_0121671 | |||
| 1202 | Ga0495640_0158769 | |||
| 1203 | Ga0495586_0044616 | |||
| 1204 | Ga0495586_0073448 | |||
| 1205 | Ga0495587_0000119 | |||
| 1206 | Ga0495587_0000756 | |||
| 1207 | Ga0495587_0005073 | |||
| 1208 | Ga0495587_0007941 | |||
| 1209 | Ga0495587_0077122 | |||
| 1210 | Ga0495587_0142677 | |||
| 1211 | Ga0495587_0393103 | |||
| 1212 | Ga0495609_0286598 | |||
| 1213 | Ga0495645_0000302 | |||
| 1214 | Ga0495645_0049012 | |||
| 1215 | Ga0495645_0084491 | |||
| 1216 | Ga0495645_0172856 | |||
| 1217 | Ga0495645_0250424 | |||
| 1218 | Ga0495667_0000253 | |||
| 1219 | Ga0495667_0001257 | |||
| 1220 | Ga0495667_0014568 | |||
| 1221 | Ga0495667_0018800 | |||
| 1222 | Ga0495667_0020467 | |||
| 1223 | Ga0495667_0030474 | |||
| 1224 | Ga0495667_0044751 | |||
| 1225 | Ga0495667_0098728 | |||
| 1226 | Ga0495667_0210426 | |||
| 1227 | Ga0495634_0013381 | |||
| 1228 | Ga0495634_0015127 | |||
| 1229 | Ga0495634_0028660 | |||
| 1230 | Ga0495634_0030966 | |||
| 1231 | Ga0495634_0070280 | |||
| 1232 | Ga0495611_0303520 | |||
| 1233 | Ga0495635_0001972 | |||
| 1234 | Ga0495635_0002434 | |||
| 1235 | Ga0495635_0002435 | |||
| 1236 | Ga0495635_0009108 | |||
| 1237 | Ga0495635_0355529 | |||
| 1238 | Ga0495588_0087454 | |||
| 1239 | Ga0495657_0000067 | |||
| 1240 | Ga0495657_0003973 | |||
| 1241 | Ga0495657_0022269 | |||
| 1242 | Ga0495657_0053709 | |||
| 1243 | Ga0495657_0120503 | |||
| 1244 | Ga0495657_0171193 | |||
| 1245 | Ga0495657_0405778 | |||
| 1246 | Ga0495599_0000042 | |||
| 1247 | Ga0495599_0000063 | |||
| 1248 | Ga0495599_0015920 | |||
| 1249 | Ga0495599_0017126 | |||
| 1250 | Ga0495599_0158477 | |||
| 1251 | Ga0495599_0179996 | |||
| 1252 | Ga0495599_0342330 | |||
| 1253 | Ga0495623_0000132 | |||
| 1254 | Ga0495623_0000297 | |||
| 1255 | Ga0495623_0008953 | |||
| 1256 | Ga0495623_0068534 | |||
| 1257 | Ga0495623_0087595 | |||
| 1258 | Ga0495646_0000560 | |||
| 1259 | Ga0495646_0029968 | |||
| 1260 | Ga0495646_0044170 | |||
| 1261 | Ga0495646_0052913 | |||
| 1262 | Ga0495646_0148104 | |||
| 1263 | Ga0495646_0154827 | |||
| 1264 | Ga0495646_0679740 | |||
| 1265 | Ga0495647_0001966 | |||
| 1266 | Ga0495647_0004600 | |||
| 1267 | Ga0495647_0174521 | |||
| 1268 | Ga0495658_0000245 | |||
| 1269 | Ga0495658_0004873 | |||
| 1270 | Ga0495658_0067271 | |||
| 1271 | Ga0495658_0267989 | |||
| 1272 | Ga0495658_0409863 | |||
| 1273 | Ga0495613_0000910 | |||
| 1274 | Ga0495613_0004723 | |||
| 1275 | Ga0495613_0097115 | |||
| 1276 | Ga0495613_0168934 | |||
| 1277 | Ga0495613_0280214 | |||
| 1278 | Ga0495624_0000611 | |||
| 1279 | Ga0495624_0023199 | |||
| 1280 | Ga0495624_0054549 | |||
| 1281 | Ga0495624_0084026 | |||
| 1282 | Ga0495624_0222237 | |||
| 1283 | Ga0495600_0003453 | |||
| 1284 | Ga0495600_0006545 | |||
| 1285 | Ga0495600_0040759 | |||
| 1286 | Ga0495600_0136174 | |||
| 1287 | Ga0495581_0002120 | |||
| 1288 | Ga0495581_0011392 | |||
| 1289 | Ga0495581_0016472 | |||
| 1290 | Ga0495581_0025517 | |||
| 1291 | Ga0495604_0000004 | |||
| 1292 | Ga0495604_0000749 | |||
| 1293 | Ga0495604_0015660 | |||
| 1294 | Ga0495604_0044615 | |||
| 1295 | Ga0495604_0277873 | |||
| 1296 | Ga0495604_0636213 | |||
| 1297 | Ga0495674_0003020 | |||
| 1298 | Ga0495674_0017597 | |||
| 1299 | Ga0495674_0019473 | |||
| 1300 | Ga0495674_0051622 | |||
| 1301 | Ga0495674_0059909 | |||
| 1302 | Ga0495674_0074065 | |||
| 1303 | Ga0495674_0171418 | |||
| 1304 | Ga0495674_0612719 | |||
| 1305 | Ga0495674_0688323 | |||
| 1306 | Ga0495676_0005393 | |||
| 1307 | Ga0495676_0005787 | |||
| 1308 | Ga0495676_0008262 | |||
| 1309 | Ga0495680_0000054 | |||
| 1310 | Ga0495680_0001625 | |||
| 1311 | Ga0495680_0008750 | |||
| 1312 | Ga0495680_0012878 | |||
| 1313 | Ga0495680_0031079 | |||
| 1314 | Ga0495680_0036576 | |||
| 1315 | Ga0495680_0114444 | |||
| 1316 | Ga0495675_0000075 | |||
| 1317 | Ga0495675_0031359 | |||
| 1318 | Ga0495675_0066964 | |||
| 1319 | Ga0495677_0258488 | |||
| 1320 | Ga0495684_0001323 | |||
| 1321 | Ga0495684_0002467 | |||
| 1322 | Ga0495684_0004368 | |||
| 1323 | Ga0495684_0040159 | |||
| 1324 | Ga0495684_0063140 | |||
| 1325 | Ga0495684_0064877 | |||
| 1326 | Ga0495593_0006744 | |||
| 1327 | Ga0495593_0013851 | |||
| 1328 | Ga0495593_0020301 | |||
| 1329 | Ga0495593_0046619 | |||
| 1330 | Ga0495593_0208198 | |||
| 1331 | Ga0495602_0000083 | |||
| 1332 | Ga0495602_0000524 | |||
| 1333 | Ga0495602_0145081 | |||
| 1334 | Ga0495602_0363618 | |||
| 1335 | Ga0495602_0945225 | |||
| 1336 | Ga0495614_0000627 | |||
| 1337 | Ga0495614_0237653 | |||
| 1338 | Ga0496100_0168030 | |||
| 1339 | Ga0496100_0168448 | |||
| 1340 | Ga0496100_0486477 | |||
| 1341 | Ga0496100_1091687 | |||
| 1342 | Ga0496101_0010710 | |||
| 1343 | Ga0496101_0012577 | |||
| 1344 | Ga0496101_0021871 | |||
| 1345 | Ga0496101_0097771 | |||
| 1346 | Ga0496102_0030034 | |||
| 1347 | Ga0496102_0689362 | |||
| 1348 | Ga0496102_0842711 | |||
| 1349 | Ga0496102_0870599 | |||
| 1350 | Ga0496103_0808850 | |||
| 1351 | Ga0496104_0020586 | |||
| 1352 | Ga0496104_0084495 | |||
| 1353 | Ga0496104_0247106 | |||
| 1354 | Ga0496104_1145667 | |||
| 1355 | Ga0496105_0020375 | |||
| 1356 | Ga0496105_0082539 | |||
| 1357 | Ga0496105_0339667 | |||
| 1358 | Ga0496105_0525487 | |||
| 1359 | Ga0496106_0306971 | |||
| 1360 | Ga0496106_0432191 | |||
| 1361 | Ga0496106_0730396 | |||
| 1362 | Ga0496108_0007624 | |||
| 1363 | Ga0496108_0198479 | |||
| 1364 | Ga0496109_0073074 | |||
| 1365 | Ga0496109_0153915 | |||
| 1366 | Ga0496109_0173614 | |||
| 1367 | Ga0496110_0068794 | |||
| 1368 | Ga0496110_0755706 | |||
| 1369 | Ga0496110_0816958 | |||
| 1370 | Ga0496111_0016322 | |||
| 1371 | Ga0496111_0056360 | |||
| 1372 | Ga0496111_0579586 | |||
| 1373 | Ga0496111_0625687 | |||
| 1374 | Ga0496112_0048934 | |||
| 1375 | Ga0496112_0160495 | |||
| 1376 | Ga0496112_0267340 | |||
| 1377 | Ga0496112_0639566 | |||
| 1378 | Ga0496112_0646597 | |||
| 1379 | Ga0496112_1157994 | |||
| 1380 | Ga0496113_0034492 | |||
| 1381 | Ga0496113_0307538 | |||
| 1382 | Ga0496114_0006163 | |||
| 1383 | Ga0496114_0180763 | |||
| 1384 | Ga0496114_0187698 | |||
| 1385 | Ga0496114_0366979 | |||
| 1386 | Ga0496114_0648693 | |||
| 1387 | Ga0496114_0729899 | |||
| 1388 | Ga0496115_0016435 | |||
| 1389 | Ga0496115_0048963 | |||
| 1390 | Ga0496115_0128664 | |||
| 1391 | Ga0496115_0555020 | |||
| 1392 | Ga0496126_0869225 | |||
| 1393 | Ga0501031_0005545 | |||
| 1394 | Ga0501033_0102724 | |||
| 1395 | Ga0501033_0526520 | |||
| 1396 | Ga0501034_0100111 | |||
| 1397 | Ga0501036_0002610 | |||
| 1398 | Ga0501036_0127547 | |||
| 1399 | Ga0501036_0246494 | |||
| 1400 | Ga0501038_0112614 | |||
| 1401 | Ga0501038_0182507 | |||
| 1402 | Ga0501038_0969250 | |||
| 1403 | Ga0501039_0022722 | |||
| 1404 | Ga0501039_0086997 | |||
| 1405 | Ga0501040_0027834 | |||
| 1406 | Ga0501041_0011618 | |||
| 1407 | Ga0501041_0232713 | |||
| 1408 | Ga0501042_0046084 | |||
| 1409 | Ga0501042_0073561 | |||
| 1410 | Ga0501043_0024389 | |||
| 1411 | Ga0501046_0081015 | |||
| 1412 | Ga0501046_0173524 | |||
| 1413 | Ga0501048_0012534 | |||
| 1414 | Ga0501048_0289318 | |||
| 1415 | Ga0501067_0041700 | |||
| 1416 | Ga0501067_0044444 | |||
| 1417 | Ga0501068_0131794 | |||
| 1418 | Ga0501069_0079764 | |||
| 1419 | Ga0501070_0048483 | |||
| 1420 | Ga0501070_0076925 | |||
| 1421 | Ga0501070_0179339 | |||
| 1422 | Ga0501070_0794439 | |||
| 1423 | Ga0501071_0027044 | |||
| 1424 | Ga0501072_0035928 | |||
| 1425 | Ga0501072_0132572 | |||
| 1426 | Ga0501072_0375294 | |||
| 1427 | Ga0501073_0132128 | |||
| 1428 | Ga0501073_0407267 | |||
| 1429 | Ga0501074_0008925 | |||
| 1430 | Ga0501074_0084497 | |||
| 1431 | Ga0501074_0203431 | |||
| 1432 | Ga0501075_0013273 | |||
| 1433 | Ga0501075_0697488 | |||
| 1434 | Ga0501076_0019824 | |||
| 1435 | Ga0501076_0118346 | |||
| 1436 | Ga0501077_0013254 | |||
| 1437 | Ga0501077_0024737 | |||
| 1438 | Ga0501079_0008733 | |||
| 1439 | Ga0501079_0017873 | |||
| 1440 | Ga0501080_0011560 | |||
| 1441 | Ga0501080_0188607 | |||
| 1442 | Ga0501080_0486739 | |||
| 1443 | Ga0501080_0637596 | |||
| 1444 | Ga0501081_0010332 | |||
| 1445 | Ga0501081_0051741 | |||
| 1446 | Ga0501081_0204610 | |||
| 1447 | Ga0501083_0002073 | |||
| 1448 | Ga0501083_0145013 | |||
| 1449 | Ga0501035_0118682 | |||
| 1450 | Ga0501035_0276210 | |||
| 1451 | Ga0501044_0092185 | |||
| 1452 | Ga0501044_0498229 | |||
| 1453 | Ga0501045_0020852 | |||
| 1454 | Ga0501045_0354847 | |||
| 1455 | nmdc:mga05p37_4173_c1 | |||
| 1456 | nmdc:mga08y16_307245_c1 | |||
| 1457 | nmdc:mga08y16_46468_c1 | |||
| 1458 | nmdc:mga0n895_135749_c1 | |||
| 1459 | nmdc:mga0n895_262827_c1 | |||
| 1460 | nmdc:mga0n895_317217_c1 | |||
| 1461 | nmdc:mga0rr50_135995_c1 | |||
| 1462 | nmdc:mga0rr50_525404_c1 | |||
| 1463 | nmdc:mga08x19_349782_c1 | |||
| 1464 | nmdc:mga08x19_722228_c1 | |||
| 1465 | nmdc:mga0a205_131851_c1 | |||
| 1466 | nmdc:mga0a205_35031_c1 | |||
| 1467 | nmdc:mga0a205_507675_c1 | |||
| 1468 | nmdc:mga0a205_540401_c1 | |||
| 1469 | nmdc:mga0a205_589259_c1 | |||
| 1470 | Ga0495601_0001003 | |||
| 1471 | Ga0495601_0100744 | |||
| 1472 | Ga0495601_0312007 | |||
| 1473 | Ga0495612_0003375 | |||
| 1474 | Ga0495612_0053481 | |||
| 1475 | Ga0495612_0101886 | |||
| 1476 | Ga0495612_0132155 | |||
| 1477 | Ga0495612_0304652 | |||
| 1478 | Ga0495612_0541929 | |||
| 1479 | Ga0495595_0010809 | |||
| 1480 | Ga0495595_0140268 | |||
| 1481 | Ga0495595_0299016 | |||
| 1482 | Ga0495619_0000648 | |||
| 1483 | Ga0495619_0002217 | |||
| 1484 | Ga0495619_0005526 | |||
| 1485 | Ga0495619_0030751 | |||
| 1486 | Ga0495619_0067818 | |||
| 1487 | Ga0495619_0156100 | |||
| 1488 | Ga0495619_0172616 | |||
| 1489 | Ga0495619_0358339 | |||
| 1490 | Ga0495619_0377177 | |||
| 1491 | Ga0501084_0041451 | |||
| 1492 | Ga0501084_0044995 | |||
| 1493 | Ga0501084_0171729 | |||
| 1494 | Ga0501084_0180481 | |||
| 1495 | Ga0590077_032440 | |||
| 1496 | Ga0501082_0091494 | |||
| 1497 | Ga0501082_0344756 | |||
| 1498 | Ga0501082_0399822 | |||
| 1499 | Ga0466962_0042247 | |||
| 1500 | Ga0466962_0334518 | |||
| 1501 | Ga0530510_0006433 | |||
| 1502 | Ga0530510_0008590 | |||
| 1503 | Ga0530510_0664043 | |||
| 1504 | Ga0530510_0918408 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nsl-assembly1.cif.gz_F | crystal structure of probable acetyltransferase | 0.7788 | 14 | 143 |
| 3juw-assembly2.cif.gz_C-2 | putative gnat-family acetyltransferase from bordetella pertussis. | 0.7562 | 12 | 135 |
| 3igr-assembly1.cif.gz_A | the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a | 0.7503 | 12 | 134 |
| 1nsl-assembly1.cif.gz_D | crystal structure of probable acetyltransferase | 0.7445 | 14 | 143 |
| 1nsl-assembly1.cif.gz_E | crystal structure of probable acetyltransferase | 0.7437 | 14 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54L65_11_183_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7782 | 15 | 143 | 3.40.630.30 |
| 3exnA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7632 | 19 | 135 | 3.40.630.30 |
| af_Q54VL6_2_179_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7602 | 14 | 134 | 3.40.630.30 |
| af_Q2G132_3_176_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7593 | 14 | 137 | 3.40.630.30 |
| af_O05841_12_169_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7492 | 17 | 143 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538EHY1-F1-model_v4 | N-acetyltransferase | 0.9905 | 3 | 149 |
GO:0016740
|
| AF-A0A7Y5U714-F1-model_v4 | N-acetyltransferase | 0.9897 | 1 | 149 |
GO:0016740
|
| AF-A0A5M3W926-F1-model_v4 | SnoaL-like domain-containing protein | 0.9887 | 2 | 150 |
|
| AF-A0A3D8RV21-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9876 | 3 | 148 |
|
| AF-A0A2W6DQD5-F1-model_v4 | Twin-arginine translocation pathway signal protein | 0.984 | 3 | 150 |
|