F479170

General Info

Members Datasets Scaffolds Average Seq Length
752 279 1504 154

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0458282|Ga0436364_0458282_890_1426
Length 178
Sequence MSDQLFIPVDFAVPGGLAAGEFQLEPLGPQHNAADYAAWTASIGHIRATPGFTGASWPHQMSLAENLRDLERHAQDFAGRRGFTYTVLSTSTGEVIGCVYIYPLRGGKPGHTSGGGQHAAVRSWVRADHAALDPVLYHAVRAWLERDWPFRSIEYAPRPLPDTACGAALSPPRLGIPG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.98
Rhizosphere 90.03
Stem 0
Stem Tuber 0
Unclassified 18.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0458282 3300037853 Bacteria 2730
2 Ga0070658_10029449 3300005327 Bacteria 4410
3 Ga0070683_100008344 3300005329 Bacteria 8798
4 Ga0070683_100669714 3300005329 Unclassified 994
5 Ga0070680_100092427 3300005336 Bacteria 2505
6 Ga0070680_100180989 3300005336 Bacteria 1775
7 Ga0070680_100197355 3300005336 Bacteria 1696
8 Ga0070680_100432210 3300005336 Bacteria 1124
9 Ga0068868_100558505 3300005338 Bacteria 1010
10 Ga0070660_100008122 3300005339 Bacteria 7335
11 Ga0070661_100025917 3300005344 Bacteria 4214
12 Ga0070674_100733305 3300005356 Bacteria 848
13 Ga0070688_101383295 3300005365 Bacteria 570
14 Ga0070659_100156890 3300005366 Bacteria 1859
15 Ga0070659_100587949 3300005366 Bacteria 956
16 Ga0070659_100958223 3300005366 Bacteria 750
17 Ga0070709_10910372 3300005434 Unclassified 696
18 Ga0070713_100017211 3300005436 Bacteria 5461
19 Ga0070713_100635507 3300005436 Bacteria 1016
20 Ga0070710_10122823 3300005437 Bacteria 1574
21 Ga0070710_10136858 3300005437 Bacteria 1498
22 Ga0070710_10385815 3300005437 Unclassified 935
23 Ga0070711_100019629 3300005439 Bacteria 4340
24 Ga0070711_100027531 3300005439 Bacteria 3733
25 Ga0070711_100192452 3300005439 Bacteria 1569
26 Ga0070711_100519762 3300005439 Unclassified 984
27 Ga0070705_100367770 3300005440 Unclassified 1054
28 Ga0070700_100752237 3300005441 Bacteria 780
29 Ga0070708_100358408 3300005445 Bacteria 1374
30 Ga0070678_100790694 3300005456 Bacteria 861
31 Ga0070681_10021809 3300005458 Bacteria 6423
32 Ga0070681_10102947 3300005458 Bacteria 2800
33 Ga0070681_10132409 3300005458 Bacteria 2425
34 Ga0070681_10239167 3300005458 Bacteria 1729
35 Ga0070681_10791058 3300005458 Bacteria 865
36 Ga0068867_100531156 3300005459 Bacteria 1016
37 Ga0070706_100036315 3300005467 Unclassified 4551
38 Ga0070706_100365423 3300005467 Unclassified 1344
39 Ga0070707_100088122 3300005468 Bacteria 3002
40 Ga0070707_100181252 3300005468 Bacteria 2053
41 Ga0070707_100738711 3300005468 Unclassified 947
42 Ga0070707_100958329 3300005468 Unclassified 821
43 Ga0070698_100122382 3300005471 Bacteria 2560
44 Ga0070699_100010266 3300005518 Bacteria 8099
45 Ga0070699_100032770 3300005518 Bacteria 4487
46 Ga0070699_100598040 3300005518 Bacteria 1006
47 Ga0070679_100067576 3300005530 Bacteria 3564
48 Ga0070679_100072003 3300005530 Bacteria 3448
49 Ga0070679_100248215 3300005530 Bacteria 1736
50 Ga0070684_100028374 3300005535 Bacteria 4735
51 Ga0070684_100149217 3300005535 Bacteria 2117
52 Ga0070684_101212842 3300005535 Unclassified 710
53 Ga0070697_100005179 3300005536 Bacteria 10018
54 Ga0070697_100005436 3300005536 Bacteria 9820
55 Ga0068853_100314262 3300005539 Bacteria 1451
56 Ga0068853_100494058 3300005539 Bacteria 1155
57 Ga0070695_100118462 3300005545 Bacteria 1808
58 Ga0070665_100444434 3300005548 Unclassified 1306
59 Ga0068857_100056585 3300005577 Bacteria 3481
60 Ga0068857_100352627 3300005577 Bacteria 1363
61 Ga0068854_100517225 3300005578 Unclassified 1007
62 Ga0068856_100143144 3300005614 Bacteria 2398
63 Ga0068856_100320612 3300005614 Bacteria 1567
64 Ga0068856_100329602 3300005614 Bacteria 1544
65 Ga0081455_10081162 3300005937 Bacteria 2657
66 Ga0081455_10475021 3300005937 Bacteria 847
67 Ga0081540_1205524 3300005983 Bacteria 712
68 Ga0070717_10169286 3300006028 Bacteria 1899
69 Ga0070717_10211171 3300006028 Bacteria 1703
70 Ga0070717_10285468 3300006028 Bacteria 1465
71 Ga0070717_10596693 3300006028 Bacteria 1002
72 Ga0070717_10621181 3300006028 Bacteria 980
73 Ga0070717_11460413 3300006028 Bacteria 621
74 Ga0075432_10048467 3300006058 Bacteria 1495
75 Ga0070715_10029745 3300006163 Bacteria 2202
76 Ga0070715_10353491 3300006163 Unclassified 803
77 Ga0070715_10451581 3300006163 Bacteria 726
78 Ga0070716_100095427 3300006173 Bacteria 1810
79 Ga0070712_100003758 3300006175 Bacteria 9352
80 Ga0070712_100023530 3300006175 Bacteria 4071
81 Ga0070712_100106718 3300006175 Bacteria 2082
82 Ga0070712_100457759 3300006175 Unclassified 1063
83 Ga0075433_10019520 3300006852 Bacteria 5650
84 Ga0075433_10136034 3300006852 Bacteria 2184
85 Ga0075433_10333055 3300006852 Unclassified 1342
86 Ga0075434_100352207 3300006871 Bacteria 1493
87 Ga0075436_100029394 3300006914 Bacteria 3779
88 Ga0075435_100226938 3300007076 Bacteria 1586
89 Ga0075435_100716449 3300007076 Bacteria 870
90 Ga0075435_101401567 3300007076 Unclassified 612
91 Ga0105240_10264969 3300009093 Bacteria 1981
92 Ga0105240_10303951 3300009093 Bacteria 1824
93 Ga0105240_10771158 3300009093 Unclassified 1044
94 Ga0105240_10812314 3300009093 Bacteria 1012
95 Ga0111539_10087422 3300009094 Bacteria 3662
96 Ga0111539_10128424 3300009094 Unclassified 2969
97 Ga0111539_10234832 3300009094 Bacteria 2135
98 Ga0105245_10041686 3300009098 Bacteria 4092
99 Ga0105245_10843995 3300009098 Bacteria 956
100 Ga0105245_10995498 3300009098 Bacteria 882
101 Ga0105245_11425718 3300009098 Bacteria 743
102 Ga0105247_10788889 3300009101 Unclassified 724
103 Ga0105243_10588698 3300009148 Bacteria 1069
104 Ga0105243_10918056 3300009148 Bacteria 872
105 Ga0105241_10943706 3300009174 Unclassified 804
106 Ga0105241_11339433 3300009174 Bacteria 683
107 Ga0105242_10680159 3300009176 Bacteria 1004
108 Ga0105237_10173645 3300009545 Bacteria 2155
109 Ga0105237_10336253 3300009545 Bacteria 1514
110 Ga0105237_10540100 3300009545 Bacteria 1172
111 Ga0105249_10368669 3300009553 Unclassified 1459
112 Ga0105249_11800236 3300009553 Bacteria 685
113 Ga0105239_10357555 3300010375 Bacteria 1649
114 Ga0105239_10514669 3300010375 Bacteria 1361
115 Ga0105246_10526344 3300011119 Bacteria 1009
116 Ga0157338_1078832 3300012515 Bacteria 529
117 Ga0157373_10055526 3300013100 Bacteria 2813
118 Ga0157370_10004652 3300013104 Bacteria 15680
119 Ga0157370_10474537 3300013104 Bacteria 1150
120 Ga0157370_12005301 3300013104 Unclassified 519
121 Ga0157369_10874590 3300013105 Bacteria 922
122 Ga0157369_10985058 3300013105 Unclassified 863
123 Ga0157374_11189823 3300013296 Unclassified 783
124 Ga0163162_11236513 3300013306 Bacteria 848
125 Ga0157372_10171621 3300013307 Bacteria 2509
126 Ga0157372_10562325 3300013307 Bacteria 1329
127 Ga0157375_12338806 3300013308 Bacteria 637
128 Ga0163163_10172619 3300014325 Unclassified 2209
129 Ga0163163_10271834 3300014325 Unclassified 1746
130 Ga0163163_10555380 3300014325 Unclassified 1211
131 Ga0163163_10910127 3300014325 Unclassified 943
132 Ga0157380_10469996 3300014326 Bacteria 1213
133 Ga0182008_10002385 3300014497 Bacteria 11806
134 Ga0157377_10138807 3300014745 Bacteria 1492
135 Ga0157376_10762826 3300014969 Bacteria 977
136 Ga0157376_12091758 3300014969 Unclassified 604
137 Ga0182006_1085570 3300015261 Bacteria 1143
138 Ga0163161_10748039 3300017792 Unclassified 818
139 Ga0197907_11002288 3300020069 Unclassified 548
140 Ga0206356_11160239 3300020070 Unclassified 721
141 Ga0206354_11222688 3300020081 Bacteria 3599
142 Ga0206353_10181333 3300020082 Bacteria 11098
143 Ga0206353_12023555 3300020082 Bacteria 904
144 Ga0213875_10155949 3300021388 Bacteria 1071
145 Ga0207692_10005869 3300025898 Bacteria 4950
146 Ga0207692_10033859 3300025898 Bacteria 2469
147 Ga0207692_10073206 3300025898 Bacteria 1812
148 Ga0207685_10005475 3300025905 Bacteria 3357
149 Ga0207685_10481195 3300025905 Bacteria 650
150 Ga0207705_10063949 3300025909 Bacteria 2659
151 Ga0207684_10018469 3300025910 Bacteria 5971
152 Ga0207684_10036456 3300025910 Unclassified 4174
153 Ga0207684_10144524 3300025910 Unclassified 2046
154 Ga0207707_10081694 3300025912 Bacteria 2821
155 Ga0207707_10184886 3300025912 Bacteria 1819
156 Ga0207695_10375453 3300025913 Bacteria 1308
157 Ga0207671_10025969 3300025914 Bacteria 4394
158 Ga0207671_10104596 3300025914 Bacteria 2147
159 Ga0207693_10002613 3300025915 Bacteria 15647
160 Ga0207693_10013042 3300025915 Bacteria 6706
161 Ga0207693_10018376 3300025915 Bacteria 5568
162 Ga0207693_10130761 3300025915 Bacteria 1973
163 Ga0207693_10200459 3300025915 Bacteria 1569
164 Ga0207663_10008287 3300025916 Bacteria 5427
165 Ga0207663_10109403 3300025916 Bacteria 1873
166 Ga0207663_10331634 3300025916 Unclassified 1146
167 Ga0207663_10385033 3300025916 Bacteria 1069
168 Ga0207663_10397157 3300025916 Bacteria 1054
169 Ga0207663_10414933 3300025916 Unclassified 1032
170 Ga0207660_10075917 3300025917 Bacteria 2456
171 Ga0207657_10000964 3300025919 Bacteria 30488
172 Ga0207649_10032593 3300025920 Bacteria 3108
173 Ga0207646_10007631 3300025922 Bacteria 10951
174 Ga0207646_10047283 3300025922 Unclassified 3858
175 Ga0207681_11231161 3300025923 Unclassified 629
176 Ga0207700_10039434 3300025928 Bacteria 3439
177 Ga0207700_10471696 3300025928 Bacteria 1108
178 Ga0207664_11311797 3300025929 Bacteria 643
179 Ga0207664_11395023 3300025929 Bacteria 621
180 Ga0207690_10276888 3300025932 Bacteria 1306
181 Ga0207665_10699407 3300025939 Bacteria 797
182 Ga0207691_10553542 3300025940 Bacteria 975
183 Ga0207661_10139208 3300025944 Bacteria 2087
184 Ga0207661_10360673 3300025944 Unclassified 1313
185 Ga0207661_10564533 3300025944 Unclassified 1043
186 Ga0207667_10116255 3300025949 Bacteria 2756
187 Ga0207712_10337729 3300025961 Unclassified 1248
188 Ga0207668_11648477 3300025972 Bacteria 579
189 Ga0207702_10072302 3300026078 Bacteria 2972
190 Ga0207702_10247817 3300026078 Unclassified 1672
191 Ga0207648_10128270 3300026089 Bacteria 2232
192 Ga0207674_10070623 3300026116 Bacteria 3511
193 Ga0207674_10381071 3300026116 Bacteria 1363
194 Ga0207683_11087410 3300026121 Unclassified 742
195 Ga0207428_10283271 3300027907 Bacteria 1230
196 Ga0268266_10634242 3300028379 Bacteria 1028
197 Ga0268265_10931211 3300028380 Unclassified 855
198 Ga0265760_10257865 3300031090 Unclassified 606
199 Ga0265340_10116097 3300031247 Bacteria 1234
200 Ga0265314_10336595 3300031711 Unclassified 835
201 Ga0307405_10482313 3300031731 Bacteria 990
202 Ga0307410_11098914 3300031852 Bacteria 689
203 Ga0307409_100816850 3300031995 Bacteria 941
204 Ga0307415_100363188 3300032126 Bacteria 1223
205 Ga0373926_0001987 3300035083 Bacteria 6411
206 Ga0373926_0004338 3300035083 Bacteria 4649
207 Ga0373926_0079196 3300035083 Bacteria 1213
208 Ga0373934_0000196 3300035086 Bacteria 22202
209 Ga0373934_0065260 3300035086 Unclassified 1453
210 Ga0373944_0001293 3300035089 Bacteria 6296
211 Ga0373944_0001729 3300035089 Bacteria 5521
212 Ga0373944_0062118 3300035089 Unclassified 1200
213 Ga0373952_0019633 3300035092 Unclassified 1410
214 Ga0373923_0000096 3300035111 Bacteria 15433
215 Ga0373923_0006540 3300035111 Bacteria 4037
216 Ga0373923_0349978 3300035111 Bacteria 705
217 Ga0373936_0002062 3300035113 Bacteria 7452
218 Ga0373936_0012555 3300035113 Plasmid 3225
219 Ga0373936_0025147 3300035113 Bacteria 2327
220 Ga0373945_0000006 3300035116 Bacteria 50221
221 Ga0373945_0000033 3300035116 Bacteria 28437
222 Ga0373945_0018772 3300035116 Unclassified 2355
223 Ga0373953_0000133 3300035117 Bacteria 18374
224 Ga0373953_0002866 3300035117 Bacteria 5259
225 Ga0373953_0163199 3300035117 Unclassified 958
226 Ga0373954_0101660 3300035118 Unclassified 1387
227 Ga0373954_0102957 3300035118 Unclassified 1378
228 Ga0373954_0299449 3300035118 Bacteria 793
229 Ga0373956_0000537 3300035119 Bacteria 15481
230 Ga0373956_0128730 3300035119 Unclassified 1184
231 Ga0373956_0325362 3300035119 Bacteria 733
232 Ga0373956_0485319 3300035119 Bacteria 590
233 Ga0373957_0000815 3300035120 Bacteria 8131
234 Ga0373957_0004464 3300035120 Unclassified 4258
235 Ga0373957_0004731 3300035120 Bacteria 4165
236 Ga0373957_0171296 3300035120 Unclassified 897
237 Ga0373957_0295655 3300035120 Unclassified 686
238 Ga0373960_0380549 3300035121 Unclassified 541
239 Ga0373943_0000904 3300035170 Bacteria 13096
240 Ga0373943_0001521 3300035170 Bacteria 10494
241 Ga0373946_0000392 3300035171 Bacteria 14223
242 Ga0373946_0011653 3300035171 Bacteria 3286
243 Ga0373946_0027954 3300035171 Unclassified 2234
244 Ga0373955_0000130 3300035172 Bacteria 29820
245 Ga0373955_0004056 3300035172 Bacteria 6459
246 Ga0373955_0011112 3300035172 Bacteria 4278
247 Ga0373955_0131131 3300035172 Bacteria 1463
248 Ga0373955_0303463 3300035172 Unclassified 963
249 Ga0373955_0324325 3300035172 Bacteria 931
250 Ga0373955_0576059 3300035172 Bacteria 689
251 Ga0373961_0046200 3300035241 Unclassified 1276
252 Ga0373924_0000286 3300035410 Bacteria 15517
253 Ga0373924_0015210 3300035410 Bacteria 2921
254 Ga0373924_0017008 3300035410 Bacteria 2784
255 Ga0373931_0030251 3300035691 Unclassified 2787
256 Ga0373935_0001107 3300035692 Bacteria 14691
257 Ga0373935_0057923 3300035692 Bacteria 2473
258 Ga0373935_0128664 3300035692 Bacteria 1699
259 Ga0373935_0295548 3300035692 Unclassified 1143
260 Ga0373935_0369421 3300035692 Bacteria 1026
261 Ga0373935_0492407 3300035692 Bacteria 889
262 Ga0373927_0003915 3300035695 Bacteria 10552
263 Ga0373927_0007610 3300035695 Bacteria 7336
264 Ga0373927_0136070 3300035695 Bacteria 1606
265 Ga0373933_0000121 3300035724 Bacteria 50773
266 Ga0373933_0012868 3300035724 Bacteria 4627
267 Ga0373933_0026106 3300035724 Bacteria 3352
268 Ga0373933_0102060 3300035724 Bacteria 1780
269 Ga0373933_0465492 3300035724 Bacteria 827
270 Ga0373947_0000939 3300035725 Bacteria 17729
271 Ga0373947_0002845 3300035725 Bacteria 10326
272 Ga0373947_0009756 3300035725 Bacteria 5510
273 Ga0373947_0023843 3300035725 Bacteria 3562
274 Ga0373937_0000190 3300036401 Bacteria 60066
275 Ga0373937_0000671 3300036401 Bacteria 29787
276 Ga0373937_0028381 3300036401 Bacteria 5063
277 Ga0373937_0028865 3300036401 Bacteria 5023
278 Ga0373937_0054575 3300036401 Bacteria 3667
279 Ga0373937_0076091 3300036401 Bacteria 3100
280 Ga0373937_0104611 3300036401 Bacteria 2630
281 Ga0373925_0007222 3300037068 Bacteria 8122
282 Ga0373925_0024347 3300037068 Bacteria 4420
283 Ga0373925_0026296 3300037068 Unclassified 4258
284 Ga0373925_0264191 3300037068 Bacteria 1383
285 Ga0373925_0505362 3300037068 Unclassified 992
286 Ga0373925_1520603 3300037068 Bacteria 548
287 Ga0395900_0013258 3300037418 Bacteria 8424
288 Ga0395900_0421033 3300037418 Bacteria 1296
289 Ga0395898_0037444 3300037466 Bacteria 4812
290 Ga0395898_0197852 3300037466 Bacteria 1920
291 Ga0395898_0563540 3300037466 Bacteria 1081
292 Ga0395905_0082224 3300037471 Bacteria 3018
293 Ga0395905_0169589 3300037471 Bacteria 2050
294 Ga0395905_0494174 3300037471 Bacteria 1123
295 Ga0436364_0365242 3300037853 Bacteria 1402
296 Ga0395901_0022032 3300038443 Bacteria 6530
297 Ga0395901_0312714 3300038443 Unclassified 1626
298 Ga0395901_0600939 3300038443 Bacteria 1109
299 Ga0436365_0248728 3300039437 Bacteria 652
300 Ga0436365_1501831 3300039437 Bacteria 3607
301 Ga0436363_1541417 3300039450 Unclassified 713
302 Ga0436362_0236721 3300039453 Bacteria 1268
303 Ga0451789_1217424 3300041443 Bacteria 1006
304 Ga0451793_0887223 3300041452 Unclassified 2207
305 Ga0451795_1713235 3300041456 Bacteria 931
306 Ga0451800_0960620 3300041459 Bacteria 1496
307 Ga0451802_1623103 3300041460 Bacteria 749
308 Ga0451807_1979534 3300041486 Unclassified 856
309 Ga0451833_0893515 3300041491 Bacteria 1415
310 Ga0451835_0620315 3300041492 Unclassified 2076
311 Ga0451839_0751977 3300041496 Unclassified 3292
312 Ga0451841_0626723 3300041498 Unclassified 707
313 Ga0451849_0672841 3300041505 Unclassified 756
314 Ga0451855_1565654 3300041511 Bacteria 1178
315 Ga0451853_2337302 3300041512 Unclassified 892
316 Ga0451853_2571487 3300041512 Bacteria 1613
317 Ga0439448_0141379 3300042005 Bacteria 833
318 Ga0439450_216691 3300042008 Bacteria 515
319 Ga0439458_0132298 3300042157 Unclassified 661
320 Ga0439460_0343140 3300042461 Bacteria 526
321 Ga0450918_023532 3300042531 Bacteria 1077
322 Ga0439440_0197245 3300042993 Unclassified 596
323 Ga0466963_0002216 3300044694 Bacteria 10754
324 Ga0466963_0035889 3300044694 Bacteria 3230
325 Ga0466963_0147959 3300044694 Bacteria 1630
326 Ga0466963_0964451 3300044694 Bacteria 600
327 Ga0466964_0086650 3300044706 Bacteria 1355
328 Ga0466964_0214464 3300044706 Unclassified 932
329 Ga0466964_0610132 3300044706 Bacteria 599
330 Ga0466957_0132348 3300044842 Bacteria 1599
331 Ga0466957_0160110 3300044842 Bacteria 1461
332 Ga0466957_0165010 3300044842 Bacteria 1440
333 Ga0466960_0014177 3300044901 Bacteria 3405
334 Ga0466958_0002307 3300045836 Bacteria 9518
335 Ga0466958_0012372 3300045836 Bacteria 4833
336 Ga0466967_0011663 3300045976 Bacteria 6675
337 Ga0466967_0040251 3300045976 Unclassified 4023
338 Ga0466967_0069312 3300045976 Bacteria 3151
339 Ga0466967_0092643 3300045976 Bacteria 2748
340 Ga0466967_0388563 3300045976 Unclassified 1356
341 Ga0466967_1056651 3300045976 Unclassified 809
342 Ga0466967_1406448 3300045976 Bacteria 695
343 Ga0495592_0000070 3300046454 Bacteria 93255
344 Ga0495592_0000206 3300046454 Bacteria 50513
345 Ga0495592_0010136 3300046454 Bacteria 7101
346 Ga0495592_0082463 3300046454 Bacteria 2323
347 Ga0495592_0204622 3300046454 Bacteria 1330
348 Ga0495592_0244502 3300046454 Unclassified 1189
349 Ga0495592_0286546 3300046454 Bacteria 1075
350 Ga0495592_0464374 3300046454 Bacteria 791
351 Ga0495603_0000794 3300046455 Bacteria 18046
352 Ga0495603_0106896 3300046455 Bacteria 1633
353 Ga0495603_0197816 3300046455 Bacteria 1162
354 Ga0495629_0001447 3300046459 Bacteria 18720
355 Ga0495629_0001647 3300046459 Bacteria 17529
356 Ga0495629_0016488 3300046459 Bacteria 5303
357 Ga0495629_0113227 3300046459 Bacteria 1891
358 Ga0495629_0134220 3300046459 Bacteria 1724
359 Ga0495641_0003897 3300046461 Bacteria 10853
360 Ga0495641_0010886 3300046461 Bacteria 5228
361 Ga0495641_0013567 3300046461 Bacteria 4465
362 Ga0495641_0191307 3300046461 Unclassified 917
363 Ga0495651_0000042 3300046462 Bacteria 93255
364 Ga0495651_0000053 3300046462 Bacteria 85191
365 Ga0495651_0024629 3300046462 Bacteria 4681
366 Ga0495651_0040155 3300046462 Unclassified 3640
367 Ga0495651_0339397 3300046462 Bacteria 996
368 Ga0495651_0645968 3300046462 Unclassified 664
369 Ga0495653_0003163 3300046463 Bacteria 13185
370 Ga0495653_0003512 3300046463 Bacteria 12622
371 Ga0495653_0010133 3300046463 Bacteria 7712
372 Ga0495653_0018523 3300046463 Bacteria 5652
373 Ga0495653_0022163 3300046463 Bacteria 5141
374 Ga0495653_0023865 3300046463 Bacteria 4937
375 Ga0495653_0056868 3300046463 Plasmid 2980
376 Ga0495653_0077023 3300046463 Bacteria 2477
377 Ga0495580_0000893 3300046472 Bacteria 25945
378 Ga0495580_0740926 3300046472 Unclassified 641
379 Ga0495582_0000092 3300046473 Bacteria 46401
380 Ga0495582_0004863 3300046473 Bacteria 7534
381 Ga0495582_0011651 3300046473 Bacteria 4846
382 Ga0495582_0050101 3300046473 Bacteria 2301
383 Ga0495582_0120459 3300046473 Bacteria 1478
384 Ga0495582_0154304 3300046473 Bacteria 1304
385 Ga0495639_0000142 3300046475 Bacteria 37138
386 Ga0495639_0005945 3300046475 Bacteria 5249
387 Ga0495639_0048546 3300046475 Bacteria 1925
388 Ga0495662_0001812 3300046476 Bacteria 10697
389 Ga0495662_0007338 3300046476 Bacteria 5451
390 Ga0495662_0057614 3300046476 Bacteria 1876
391 Ga0495662_0090101 3300046476 Unclassified 1495
392 Ga0495662_0107892 3300046476 Bacteria 1363
393 Ga0495662_0209831 3300046476 Unclassified 960
394 Ga0495664_0004862 3300046477 Bacteria 7348
395 Ga0495664_0014410 3300046477 Bacteria 4482
396 Ga0495664_0018021 3300046477 Bacteria 4038
397 Ga0495594_0011460 3300046499 Bacteria 4609
398 Ga0495594_0021566 3300046499 Unclassified 3438
399 Ga0495608_0000054 3300046511 Bacteria 93255
400 Ga0495608_0002448 3300046511 Bacteria 13326
401 Ga0495608_0012588 3300046511 Bacteria 5867
402 Ga0495608_0020652 3300046511 Bacteria 4524
403 Ga0495608_0062840 3300046511 Bacteria 2438
404 Ga0495608_0149825 3300046511 Bacteria 1487
405 Ga0495608_0282082 3300046511 Unclassified 1031
406 Ga0495608_0291649 3300046511 Unclassified 1011
407 Ga0495608_0322350 3300046511 Bacteria 954
408 Ga0495608_0420729 3300046511 Unclassified 815
409 Ga0495618_0003117 3300046514 Bacteria 10442
410 Ga0495618_0012524 3300046514 Bacteria 5153
411 Ga0495618_0016557 3300046514 Bacteria 4512
412 Ga0495618_0033458 3300046514 Bacteria 3223
413 Ga0495618_0065681 3300046514 Bacteria 2306
414 Ga0495618_0279607 3300046514 Bacteria 1041
415 Ga0495628_0000047 3300046516 Bacteria 97852
416 Ga0495628_0000106 3300046516 Bacteria 67965
417 Ga0495628_0010271 3300046516 Bacteria 7960
418 Ga0495628_0051594 3300046516 Bacteria 3252
419 Ga0495628_0083200 3300046516 Bacteria 2485
420 Ga0495628_0206956 3300046516 Bacteria 1477
421 Ga0495628_0428949 3300046516 Bacteria 962
422 Ga0495628_0647682 3300046516 Unclassified 750
423 Ga0495630_0003384 3300046517 Bacteria 11110
424 Ga0495630_0019551 3300046517 Bacteria 4980
425 Ga0495630_0040697 3300046517 Bacteria 3473
426 Ga0495630_0111053 3300046517 Bacteria 2076
427 Ga0495630_0119196 3300046517 Bacteria 2002
428 Ga0495630_0248721 3300046517 Bacteria 1358
429 Ga0495644_0341821 3300046523 Unclassified 589
430 Ga0495666_0002208 3300046526 Bacteria 9701
431 Ga0495666_0056909 3300046526 Bacteria 1872
432 Ga0495666_0466331 3300046526 Unclassified 565
433 Ga0495652_0000291 3300046529 Bacteria 59608
434 Ga0495652_0012044 3300046529 Bacteria 7813
435 Ga0495652_0013837 3300046529 Bacteria 7257
436 Ga0495652_0029059 3300046529 Bacteria 4857
437 Ga0495652_0041811 3300046529 Bacteria 3954
438 Ga0495652_0086546 3300046529 Plasmid 2572
439 Ga0495652_0130577 3300046529 Bacteria 1989
440 Ga0495652_0571729 3300046529 Unclassified 774
441 Ga0495665_0000679 3300046531 Bacteria 17435
442 Ga0495665_0014908 3300046531 Bacteria 4185
443 Ga0495665_0039831 3300046531 Bacteria 2502
444 Ga0495665_0132573 3300046531 Bacteria 1304
445 Ga0495640_0013511 3300046533 Bacteria 6207
446 Ga0495640_0018628 3300046533 Bacteria 5141
447 Ga0495640_0061462 3300046533 Bacteria 2551
448 Ga0495640_0096261 3300046533 Bacteria 1948
449 Ga0495640_0121671 3300046533 Bacteria 1696
450 Ga0495640_0158769 3300046533 Bacteria 1450
451 Ga0495586_0044616 3300046535 Bacteria 2388
452 Ga0495586_0073448 3300046535 Bacteria 1871
453 Ga0495587_0000119 3300046536 Bacteria 60244
454 Ga0495587_0000756 3300046536 Bacteria 21566
455 Ga0495587_0005073 3300046536 Bacteria 8610
456 Ga0495587_0007941 3300046536 Bacteria 6854
457 Ga0495587_0077122 3300046536 Bacteria 1935
458 Ga0495587_0142677 3300046536 Bacteria 1366
459 Ga0495587_0393103 3300046536 Bacteria 771
460 Ga0495609_0286598 3300046538 Unclassified 673
461 Ga0495645_0000302 3300046543 Bacteria 35690
462 Ga0495645_0049012 3300046543 Plasmid 3076
463 Ga0495645_0084491 3300046543 Bacteria 2273
464 Ga0495645_0172856 3300046543 Bacteria 1486
465 Ga0495645_0250424 3300046543 Unclassified 1177
466 Ga0495667_0000253 3300046559 Bacteria 34719
467 Ga0495667_0001257 3300046559 Bacteria 16612
468 Ga0495667_0014568 3300046559 Bacteria 5311
469 Ga0495667_0018800 3300046559 Bacteria 4665
470 Ga0495667_0020467 3300046559 Bacteria 4463
471 Ga0495667_0030474 3300046559 Bacteria 3624
472 Ga0495667_0044751 3300046559 Unclassified 2931
473 Ga0495667_0098728 3300046559 Bacteria 1891
474 Ga0495667_0210426 3300046559 Bacteria 1243
475 Ga0495634_0013381 3300046642 Bacteria 5929
476 Ga0495634_0015127 3300046642 Bacteria 5546
477 Ga0495634_0028660 3300046642 Bacteria 3863
478 Ga0495634_0030966 3300046642 Bacteria 3688
479 Ga0495634_0070280 3300046642 Bacteria 2308
480 Ga0495611_0303520 3300046648 Bacteria 736
481 Ga0495635_0001972 3300046663 Bacteria 13953
482 Ga0495635_0002434 3300046663 Bacteria 12698
483 Ga0495635_0002435 3300046663 Bacteria 12698
484 Ga0495635_0009108 3300046663 Bacteria 6931
485 Ga0495635_0355529 3300046663 Bacteria 977
486 Ga0495588_0087454 3300046674 Bacteria 1630
487 Ga0495657_0000067 3300046675 Bacteria 93255
488 Ga0495657_0003973 3300046675 Bacteria 11866
489 Ga0495657_0022269 3300046675 Bacteria 4542
490 Ga0495657_0053709 3300046675 Bacteria 2695
491 Ga0495657_0120503 3300046675 Unclassified 1652
492 Ga0495657_0171193 3300046675 Bacteria 1337
493 Ga0495657_0405778 3300046675 Bacteria 801
494 Ga0495599_0000042 3300046678 Bacteria 94912
495 Ga0495599_0000063 3300046678 Bacteria 73690
496 Ga0495599_0015920 3300046678 Bacteria 4667
497 Ga0495599_0017126 3300046678 Bacteria 4502
498 Ga0495599_0158477 3300046678 Bacteria 1400
499 Ga0495599_0179996 3300046678 Bacteria 1303
500 Ga0495599_0342330 3300046678 Unclassified 897
501 Ga0495623_0000132 3300046679 Bacteria 45369
502 Ga0495623_0000297 3300046679 Bacteria 32443
503 Ga0495623_0008953 3300046679 Bacteria 6499
504 Ga0495623_0068534 3300046679 Bacteria 2213
505 Ga0495623_0087595 3300046679 Bacteria 1918
506 Ga0495646_0000560 3300046680 Bacteria 20144
507 Ga0495646_0029968 3300046680 Bacteria 3399
508 Ga0495646_0044170 3300046680 Plasmid 2725
509 Ga0495646_0052913 3300046680 Unclassified 2450
510 Ga0495646_0148104 3300046680 Unclassified 1307
511 Ga0495646_0154827 3300046680 Bacteria 1272
512 Ga0495646_0679740 3300046680 Unclassified 519
513 Ga0495647_0001966 3300046681 Bacteria 6411
514 Ga0495647_0004600 3300046681 Unclassified 4496
515 Ga0495647_0174521 3300046681 Bacteria 932
516 Ga0495658_0000245 3300046683 Bacteria 31102
517 Ga0495658_0004873 3300046683 Bacteria 6585
518 Ga0495658_0067271 3300046683 Bacteria 2072
519 Ga0495658_0267989 3300046683 Unclassified 1076
520 Ga0495658_0409863 3300046683 Unclassified 864
521 Ga0495613_0000910 3300046689 Bacteria 22719
522 Ga0495613_0004723 3300046689 Bacteria 10223
523 Ga0495613_0097115 3300046689 Bacteria 2130
524 Ga0495613_0168934 3300046689 Bacteria 1553
525 Ga0495613_0280214 3300046689 Bacteria 1158
526 Ga0495624_0000611 3300046690 Bacteria 27875
527 Ga0495624_0023199 3300046690 Bacteria 4093
528 Ga0495624_0054549 3300046690 Unclassified 2519
529 Ga0495624_0084026 3300046690 Bacteria 1968
530 Ga0495624_0222237 3300046690 Unclassified 1145
531 Ga0495600_0003453 3300046809 Bacteria 9288
532 Ga0495600_0006545 3300046809 Bacteria 7090
533 Ga0495600_0040759 3300046809 Unclassified 3025
534 Ga0495600_0136174 3300046809 Bacteria 1595
535 Ga0495581_0002120 3300047315 Bacteria 11183
536 Ga0495581_0011392 3300047315 Bacteria 5145
537 Ga0495581_0016472 3300047315 Unclassified 4296
538 Ga0495581_0025517 3300047315 Bacteria 3427
539 Ga0495604_0000004 3300047317 Bacteria 456385
540 Ga0495604_0000749 3300047317 Bacteria 27290
541 Ga0495604_0015660 3300047317 Bacteria 6052
542 Ga0495604_0044615 3300047317 Bacteria 3462
543 Ga0495604_0277873 3300047317 Unclassified 1132
544 Ga0495604_0636213 3300047317 Bacteria 681
545 Ga0495674_0003020 3300047319 Bacteria 16387
546 Ga0495674_0017597 3300047319 Bacteria 6654
547 Ga0495674_0019473 3300047319 Bacteria 6299
548 Ga0495674_0051622 3300047319 Bacteria 3624
549 Ga0495674_0059909 3300047319 Bacteria 3323
550 Ga0495674_0074065 3300047319 Bacteria 2934
551 Ga0495674_0171418 3300047319 Bacteria 1811
552 Ga0495674_0612719 3300047319 Bacteria 861
553 Ga0495674_0688323 3300047319 Unclassified 803
554 Ga0495676_0005393 3300047321 Bacteria 11722
555 Ga0495676_0005787 3300047321 Bacteria 11339
556 Ga0495676_0008262 3300047321 Bacteria 9547
557 Ga0495680_0000054 3300047322 Bacteria 93244
558 Ga0495680_0001625 3300047322 Bacteria 23901
559 Ga0495680_0008750 3300047322 Bacteria 9169
560 Ga0495680_0012878 3300047322 Bacteria 7329
561 Ga0495680_0031079 3300047322 Bacteria 4350
562 Ga0495680_0036576 3300047322 Bacteria 3940
563 Ga0495680_0114444 3300047322 Bacteria 1996
564 Ga0495675_0000075 3300047444 Bacteria 69347
565 Ga0495675_0031359 3300047444 Bacteria 3393
566 Ga0495675_0066964 3300047444 Bacteria 2270
567 Ga0495677_0258488 3300047445 Bacteria 682
568 Ga0495684_0001323 3300047471 Bacteria 19950
569 Ga0495684_0002467 3300047471 Bacteria 14745
570 Ga0495684_0004368 3300047471 Bacteria 11045
571 Ga0495684_0040159 3300047471 Bacteria 3587
572 Ga0495684_0063140 3300047471 Bacteria 2816
573 Ga0495684_0064877 3300047471 Bacteria 2775
574 Ga0495593_0006744 3300047673 Bacteria 6720
575 Ga0495593_0013851 3300047673 Bacteria 4594
576 Ga0495593_0020301 3300047673 Bacteria 3721
577 Ga0495593_0046619 3300047673 Bacteria 2308
578 Ga0495593_0208198 3300047673 Bacteria 982
579 Ga0495602_0000083 3300048088 Bacteria 93242
580 Ga0495602_0000524 3300048088 Bacteria 35765
581 Ga0495602_0145081 3300048088 Bacteria 1874
582 Ga0495602_0363618 3300048088 Bacteria 1041
583 Ga0495602_0945225 3300048088 Unclassified 571
584 Ga0495614_0000627 3300048089 Bacteria 14801
585 Ga0495614_0237653 3300048089 Bacteria 831
586 Ga0496100_0168030 3300048903 Bacteria 1577
587 Ga0496100_0168448 3300048903 Bacteria 1575
588 Ga0496100_0486477 3300048903 Bacteria 949
589 Ga0496100_1091687 3300048903 Bacteria 629
590 Ga0496101_0010710 3300048904 Bacteria 6062
591 Ga0496101_0012577 3300048904 Bacteria 5651
592 Ga0496101_0021871 3300048904 Bacteria 4396
593 Ga0496101_0097771 3300048904 Archaea 2193
594 Ga0496102_0030034 3300048905 Bacteria 4864
595 Ga0496102_0689362 3300048905 Unclassified 945
596 Ga0496102_0842711 3300048905 Bacteria 839
597 Ga0496102_0870599 3300048905 Unclassified 823
598 Ga0496103_0808850 3300048906 Unclassified 591
599 Ga0496104_0020586 3300048907 Bacteria 6048
600 Ga0496104_0084495 3300048907 Unclassified 3029
601 Ga0496104_0247106 3300048907 Bacteria 1697
602 Ga0496104_1145667 3300048907 Bacteria 681
603 Ga0496105_0020375 3300048908 Bacteria 5359
604 Ga0496105_0082539 3300048908 Bacteria 2655
605 Ga0496105_0339667 3300048908 Unclassified 1201
606 Ga0496105_0525487 3300048908 Bacteria 926
607 Ga0496106_0306971 3300048909 Bacteria 1273
608 Ga0496106_0432191 3300048909 Bacteria 1058
609 Ga0496106_0730396 3300048909 Unclassified 788
610 Ga0496108_0007624 3300048911 Bacteria 8766
611 Ga0496108_0198479 3300048911 Unclassified 1741
612 Ga0496109_0073074 3300048912 Bacteria 3151
613 Ga0496109_0153915 3300048912 Unclassified 2154
614 Ga0496109_0173614 3300048912 Bacteria 2023
615 Ga0496110_0068794 3300048913 Bacteria 3134
616 Ga0496110_0755706 3300048913 Bacteria 875
617 Ga0496110_0816958 3300048913 Unclassified 837
618 Ga0496111_0016322 3300048914 Bacteria 5115
619 Ga0496111_0056360 3300048914 Archaea 2843
620 Ga0496111_0579586 3300048914 Bacteria 822
621 Ga0496111_0625687 3300048914 Unclassified 787
622 Ga0496112_0048934 3300048915 Bacteria 4142
623 Ga0496112_0160495 3300048915 Bacteria 2215
624 Ga0496112_0267340 3300048915 Unclassified 1659
625 Ga0496112_0639566 3300048915 Unclassified 994
626 Ga0496112_0646597 3300048915 Bacteria 987
627 Ga0496112_1157994 3300048915 Bacteria 691
628 Ga0496113_0034492 3300048916 Bacteria 3692
629 Ga0496113_0307538 3300048916 Bacteria 1270
630 Ga0496114_0006163 3300048917 Bacteria 9436
631 Ga0496114_0180763 3300048917 Bacteria 1842
632 Ga0496114_0187698 3300048917 Unclassified 1807
633 Ga0496114_0366979 3300048917 Unclassified 1274
634 Ga0496114_0648693 3300048917 Bacteria 929
635 Ga0496114_0729899 3300048917 Bacteria 867
636 Ga0496115_0016435 3300048918 Bacteria 5636
637 Ga0496115_0048963 3300048918 Bacteria 3381
638 Ga0496115_0128664 3300048918 Bacteria 2087
639 Ga0496115_0555020 3300048918 Bacteria 918
640 Ga0496126_0869225 3300048929 Bacteria 686
641 Ga0501031_0005545 3300049568 Bacteria 8216
642 Ga0501033_0102724 3300049570 Bacteria 2085
643 Ga0501033_0526520 3300049570 Bacteria 816
644 Ga0501034_0100111 3300049571 Bacteria 2893
645 Ga0501036_0002610 3300049572 Bacteria 14211
646 Ga0501036_0127547 3300049572 Unclassified 2148
647 Ga0501036_0246494 3300049572 Bacteria 1498
648 Ga0501038_0112614 3300049574 Bacteria 2252
649 Ga0501038_0182507 3300049574 Bacteria 1692
650 Ga0501038_0969250 3300049574 Bacteria 625
651 Ga0501039_0022722 3300049575 Bacteria 4812
652 Ga0501039_0086997 3300049575 Bacteria 2434
653 Ga0501040_0027834 3300049576 Bacteria 3807
654 Ga0501041_0011618 3300049577 Bacteria 5211
655 Ga0501041_0232713 3300049577 Bacteria 1157
656 Ga0501042_0046084 3300049578 Bacteria 3108
657 Ga0501042_0073561 3300049578 Bacteria 2444
658 Ga0501043_0024389 3300049579 Bacteria 4747
659 Ga0501046_0081015 3300049580 Bacteria 2507
660 Ga0501046_0173524 3300049580 Bacteria 1616
661 Ga0501048_0012534 3300049582 Bacteria 6308
662 Ga0501048_0289318 3300049582 Bacteria 1165
663 Ga0501067_0041700 3300049583 Bacteria 2548
664 Ga0501067_0044444 3300049583 Bacteria 2468
665 Ga0501068_0131794 3300049584 Unclassified 1563
666 Ga0501069_0079764 3300049585 Unclassified 1843
667 Ga0501070_0048483 3300049586 Bacteria 3528
668 Ga0501070_0076925 3300049586 Bacteria 2762
669 Ga0501070_0179339 3300049586 Unclassified 1744
670 Ga0501070_0794439 3300049586 Bacteria 743
671 Ga0501071_0027044 3300049587 Bacteria 4033
672 Ga0501072_0035928 3300049588 Bacteria 3883
673 Ga0501072_0132572 3300049588 Bacteria 1986
674 Ga0501072_0375294 3300049588 Bacteria 1128
675 Ga0501073_0132128 3300049589 Bacteria 1730
676 Ga0501073_0407267 3300049589 Bacteria 940
677 Ga0501074_0008925 3300049590 Bacteria 7270
678 Ga0501074_0084497 3300049590 Bacteria 2275
679 Ga0501074_0203431 3300049590 Bacteria 1411
680 Ga0501075_0013273 3300049591 Bacteria 5878
681 Ga0501075_0697488 3300049591 Bacteria 773
682 Ga0501076_0019824 3300049592 Bacteria 5144
683 Ga0501076_0118346 3300049592 Unclassified 2144
684 Ga0501077_0013254 3300049593 Bacteria 5166
685 Ga0501077_0024737 3300049593 Bacteria 3812
686 Ga0501079_0008733 3300049741 Bacteria 7679
687 Ga0501079_0017873 3300049741 Bacteria 5416
688 Ga0501080_0011560 3300049742 Bacteria 8084
689 Ga0501080_0188607 3300049742 Bacteria 1895
690 Ga0501080_0486739 3300049742 Bacteria 1103
691 Ga0501080_0637596 3300049742 Bacteria 943
692 Ga0501081_0010332 3300049743 Bacteria 6092
693 Ga0501081_0051741 3300049743 Bacteria 2832
694 Ga0501081_0204610 3300049743 Bacteria 1432
695 Ga0501083_0002073 3300049744 Bacteria 13795
696 Ga0501083_0145013 3300049744 Unclassified 1554
697 Ga0501035_0118682 3300049822 Unclassified 2314
698 Ga0501035_0276210 3300049822 Bacteria 1421
699 Ga0501044_0092185 3300049823 Bacteria 3056
700 Ga0501044_0498229 3300049823 Bacteria 1120
701 Ga0501045_0020852 3300049824 Bacteria 4684
702 Ga0501045_0354847 3300049824 Bacteria 1091
703 nmdc:mga05p37_4173_c1 3300050507 Bacteria 16876
704 nmdc:mga08y16_307245_c1 3300050511 Unclassified 1634
705 nmdc:mga08y16_46468_c1 3300050511 Bacteria 4545
706 nmdc:mga0n895_135749_c1 3300050512 Bacteria 2487
707 nmdc:mga0n895_262827_c1 3300050512 Bacteria 1751
708 nmdc:mga0n895_317217_c1 3300050512 Bacteria 1580
709 nmdc:mga0rr50_135995_c1 3300050513 Bacteria 1973
710 nmdc:mga0rr50_525404_c1 3300050513 Bacteria 1007
711 nmdc:mga08x19_349782_c1 3300050514 Bacteria 1032
712 nmdc:mga08x19_722228_c1 3300050514 Bacteria 707
713 nmdc:mga0a205_131851_c1 3300050515 Unclassified 2399
714 nmdc:mga0a205_35031_c1 3300050515 Bacteria 4820
715 nmdc:mga0a205_507675_c1 3300050515 Bacteria 1062
716 nmdc:mga0a205_540401_c1 3300050515 Bacteria 1021
717 nmdc:mga0a205_589259_c1 3300050515 Bacteria 965
718 Ga0495601_0001003 3300053077 Bacteria 15450
719 Ga0495601_0100744 3300053077 Bacteria 1865
720 Ga0495601_0312007 3300053077 Bacteria 1024
721 Ga0495612_0003375 3300053078 Bacteria 6613
722 Ga0495612_0053481 3300053078 Bacteria 1663
723 Ga0495612_0101886 3300053078 Bacteria 1223
724 Ga0495612_0132155 3300053078 Unclassified 1079
725 Ga0495612_0304652 3300053078 Unclassified 715
726 Ga0495612_0541929 3300053078 Unclassified 536
727 Ga0495595_0010809 3300053084 Bacteria 3804
728 Ga0495595_0140268 3300053084 Bacteria 1186
729 Ga0495595_0299016 3300053084 Unclassified 809
730 Ga0495619_0000648 3300053085 Bacteria 22843
731 Ga0495619_0002217 3300053085 Bacteria 12867
732 Ga0495619_0005526 3300053085 Bacteria 8021
733 Ga0495619_0030751 3300053085 Bacteria 3476
734 Ga0495619_0067818 3300053085 Unclassified 2382
735 Ga0495619_0156100 3300053085 Bacteria 1575
736 Ga0495619_0172616 3300053085 Bacteria 1495
737 Ga0495619_0358339 3300053085 Bacteria 1009
738 Ga0495619_0377177 3300053085 Bacteria 980
739 Ga0501084_0041451 3300054114 Bacteria 3851
740 Ga0501084_0044995 3300054114 Bacteria 3696
741 Ga0501084_0171729 3300054114 Bacteria 1830
742 Ga0501084_0180481 3300054114 Bacteria 1782
743 Ga0590077_032440 3300059426 Bacteria 1144
744 Ga0501082_0091494 3300060353 Bacteria 2627
745 Ga0501082_0344756 3300060353 Bacteria 1298
746 Ga0501082_0399822 3300060353 Bacteria 1199
747 Ga0466962_0042247 3300061719 Bacteria 2182
748 Ga0466962_0334518 3300061719 Bacteria 752
749 Ga0530510_0006433 3300061734 Bacteria 8184
750 Ga0530510_0008590 3300061734 Bacteria 7134
751 Ga0530510_0664043 3300061734 Bacteria 794
752 Ga0530510_0918408 3300061734 Unclassified 669
753 Ga0436364_0458282
754 Ga0070658_10029449
755 Ga0070683_100008344
756 Ga0070683_100669714
757 Ga0070680_100092427
758 Ga0070680_100180989
759 Ga0070680_100197355
760 Ga0070680_100432210
761 Ga0068868_100558505
762 Ga0070660_100008122
763 Ga0070661_100025917
764 Ga0070674_100733305
765 Ga0070688_101383295
766 Ga0070659_100156890
767 Ga0070659_100587949
768 Ga0070659_100958223
769 Ga0070709_10910372
770 Ga0070713_100017211
771 Ga0070713_100635507
772 Ga0070710_10122823
773 Ga0070710_10136858
774 Ga0070710_10385815
775 Ga0070711_100019629
776 Ga0070711_100027531
777 Ga0070711_100192452
778 Ga0070711_100519762
779 Ga0070705_100367770
780 Ga0070700_100752237
781 Ga0070708_100358408
782 Ga0070678_100790694
783 Ga0070681_10021809
784 Ga0070681_10102947
785 Ga0070681_10132409
786 Ga0070681_10239167
787 Ga0070681_10791058
788 Ga0068867_100531156
789 Ga0070706_100036315
790 Ga0070706_100365423
791 Ga0070707_100088122
792 Ga0070707_100181252
793 Ga0070707_100738711
794 Ga0070707_100958329
795 Ga0070698_100122382
796 Ga0070699_100010266
797 Ga0070699_100032770
798 Ga0070699_100598040
799 Ga0070679_100067576
800 Ga0070679_100072003
801 Ga0070679_100248215
802 Ga0070684_100028374
803 Ga0070684_100149217
804 Ga0070684_101212842
805 Ga0070697_100005179
806 Ga0070697_100005436
807 Ga0068853_100314262
808 Ga0068853_100494058
809 Ga0070695_100118462
810 Ga0070665_100444434
811 Ga0068857_100056585
812 Ga0068857_100352627
813 Ga0068854_100517225
814 Ga0068856_100143144
815 Ga0068856_100320612
816 Ga0068856_100329602
817 Ga0081455_10081162
818 Ga0081455_10475021
819 Ga0081540_1205524
820 Ga0070717_10169286
821 Ga0070717_10211171
822 Ga0070717_10285468
823 Ga0070717_10596693
824 Ga0070717_10621181
825 Ga0070717_11460413
826 Ga0075432_10048467
827 Ga0070715_10029745
828 Ga0070715_10353491
829 Ga0070715_10451581
830 Ga0070716_100095427
831 Ga0070712_100003758
832 Ga0070712_100023530
833 Ga0070712_100106718
834 Ga0070712_100457759
835 Ga0075433_10019520
836 Ga0075433_10136034
837 Ga0075433_10333055
838 Ga0075434_100352207
839 Ga0075436_100029394
840 Ga0075435_100226938
841 Ga0075435_100716449
842 Ga0075435_101401567
843 Ga0105240_10264969
844 Ga0105240_10303951
845 Ga0105240_10771158
846 Ga0105240_10812314
847 Ga0111539_10087422
848 Ga0111539_10128424
849 Ga0111539_10234832
850 Ga0105245_10041686
851 Ga0105245_10843995
852 Ga0105245_10995498
853 Ga0105245_11425718
854 Ga0105247_10788889
855 Ga0105243_10588698
856 Ga0105243_10918056
857 Ga0105241_10943706
858 Ga0105241_11339433
859 Ga0105242_10680159
860 Ga0105237_10173645
861 Ga0105237_10336253
862 Ga0105237_10540100
863 Ga0105249_10368669
864 Ga0105249_11800236
865 Ga0105239_10357555
866 Ga0105239_10514669
867 Ga0105246_10526344
868 Ga0157338_1078832
869 Ga0157373_10055526
870 Ga0157370_10004652
871 Ga0157370_10474537
872 Ga0157370_12005301
873 Ga0157369_10874590
874 Ga0157369_10985058
875 Ga0157374_11189823
876 Ga0163162_11236513
877 Ga0157372_10171621
878 Ga0157372_10562325
879 Ga0157375_12338806
880 Ga0163163_10172619
881 Ga0163163_10271834
882 Ga0163163_10555380
883 Ga0163163_10910127
884 Ga0157380_10469996
885 Ga0182008_10002385
886 Ga0157377_10138807
887 Ga0157376_10762826
888 Ga0157376_12091758
889 Ga0182006_1085570
890 Ga0163161_10748039
891 Ga0197907_11002288
892 Ga0206356_11160239
893 Ga0206354_11222688
894 Ga0206353_10181333
895 Ga0206353_12023555
896 Ga0213875_10155949
897 Ga0207692_10005869
898 Ga0207692_10033859
899 Ga0207692_10073206
900 Ga0207685_10005475
901 Ga0207685_10481195
902 Ga0207705_10063949
903 Ga0207684_10018469
904 Ga0207684_10036456
905 Ga0207684_10144524
906 Ga0207707_10081694
907 Ga0207707_10184886
908 Ga0207695_10375453
909 Ga0207671_10025969
910 Ga0207671_10104596
911 Ga0207693_10002613
912 Ga0207693_10013042
913 Ga0207693_10018376
914 Ga0207693_10130761
915 Ga0207693_10200459
916 Ga0207663_10008287
917 Ga0207663_10109403
918 Ga0207663_10331634
919 Ga0207663_10385033
920 Ga0207663_10397157
921 Ga0207663_10414933
922 Ga0207660_10075917
923 Ga0207657_10000964
924 Ga0207649_10032593
925 Ga0207646_10007631
926 Ga0207646_10047283
927 Ga0207681_11231161
928 Ga0207700_10039434
929 Ga0207700_10471696
930 Ga0207664_11311797
931 Ga0207664_11395023
932 Ga0207690_10276888
933 Ga0207665_10699407
934 Ga0207691_10553542
935 Ga0207661_10139208
936 Ga0207661_10360673
937 Ga0207661_10564533
938 Ga0207667_10116255
939 Ga0207712_10337729
940 Ga0207668_11648477
941 Ga0207702_10072302
942 Ga0207702_10247817
943 Ga0207648_10128270
944 Ga0207674_10070623
945 Ga0207674_10381071
946 Ga0207683_11087410
947 Ga0207428_10283271
948 Ga0268266_10634242
949 Ga0268265_10931211
950 Ga0265760_10257865
951 Ga0265340_10116097
952 Ga0265314_10336595
953 Ga0307405_10482313
954 Ga0307410_11098914
955 Ga0307409_100816850
956 Ga0307415_100363188
957 Ga0373926_0001987
958 Ga0373926_0004338
959 Ga0373926_0079196
960 Ga0373934_0000196
961 Ga0373934_0065260
962 Ga0373944_0001293
963 Ga0373944_0001729
964 Ga0373944_0062118
965 Ga0373952_0019633
966 Ga0373923_0000096
967 Ga0373923_0006540
968 Ga0373923_0349978
969 Ga0373936_0002062
970 Ga0373936_0012555
971 Ga0373936_0025147
972 Ga0373945_0000006
973 Ga0373945_0000033
974 Ga0373945_0018772
975 Ga0373953_0000133
976 Ga0373953_0002866
977 Ga0373953_0163199
978 Ga0373954_0101660
979 Ga0373954_0102957
980 Ga0373954_0299449
981 Ga0373956_0000537
982 Ga0373956_0128730
983 Ga0373956_0325362
984 Ga0373956_0485319
985 Ga0373957_0000815
986 Ga0373957_0004464
987 Ga0373957_0004731
988 Ga0373957_0171296
989 Ga0373957_0295655
990 Ga0373960_0380549
991 Ga0373943_0000904
992 Ga0373943_0001521
993 Ga0373946_0000392
994 Ga0373946_0011653
995 Ga0373946_0027954
996 Ga0373955_0000130
997 Ga0373955_0004056
998 Ga0373955_0011112
999 Ga0373955_0131131
1000 Ga0373955_0303463
1001 Ga0373955_0324325
1002 Ga0373955_0576059
1003 Ga0373961_0046200
1004 Ga0373924_0000286
1005 Ga0373924_0015210
1006 Ga0373924_0017008
1007 Ga0373931_0030251
1008 Ga0373935_0001107
1009 Ga0373935_0057923
1010 Ga0373935_0128664
1011 Ga0373935_0295548
1012 Ga0373935_0369421
1013 Ga0373935_0492407
1014 Ga0373927_0003915
1015 Ga0373927_0007610
1016 Ga0373927_0136070
1017 Ga0373933_0000121
1018 Ga0373933_0012868
1019 Ga0373933_0026106
1020 Ga0373933_0102060
1021 Ga0373933_0465492
1022 Ga0373947_0000939
1023 Ga0373947_0002845
1024 Ga0373947_0009756
1025 Ga0373947_0023843
1026 Ga0373937_0000190
1027 Ga0373937_0000671
1028 Ga0373937_0028381
1029 Ga0373937_0028865
1030 Ga0373937_0054575
1031 Ga0373937_0076091
1032 Ga0373937_0104611
1033 Ga0373925_0007222
1034 Ga0373925_0024347
1035 Ga0373925_0026296
1036 Ga0373925_0264191
1037 Ga0373925_0505362
1038 Ga0373925_1520603
1039 Ga0395900_0013258
1040 Ga0395900_0421033
1041 Ga0395898_0037444
1042 Ga0395898_0197852
1043 Ga0395898_0563540
1044 Ga0395905_0082224
1045 Ga0395905_0169589
1046 Ga0395905_0494174
1047 Ga0436364_0365242
1048 Ga0395901_0022032
1049 Ga0395901_0312714
1050 Ga0395901_0600939
1051 Ga0436365_0248728
1052 Ga0436365_1501831
1053 Ga0436363_1541417
1054 Ga0436362_0236721
1055 Ga0451789_1217424
1056 Ga0451793_0887223
1057 Ga0451795_1713235
1058 Ga0451800_0960620
1059 Ga0451802_1623103
1060 Ga0451807_1979534
1061 Ga0451833_0893515
1062 Ga0451835_0620315
1063 Ga0451839_0751977
1064 Ga0451841_0626723
1065 Ga0451849_0672841
1066 Ga0451855_1565654
1067 Ga0451853_2337302
1068 Ga0451853_2571487
1069 Ga0439448_0141379
1070 Ga0439450_216691
1071 Ga0439458_0132298
1072 Ga0439460_0343140
1073 Ga0450918_023532
1074 Ga0439440_0197245
1075 Ga0466963_0002216
1076 Ga0466963_0035889
1077 Ga0466963_0147959
1078 Ga0466963_0964451
1079 Ga0466964_0086650
1080 Ga0466964_0214464
1081 Ga0466964_0610132
1082 Ga0466957_0132348
1083 Ga0466957_0160110
1084 Ga0466957_0165010
1085 Ga0466960_0014177
1086 Ga0466958_0002307
1087 Ga0466958_0012372
1088 Ga0466967_0011663
1089 Ga0466967_0040251
1090 Ga0466967_0069312
1091 Ga0466967_0092643
1092 Ga0466967_0388563
1093 Ga0466967_1056651
1094 Ga0466967_1406448
1095 Ga0495592_0000070
1096 Ga0495592_0000206
1097 Ga0495592_0010136
1098 Ga0495592_0082463
1099 Ga0495592_0204622
1100 Ga0495592_0244502
1101 Ga0495592_0286546
1102 Ga0495592_0464374
1103 Ga0495603_0000794
1104 Ga0495603_0106896
1105 Ga0495603_0197816
1106 Ga0495629_0001447
1107 Ga0495629_0001647
1108 Ga0495629_0016488
1109 Ga0495629_0113227
1110 Ga0495629_0134220
1111 Ga0495641_0003897
1112 Ga0495641_0010886
1113 Ga0495641_0013567
1114 Ga0495641_0191307
1115 Ga0495651_0000042
1116 Ga0495651_0000053
1117 Ga0495651_0024629
1118 Ga0495651_0040155
1119 Ga0495651_0339397
1120 Ga0495651_0645968
1121 Ga0495653_0003163
1122 Ga0495653_0003512
1123 Ga0495653_0010133
1124 Ga0495653_0018523
1125 Ga0495653_0022163
1126 Ga0495653_0023865
1127 Ga0495653_0056868
1128 Ga0495653_0077023
1129 Ga0495580_0000893
1130 Ga0495580_0740926
1131 Ga0495582_0000092
1132 Ga0495582_0004863
1133 Ga0495582_0011651
1134 Ga0495582_0050101
1135 Ga0495582_0120459
1136 Ga0495582_0154304
1137 Ga0495639_0000142
1138 Ga0495639_0005945
1139 Ga0495639_0048546
1140 Ga0495662_0001812
1141 Ga0495662_0007338
1142 Ga0495662_0057614
1143 Ga0495662_0090101
1144 Ga0495662_0107892
1145 Ga0495662_0209831
1146 Ga0495664_0004862
1147 Ga0495664_0014410
1148 Ga0495664_0018021
1149 Ga0495594_0011460
1150 Ga0495594_0021566
1151 Ga0495608_0000054
1152 Ga0495608_0002448
1153 Ga0495608_0012588
1154 Ga0495608_0020652
1155 Ga0495608_0062840
1156 Ga0495608_0149825
1157 Ga0495608_0282082
1158 Ga0495608_0291649
1159 Ga0495608_0322350
1160 Ga0495608_0420729
1161 Ga0495618_0003117
1162 Ga0495618_0012524
1163 Ga0495618_0016557
1164 Ga0495618_0033458
1165 Ga0495618_0065681
1166 Ga0495618_0279607
1167 Ga0495628_0000047
1168 Ga0495628_0000106
1169 Ga0495628_0010271
1170 Ga0495628_0051594
1171 Ga0495628_0083200
1172 Ga0495628_0206956
1173 Ga0495628_0428949
1174 Ga0495628_0647682
1175 Ga0495630_0003384
1176 Ga0495630_0019551
1177 Ga0495630_0040697
1178 Ga0495630_0111053
1179 Ga0495630_0119196
1180 Ga0495630_0248721
1181 Ga0495644_0341821
1182 Ga0495666_0002208
1183 Ga0495666_0056909
1184 Ga0495666_0466331
1185 Ga0495652_0000291
1186 Ga0495652_0012044
1187 Ga0495652_0013837
1188 Ga0495652_0029059
1189 Ga0495652_0041811
1190 Ga0495652_0086546
1191 Ga0495652_0130577
1192 Ga0495652_0571729
1193 Ga0495665_0000679
1194 Ga0495665_0014908
1195 Ga0495665_0039831
1196 Ga0495665_0132573
1197 Ga0495640_0013511
1198 Ga0495640_0018628
1199 Ga0495640_0061462
1200 Ga0495640_0096261
1201 Ga0495640_0121671
1202 Ga0495640_0158769
1203 Ga0495586_0044616
1204 Ga0495586_0073448
1205 Ga0495587_0000119
1206 Ga0495587_0000756
1207 Ga0495587_0005073
1208 Ga0495587_0007941
1209 Ga0495587_0077122
1210 Ga0495587_0142677
1211 Ga0495587_0393103
1212 Ga0495609_0286598
1213 Ga0495645_0000302
1214 Ga0495645_0049012
1215 Ga0495645_0084491
1216 Ga0495645_0172856
1217 Ga0495645_0250424
1218 Ga0495667_0000253
1219 Ga0495667_0001257
1220 Ga0495667_0014568
1221 Ga0495667_0018800
1222 Ga0495667_0020467
1223 Ga0495667_0030474
1224 Ga0495667_0044751
1225 Ga0495667_0098728
1226 Ga0495667_0210426
1227 Ga0495634_0013381
1228 Ga0495634_0015127
1229 Ga0495634_0028660
1230 Ga0495634_0030966
1231 Ga0495634_0070280
1232 Ga0495611_0303520
1233 Ga0495635_0001972
1234 Ga0495635_0002434
1235 Ga0495635_0002435
1236 Ga0495635_0009108
1237 Ga0495635_0355529
1238 Ga0495588_0087454
1239 Ga0495657_0000067
1240 Ga0495657_0003973
1241 Ga0495657_0022269
1242 Ga0495657_0053709
1243 Ga0495657_0120503
1244 Ga0495657_0171193
1245 Ga0495657_0405778
1246 Ga0495599_0000042
1247 Ga0495599_0000063
1248 Ga0495599_0015920
1249 Ga0495599_0017126
1250 Ga0495599_0158477
1251 Ga0495599_0179996
1252 Ga0495599_0342330
1253 Ga0495623_0000132
1254 Ga0495623_0000297
1255 Ga0495623_0008953
1256 Ga0495623_0068534
1257 Ga0495623_0087595
1258 Ga0495646_0000560
1259 Ga0495646_0029968
1260 Ga0495646_0044170
1261 Ga0495646_0052913
1262 Ga0495646_0148104
1263 Ga0495646_0154827
1264 Ga0495646_0679740
1265 Ga0495647_0001966
1266 Ga0495647_0004600
1267 Ga0495647_0174521
1268 Ga0495658_0000245
1269 Ga0495658_0004873
1270 Ga0495658_0067271
1271 Ga0495658_0267989
1272 Ga0495658_0409863
1273 Ga0495613_0000910
1274 Ga0495613_0004723
1275 Ga0495613_0097115
1276 Ga0495613_0168934
1277 Ga0495613_0280214
1278 Ga0495624_0000611
1279 Ga0495624_0023199
1280 Ga0495624_0054549
1281 Ga0495624_0084026
1282 Ga0495624_0222237
1283 Ga0495600_0003453
1284 Ga0495600_0006545
1285 Ga0495600_0040759
1286 Ga0495600_0136174
1287 Ga0495581_0002120
1288 Ga0495581_0011392
1289 Ga0495581_0016472
1290 Ga0495581_0025517
1291 Ga0495604_0000004
1292 Ga0495604_0000749
1293 Ga0495604_0015660
1294 Ga0495604_0044615
1295 Ga0495604_0277873
1296 Ga0495604_0636213
1297 Ga0495674_0003020
1298 Ga0495674_0017597
1299 Ga0495674_0019473
1300 Ga0495674_0051622
1301 Ga0495674_0059909
1302 Ga0495674_0074065
1303 Ga0495674_0171418
1304 Ga0495674_0612719
1305 Ga0495674_0688323
1306 Ga0495676_0005393
1307 Ga0495676_0005787
1308 Ga0495676_0008262
1309 Ga0495680_0000054
1310 Ga0495680_0001625
1311 Ga0495680_0008750
1312 Ga0495680_0012878
1313 Ga0495680_0031079
1314 Ga0495680_0036576
1315 Ga0495680_0114444
1316 Ga0495675_0000075
1317 Ga0495675_0031359
1318 Ga0495675_0066964
1319 Ga0495677_0258488
1320 Ga0495684_0001323
1321 Ga0495684_0002467
1322 Ga0495684_0004368
1323 Ga0495684_0040159
1324 Ga0495684_0063140
1325 Ga0495684_0064877
1326 Ga0495593_0006744
1327 Ga0495593_0013851
1328 Ga0495593_0020301
1329 Ga0495593_0046619
1330 Ga0495593_0208198
1331 Ga0495602_0000083
1332 Ga0495602_0000524
1333 Ga0495602_0145081
1334 Ga0495602_0363618
1335 Ga0495602_0945225
1336 Ga0495614_0000627
1337 Ga0495614_0237653
1338 Ga0496100_0168030
1339 Ga0496100_0168448
1340 Ga0496100_0486477
1341 Ga0496100_1091687
1342 Ga0496101_0010710
1343 Ga0496101_0012577
1344 Ga0496101_0021871
1345 Ga0496101_0097771
1346 Ga0496102_0030034
1347 Ga0496102_0689362
1348 Ga0496102_0842711
1349 Ga0496102_0870599
1350 Ga0496103_0808850
1351 Ga0496104_0020586
1352 Ga0496104_0084495
1353 Ga0496104_0247106
1354 Ga0496104_1145667
1355 Ga0496105_0020375
1356 Ga0496105_0082539
1357 Ga0496105_0339667
1358 Ga0496105_0525487
1359 Ga0496106_0306971
1360 Ga0496106_0432191
1361 Ga0496106_0730396
1362 Ga0496108_0007624
1363 Ga0496108_0198479
1364 Ga0496109_0073074
1365 Ga0496109_0153915
1366 Ga0496109_0173614
1367 Ga0496110_0068794
1368 Ga0496110_0755706
1369 Ga0496110_0816958
1370 Ga0496111_0016322
1371 Ga0496111_0056360
1372 Ga0496111_0579586
1373 Ga0496111_0625687
1374 Ga0496112_0048934
1375 Ga0496112_0160495
1376 Ga0496112_0267340
1377 Ga0496112_0639566
1378 Ga0496112_0646597
1379 Ga0496112_1157994
1380 Ga0496113_0034492
1381 Ga0496113_0307538
1382 Ga0496114_0006163
1383 Ga0496114_0180763
1384 Ga0496114_0187698
1385 Ga0496114_0366979
1386 Ga0496114_0648693
1387 Ga0496114_0729899
1388 Ga0496115_0016435
1389 Ga0496115_0048963
1390 Ga0496115_0128664
1391 Ga0496115_0555020
1392 Ga0496126_0869225
1393 Ga0501031_0005545
1394 Ga0501033_0102724
1395 Ga0501033_0526520
1396 Ga0501034_0100111
1397 Ga0501036_0002610
1398 Ga0501036_0127547
1399 Ga0501036_0246494
1400 Ga0501038_0112614
1401 Ga0501038_0182507
1402 Ga0501038_0969250
1403 Ga0501039_0022722
1404 Ga0501039_0086997
1405 Ga0501040_0027834
1406 Ga0501041_0011618
1407 Ga0501041_0232713
1408 Ga0501042_0046084
1409 Ga0501042_0073561
1410 Ga0501043_0024389
1411 Ga0501046_0081015
1412 Ga0501046_0173524
1413 Ga0501048_0012534
1414 Ga0501048_0289318
1415 Ga0501067_0041700
1416 Ga0501067_0044444
1417 Ga0501068_0131794
1418 Ga0501069_0079764
1419 Ga0501070_0048483
1420 Ga0501070_0076925
1421 Ga0501070_0179339
1422 Ga0501070_0794439
1423 Ga0501071_0027044
1424 Ga0501072_0035928
1425 Ga0501072_0132572
1426 Ga0501072_0375294
1427 Ga0501073_0132128
1428 Ga0501073_0407267
1429 Ga0501074_0008925
1430 Ga0501074_0084497
1431 Ga0501074_0203431
1432 Ga0501075_0013273
1433 Ga0501075_0697488
1434 Ga0501076_0019824
1435 Ga0501076_0118346
1436 Ga0501077_0013254
1437 Ga0501077_0024737
1438 Ga0501079_0008733
1439 Ga0501079_0017873
1440 Ga0501080_0011560
1441 Ga0501080_0188607
1442 Ga0501080_0486739
1443 Ga0501080_0637596
1444 Ga0501081_0010332
1445 Ga0501081_0051741
1446 Ga0501081_0204610
1447 Ga0501083_0002073
1448 Ga0501083_0145013
1449 Ga0501035_0118682
1450 Ga0501035_0276210
1451 Ga0501044_0092185
1452 Ga0501044_0498229
1453 Ga0501045_0020852
1454 Ga0501045_0354847
1455 nmdc:mga05p37_4173_c1
1456 nmdc:mga08y16_307245_c1
1457 nmdc:mga08y16_46468_c1
1458 nmdc:mga0n895_135749_c1
1459 nmdc:mga0n895_262827_c1
1460 nmdc:mga0n895_317217_c1
1461 nmdc:mga0rr50_135995_c1
1462 nmdc:mga0rr50_525404_c1
1463 nmdc:mga08x19_349782_c1
1464 nmdc:mga08x19_722228_c1
1465 nmdc:mga0a205_131851_c1
1466 nmdc:mga0a205_35031_c1
1467 nmdc:mga0a205_507675_c1
1468 nmdc:mga0a205_540401_c1
1469 nmdc:mga0a205_589259_c1
1470 Ga0495601_0001003
1471 Ga0495601_0100744
1472 Ga0495601_0312007
1473 Ga0495612_0003375
1474 Ga0495612_0053481
1475 Ga0495612_0101886
1476 Ga0495612_0132155
1477 Ga0495612_0304652
1478 Ga0495612_0541929
1479 Ga0495595_0010809
1480 Ga0495595_0140268
1481 Ga0495595_0299016
1482 Ga0495619_0000648
1483 Ga0495619_0002217
1484 Ga0495619_0005526
1485 Ga0495619_0030751
1486 Ga0495619_0067818
1487 Ga0495619_0156100
1488 Ga0495619_0172616
1489 Ga0495619_0358339
1490 Ga0495619_0377177
1491 Ga0501084_0041451
1492 Ga0501084_0044995
1493 Ga0501084_0171729
1494 Ga0501084_0180481
1495 Ga0590077_032440
1496 Ga0501082_0091494
1497 Ga0501082_0344756
1498 Ga0501082_0399822
1499 Ga0466962_0042247
1500 Ga0466962_0334518
1501 Ga0530510_0006433
1502 Ga0530510_0008590
1503 Ga0530510_0664043
1504 Ga0530510_0918408

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nsl-assembly1.cif.gz_F crystal structure of probable acetyltransferase 0.7788 14 143
3juw-assembly2.cif.gz_C-2 putative gnat-family acetyltransferase from bordetella pertussis. 0.7562 12 135
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.7503 12 134
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.7445 14 143
1nsl-assembly1.cif.gz_E crystal structure of probable acetyltransferase 0.7437 14 136
ID Description Score Start End Superfamily
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7782 15 143 3.40.630.30
3exnA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7632 19 135 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7602 14 134 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7593 14 137 3.40.630.30
af_O05841_12_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7492 17 143 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538EHY1-F1-model_v4 N-acetyltransferase 0.9905 3 149 GO:0016740
AF-A0A7Y5U714-F1-model_v4 N-acetyltransferase 0.9897 1 149 GO:0016740
AF-A0A5M3W926-F1-model_v4 SnoaL-like domain-containing protein 0.9887 2 150
AF-A0A3D8RV21-F1-model_v4 N-acetyltransferase domain-containing protein 0.9876 3 148
AF-A0A2W6DQD5-F1-model_v4 Twin-arginine translocation pathway signal protein 0.984 3 150

Map