F479080

General Info

Members Datasets Scaffolds Average Seq Length
751 363 1502 80

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10100162|JGI24738J21930_101001621
Length 83
Sequence MQKSLLLIVAVVLPASATFAEQIRVPKSEKAATSGKVLPLKGARSANSCAEYGAGFVKIEGTNTCMKIGGAISIGAGTSAGSH

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
203 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
206 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
207 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
322 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
323 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
328 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
332 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
343 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
344 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
352 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
353 2791355199
354 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
355 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
356 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
357 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
358 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
359 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
360 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
361 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
362 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
363 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 1.2
Rhizoplane 5.46
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10100162 3300002075 Bacteria 618
2 JGI25406J46586_10146065 3300003203 Bacteria 691
3 JGI25404J52841_10003538 3300003659 Bacteria 3098
4 Ga0070658_11408277 3300005327 Bacteria 605
5 Ga0070676_10134039 3300005328 Bacteria 1569
6 Ga0070676_11164581 3300005328 Bacteria 585
7 Ga0070670_100049694 3300005331 Bacteria 3605
8 Ga0068869_100032889 3300005334 Bacteria 3658
9 Ga0068869_100162069 3300005334 Bacteria 1741
10 Ga0068869_100292653 3300005334 Bacteria 1312
11 Ga0068869_100530379 3300005334 Bacteria 987
12 Ga0068869_101773627 3300005334 Bacteria 552
13 Ga0070666_10904716 3300005335 Bacteria 652
14 Ga0070666_11387796 3300005335 Bacteria 525
15 Ga0070682_101079936 3300005337 Bacteria 671
16 Ga0068868_100019362 3300005338 Bacteria 5099
17 Ga0068868_100143820 3300005338 Bacteria 1960
18 Ga0068868_100590919 3300005338 Bacteria 982
19 Ga0068868_101067523 3300005338 Bacteria 742
20 Ga0070660_100601167 3300005339 Bacteria 920
21 Ga0070689_100902712 3300005340 Bacteria 782
22 Ga0070689_101026545 3300005340 Bacteria 734
23 Ga0070691_10542390 3300005341 Bacteria 678
24 Ga0070691_10902279 3300005341 Bacteria 545
25 Ga0070661_101125110 3300005344 Bacteria 655
26 Ga0070692_10555325 3300005345 Bacteria 753
27 Ga0070668_100027559 3300005347 Bacteria 4313
28 Ga0070668_100035347 3300005347 Bacteria 3810
29 Ga0070668_100043775 3300005347 Bacteria 3433
30 Ga0070668_100354037 3300005347 Unclassified 1243
31 Ga0070668_100388201 3300005347 Bacteria 1189
32 Ga0070668_100548940 3300005347 Bacteria 1005
33 Ga0070668_100818119 3300005347 Bacteria 828
34 Ga0070668_101667225 3300005347 Bacteria 585
35 Ga0070669_100054144 3300005353 Bacteria 2938
36 Ga0070669_100730746 3300005353 Bacteria 838
37 Ga0070669_101758810 3300005353 Bacteria 541
38 Ga0070675_100383967 3300005354 Bacteria 1251
39 Ga0070671_101023848 3300005355 Bacteria 724
40 Ga0070671_101133820 3300005355 Bacteria 687
41 Ga0070674_100324468 3300005356 Bacteria 1235
42 Ga0070673_100702611 3300005364 Bacteria 929
43 Ga0070673_101161350 3300005364 Bacteria 722
44 Ga0070688_100438068 3300005365 Bacteria 974
45 Ga0070688_100744061 3300005365 Bacteria 763
46 Ga0070659_101012606 3300005366 Bacteria 729
47 Ga0070659_101338556 3300005366 Bacteria 635
48 Ga0070667_100130190 3300005367 Bacteria 2195
49 Ga0070667_100350423 3300005367 Bacteria 1336
50 Ga0070667_100713167 3300005367 Bacteria 929
51 Ga0070667_102191418 3300005367 Bacteria 521
52 Ga0070703_10410343 3300005406 Bacteria 592
53 Ga0070709_10002536 3300005434 Bacteria 9876
54 Ga0070714_100002611 3300005435 Bacteria 13280
55 Ga0070714_100577552 3300005435 Bacteria 1078
56 Ga0070713_100034345 3300005436 Bacteria 4073
57 Ga0070710_10000517 3300005437 Bacteria 18133
58 Ga0070710_10090598 3300005437 Bacteria 1803
59 Ga0070701_10564305 3300005438 Bacteria 749
60 Ga0070711_100003443 3300005439 Bacteria 9218
61 Ga0070711_100016032 3300005439 Bacteria 4750
62 Ga0070700_100037296 3300005441 Bacteria 2955
63 Ga0070700_101042829 3300005441 Bacteria 675
64 Ga0070700_101719837 3300005441 Bacteria 539
65 Ga0070694_100360527 3300005444 Bacteria 1129
66 Ga0070663_100086861 3300005455 Bacteria 2310
67 Ga0070663_100123349 3300005455 Bacteria 1959
68 Ga0070663_100534907 3300005455 Bacteria 977
69 Ga0070678_100051348 3300005456 Bacteria 2988
70 Ga0070678_100069574 3300005456 Bacteria 2628
71 Ga0070678_100211621 3300005456 Bacteria 1607
72 Ga0070678_100533817 3300005456 Bacteria 1039
73 Ga0070662_100093206 3300005457 Bacteria 2265
74 Ga0070662_100208901 3300005457 Bacteria 1552
75 Ga0070662_101609641 3300005457 Bacteria 560
76 Ga0070698_100181894 3300005471 Bacteria 2040
77 Ga0070698_102128394 3300005471 Bacteria 515
78 Ga0068853_101212866 3300005539 Bacteria 728
79 Ga0068853_101915952 3300005539 Bacteria 575
80 Ga0068853_102224528 3300005539 Bacteria 531
81 Ga0070672_100562996 3300005543 Bacteria 990
82 Ga0070672_100667395 3300005543 Bacteria 909
83 Ga0070686_100136175 3300005544 Bacteria 1704
84 Ga0070686_100640483 3300005544 Bacteria 842
85 Ga0070695_100039170 3300005545 Bacteria 2994
86 Ga0070693_100224950 3300005547 Bacteria 1231
87 Ga0070693_100653355 3300005547 Bacteria 765
88 Ga0070665_100004521 3300005548 Bacteria 14572
89 Ga0070665_100017374 3300005548 Bacteria 7221
90 Ga0070665_100025517 3300005548 Bacteria 5953
91 Ga0070665_100026171 3300005548 Bacteria 5874
92 Ga0070665_100282305 3300005548 Bacteria 1662
93 Ga0070665_100289395 3300005548 Bacteria 1641
94 Ga0070665_100491279 3300005548 Bacteria 1238
95 Ga0070665_101654654 3300005548 Bacteria 648
96 Ga0070665_101823598 3300005548 Bacteria 615
97 Ga0070704_100237636 3300005549 Bacteria 1490
98 Ga0070704_100546493 3300005549 Bacteria 1011
99 Ga0068855_100325594 3300005563 Bacteria 1697
100 Ga0070664_100694112 3300005564 Bacteria 948
101 Ga0070664_101557984 3300005564 Bacteria 626
102 Ga0070664_102319990 3300005564 Bacteria 509
103 Ga0068857_100590730 3300005577 Bacteria 1049
104 Ga0068857_100661500 3300005577 Bacteria 990
105 Ga0068854_100290286 3300005578 Bacteria 1320
106 Ga0068856_100158739 3300005614 Bacteria 2272
107 Ga0070702_100175754 3300005615 Bacteria 1397
108 Ga0070702_100189095 3300005615 Bacteria 1353
109 Ga0070702_100834969 3300005615 Bacteria 716
110 Ga0068852_100377667 3300005616 Bacteria 1390
111 Ga0068852_101031588 3300005616 Bacteria 842
112 Ga0068852_102093551 3300005616 Bacteria 588
113 Ga0068852_102437223 3300005616 Bacteria 544
114 Ga0068859_100111070 3300005617 Bacteria 2803
115 Ga0068859_100822815 3300005617 Bacteria 1015
116 Ga0068859_100833448 3300005617 Bacteria 1009
117 Ga0068864_100040231 3300005618 Bacteria 3999
118 Ga0068864_100364405 3300005618 Bacteria 1366
119 Ga0068864_101173461 3300005618 Bacteria 766
120 Ga0068864_102226001 3300005618 Bacteria 555
121 Ga0068866_10188186 3300005718 Bacteria 1225
122 Ga0068861_100023440 3300005719 Bacteria 4451
123 Ga0068861_100121434 3300005719 Bacteria 2108
124 Ga0068861_100360868 3300005719 Bacteria 1278
125 Ga0068861_100495361 3300005719 Bacteria 1103
126 Ga0068861_100913085 3300005719 Bacteria 832
127 Ga0068861_101585856 3300005719 Bacteria 644
128 Ga0068863_100035436 3300005841 Bacteria 4753
129 Ga0068863_101705815 3300005841 Bacteria 639
130 Ga0068858_100012050 3300005842 Bacteria 8150
131 Ga0068858_100108508 3300005842 Bacteria 2591
132 Ga0068858_100734169 3300005842 Bacteria 962
133 Ga0068860_100084228 3300005843 Bacteria 3024
134 Ga0068860_102069405 3300005843 Bacteria 591
135 Ga0068860_102191355 3300005843 Bacteria 574
136 Ga0068860_102531823 3300005843 Bacteria 533
137 Ga0068862_100006644 3300005844 Bacteria 9594
138 Ga0068862_100058358 3300005844 Bacteria 3310
139 Ga0068862_100134805 3300005844 Bacteria 2187
140 Ga0068862_100297255 3300005844 Bacteria 1484
141 Ga0068862_100463463 3300005844 Bacteria 1197
142 Ga0068862_100505767 3300005844 Bacteria 1147
143 Ga0068862_101219095 3300005844 Bacteria 751
144 Ga0081455_10002749 3300005937 Bacteria 20761
145 Ga0081455_10290977 3300005937 Bacteria 1176
146 Ga0081538_10106030 3300005981 Bacteria 1397
147 Ga0081540_1000829 3300005983 Bacteria 28195
148 Ga0081540_1002310 3300005983 Bacteria 15637
149 Ga0081540_1003670 3300005983 Bacteria 12043
150 Ga0081540_1076238 3300005983 Bacteria 1529
151 Ga0081540_1210468 3300005983 Bacteria 700
152 Ga0081539_10036064 3300005985 Bacteria 2964
153 Ga0070717_10091550 3300006028 Bacteria 2568
154 Ga0075365_10092384 3300006038 Bacteria 2063
155 Ga0075365_10151849 3300006038 Bacteria 1611
156 Ga0075365_10426231 3300006038 Bacteria 937
157 Ga0075365_10528621 3300006038 Bacteria 834
158 Ga0075368_10142662 3300006042 Bacteria 998
159 Ga0075368_10425532 3300006042 Bacteria 586
160 Ga0075363_100007278 3300006048 Bacteria 5075
161 Ga0075363_100399376 3300006048 Bacteria 808
162 Ga0075364_10268317 3300006051 Bacteria 1160
163 Ga0075364_10420077 3300006051 Bacteria 913
164 Ga0070715_10233525 3300006163 Bacteria 953
165 Ga0070715_10347085 3300006163 Bacteria 809
166 Ga0070716_100000529 3300006173 Bacteria 15966
167 Ga0070712_100013092 3300006175 Bacteria 5291
168 Ga0075362_10102535 3300006177 Bacteria 1339
169 Ga0075367_10145895 3300006178 Bacteria 1467
170 Ga0075367_10180677 3300006178 Bacteria 1315
171 Ga0075367_10714002 3300006178 Bacteria 638
172 Ga0075367_10792350 3300006178 Bacteria 604
173 Ga0075369_10150554 3300006186 Bacteria 1064
174 Ga0075369_10275958 3300006186 Bacteria 782
175 Ga0075366_10106539 3300006195 Bacteria 1685
176 Ga0075366_10163391 3300006195 Bacteria 1350
177 Ga0075366_10183915 3300006195 Bacteria 1270
178 Ga0075366_11030833 3300006195 Bacteria 514
179 Ga0097621_102049761 3300006237 Bacteria 547
180 Ga0075370_10099336 3300006353 Bacteria 1683
181 Ga0075370_10129926 3300006353 Bacteria 1469
182 Ga0075370_10253374 3300006353 Bacteria 1043
183 Ga0075370_10362603 3300006353 Bacteria 867
184 Ga0075370_10469825 3300006353 Bacteria 758
185 Ga0068871_100343963 3300006358 Bacteria 1318
186 Ga0068871_100957575 3300006358 Bacteria 795
187 Ga0068871_101799299 3300006358 Bacteria 582
188 Ga0075428_100211538 3300006844 Bacteria 2095
189 Ga0075428_100670080 3300006844 Bacteria 1106
190 Ga0075428_100692632 3300006844 Bacteria 1086
191 Ga0075433_10162601 3300006852 Bacteria 1987
192 Ga0075434_101194596 3300006871 Bacteria 773
193 Ga0075436_100415983 3300006914 Bacteria 976
194 Ga0097620_100111073 3300006931 Bacteria 2803
195 Ga0097620_100760660 3300006931 Bacteria 1057
196 Ga0097620_100822833 3300006931 Bacteria 1015
197 Ga0097620_100833413 3300006931 Bacteria 1009
198 Ga0075435_101088303 3300007076 Bacteria 699
199 Ga0105244_10530387 3300009036 Bacteria 542
200 Ga0105250_10507078 3300009092 Bacteria 548
201 Ga0105240_11045035 3300009093 Bacteria 872
202 Ga0111539_10167715 3300009094 Bacteria 2566
203 Ga0111539_10299223 3300009094 Bacteria 1873
204 Ga0111539_11246987 3300009094 Bacteria 863
205 Ga0111539_11655733 3300009094 Bacteria 742
206 Ga0105245_10052050 3300009098 Bacteria 3671
207 Ga0105245_10596944 3300009098 Bacteria 1130
208 Ga0105245_10793278 3300009098 Bacteria 985
209 Ga0105247_10125843 3300009101 Bacteria 1666
210 Ga0105247_10813592 3300009101 Bacteria 714
211 Ga0105247_11118519 3300009101 Bacteria 622
212 Ga0114129_10360207 3300009147 Bacteria 1925
213 Ga0105243_10717154 3300009148 Bacteria 977
214 Ga0105243_11065580 3300009148 Bacteria 815
215 Ga0105241_10183798 3300009174 Bacteria 1736
216 Ga0105241_10901494 3300009174 Bacteria 821
217 Ga0105241_12237969 3300009174 Bacteria 543
218 Ga0105242_12968965 3300009176 Bacteria 525
219 Ga0105248_10006397 3300009177 Bacteria 12921
220 Ga0105248_10527007 3300009177 Bacteria 1332
221 Ga0105237_10365063 3300009545 Bacteria 1448
222 Ga0105237_11302828 3300009545 Bacteria 733
223 Ga0105237_11327003 3300009545 Bacteria 726
224 Ga0105238_10570775 3300009551 Bacteria 1137
225 Ga0105249_10014298 3300009553 Bacteria 7019
226 Ga0105249_10324254 3300009553 Bacteria 1552
227 Ga0105249_10449404 3300009553 Bacteria 1327
228 Ga0105249_10588171 3300009553 Bacteria 1167
229 Ga0105249_11069501 3300009553 Bacteria 876
230 Ga0105249_12580180 3300009553 Bacteria 580
231 Ga0105249_13125033 3300009553 Bacteria 532
232 Ga0105239_10577940 3300010375 Bacteria 1281
233 Ga0105239_10852560 3300010375 Bacteria 1045
234 Ga0105239_12368740 3300010375 Bacteria 618
235 Ga0105239_12538777 3300010375 Bacteria 597
236 Ga0105239_13415774 3300010375 Bacteria 516
237 Ga0105246_10516567 3300011119 Bacteria 1017
238 Ga0105246_11044138 3300011119 Bacteria 743
239 Ga0105246_11391278 3300011119 Bacteria 654
240 Ga0157373_10894934 3300013100 Bacteria 658
241 Ga0157374_10516941 3300013296 Bacteria 1200
242 Ga0157374_10794833 3300013296 Bacteria 962
243 Ga0157378_10041641 3300013297 Bacteria 4075
244 Ga0157378_10135002 3300013297 Bacteria 2287
245 Ga0157378_10149946 3300013297 Bacteria 2172
246 Ga0157378_10421004 3300013297 Bacteria 1320
247 Ga0163162_10240708 3300013306 Bacteria 1940
248 Ga0163162_10421049 3300013306 Bacteria 1468
249 Ga0163162_10533817 3300013306 Bacteria 1302
250 Ga0163162_11282358 3300013306 Bacteria 832
251 Ga0163162_12045030 3300013306 Bacteria 657
252 Ga0163162_12883755 3300013306 Bacteria 553
253 Ga0163162_12930697 3300013306 Bacteria 549
254 Ga0157372_11456931 3300013307 Bacteria 789
255 Ga0157375_10293610 3300013308 Bacteria 1789
256 Ga0157375_11376105 3300013308 Bacteria 831
257 Ga0157375_13106258 3300013308 Bacteria 554
258 Ga0163163_11086018 3300014325 Bacteria 863
259 Ga0163163_11823885 3300014325 Bacteria 668
260 Ga0157380_10214785 3300014326 Bacteria 1717
261 Ga0157380_10453914 3300014326 Unclassified 1232
262 Ga0157380_10468666 3300014326 Bacteria 1215
263 Ga0157380_10656280 3300014326 Bacteria 1047
264 Ga0157380_12532381 3300014326 Bacteria 579
265 Ga0157377_10983253 3300014745 Bacteria 638
266 Ga0157377_11218318 3300014745 Bacteria 584
267 Ga0157379_10836747 3300014968 Bacteria 870
268 Ga0157379_11023626 3300014968 Bacteria 788
269 Ga0157376_10013012 3300014969 Bacteria 6197
270 Ga0157376_10783835 3300014969 Bacteria 965
271 Ga0163161_10099331 3300017792 Bacteria 2164
272 Ga0163161_10295970 3300017792 Bacteria 1273
273 Ga0163161_11042024 3300017792 Bacteria 700
274 Ga0163161_11796744 3300017792 Bacteria 545
275 Ga0213874_10033542 3300021377 Bacteria 1497
276 Ga0213876_10167014 3300021384 Bacteria 1171
277 Ga0209758_1040878 3300025297 Bacteria 1742
278 Ga0207697_10147469 3300025315 Bacteria 1022
279 Ga0207692_10000352 3300025898 Bacteria 15822
280 Ga0207642_10097136 3300025899 Bacteria 1470
281 Ga0207688_10161869 3300025901 Bacteria 1327
282 Ga0207688_10313358 3300025901 Bacteria 961
283 Ga0207688_10469330 3300025901 Bacteria 786
284 Ga0207688_10886623 3300025901 Bacteria 565
285 Ga0207688_10958820 3300025901 Bacteria 541
286 Ga0207680_10369545 3300025903 Bacteria 1010
287 Ga0207647_10226439 3300025904 Bacteria 1077
288 Ga0207685_10282959 3300025905 Bacteria 814
289 Ga0207699_10024600 3300025906 Bacteria 3295
290 Ga0207699_10261697 3300025906 Bacteria 1196
291 Ga0207645_10157141 3300025907 Bacteria 1486
292 Ga0207643_10219488 3300025908 Bacteria 1163
293 Ga0207705_10294484 3300025909 Bacteria 1244
294 Ga0207654_10542822 3300025911 Bacteria 825
295 Ga0207695_10781852 3300025913 Bacteria 835
296 Ga0207671_10124283 3300025914 Bacteria 1975
297 Ga0207693_10013548 3300025915 Bacteria 6571
298 Ga0207663_10010476 3300025916 Bacteria 4937
299 Ga0207663_10054559 3300025916 Bacteria 2503
300 Ga0207660_11455295 3300025917 Bacteria 554
301 Ga0207649_10296762 3300025920 Bacteria 1180
302 Ga0207681_10439045 3300025923 Bacteria 1060
303 Ga0207681_10797580 3300025923 Bacteria 789
304 Ga0207681_10948323 3300025923 Bacteria 721
305 Ga0207650_10313526 3300025925 Bacteria 1283
306 Ga0207659_10687152 3300025926 Bacteria 876
307 Ga0207687_10083359 3300025927 Bacteria 2315
308 Ga0207687_11618076 3300025927 Bacteria 556
309 Ga0207664_10017973 3300025929 Bacteria 5196
310 Ga0207644_10501998 3300025931 Bacteria 1001
311 Ga0207644_10817524 3300025931 Bacteria 780
312 Ga0207644_11170219 3300025931 Bacteria 646
313 Ga0207644_11734539 3300025931 Bacteria 523
314 Ga0207690_10099643 3300025932 Bacteria 2072
315 Ga0207690_11102187 3300025932 Bacteria 662
316 Ga0207706_10184987 3300025933 Bacteria 1829
317 Ga0207706_10204190 3300025933 Bacteria 1733
318 Ga0207686_10420319 3300025934 Bacteria 1022
319 Ga0207686_10648321 3300025934 Bacteria 835
320 Ga0207709_10102520 3300025935 Bacteria 1895
321 Ga0207709_10133079 3300025935 Bacteria 1697
322 Ga0207709_10341186 3300025935 Bacteria 1128
323 Ga0207709_10443560 3300025935 Bacteria 1002
324 Ga0207709_11837665 3300025935 Bacteria 504
325 Ga0207670_10691676 3300025936 Bacteria 843
326 Ga0207670_10847240 3300025936 Bacteria 763
327 Ga0207669_10011911 3300025937 Bacteria 4254
328 Ga0207669_10411917 3300025937 Bacteria 1061
329 Ga0207669_10987494 3300025937 Bacteria 707
330 Ga0207665_10004086 3300025939 Bacteria 9741
331 Ga0207691_10155530 3300025940 Bacteria 2008
332 Ga0207691_10655015 3300025940 Bacteria 887
333 Ga0207711_10054869 3300025941 Bacteria 3420
334 Ga0207711_10449376 3300025941 Bacteria 1200
335 Ga0207689_10021843 3300025942 Bacteria 5381
336 Ga0207689_10077155 3300025942 Bacteria 2739
337 Ga0207689_10146256 3300025942 Bacteria 1947
338 Ga0207689_10283337 3300025942 Bacteria 1372
339 Ga0207689_10546337 3300025942 Bacteria 973
340 Ga0207689_11067976 3300025942 Bacteria 681
341 Ga0207679_10364929 3300025945 Bacteria 1262
342 Ga0207679_11656009 3300025945 Bacteria 586
343 Ga0207667_10842386 3300025949 Bacteria 911
344 Ga0207712_10021257 3300025961 Bacteria 4259
345 Ga0207712_10301079 3300025961 Bacteria 1316
346 Ga0207712_11039386 3300025961 Bacteria 728
347 Ga0207712_11477068 3300025961 Bacteria 609
348 Ga0207668_10015340 3300025972 Bacteria 4758
349 Ga0207668_10028018 3300025972 Bacteria 3677
350 Ga0207668_10595277 3300025972 Unclassified 963
351 Ga0207668_10612502 3300025972 Bacteria 949
352 Ga0207668_10616494 3300025972 Bacteria 946
353 Ga0207668_11264320 3300025972 Bacteria 664
354 Ga0207668_11308847 3300025972 Bacteria 652
355 Ga0207668_11423350 3300025972 Bacteria 625
356 Ga0207668_11983229 3300025972 Bacteria 524
357 Ga0207640_10696603 3300025981 Bacteria 870
358 Ga0207658_10093301 3300025986 Bacteria 2340
359 Ga0207658_10952934 3300025986 Bacteria 782
360 Ga0207658_11221443 3300025986 Bacteria 687
361 Ga0207658_11648549 3300025986 Bacteria 586
362 Ga0207677_10144544 3300026023 Bacteria 1826
363 Ga0207677_10338938 3300026023 Bacteria 1255
364 Ga0207677_10958448 3300026023 Bacteria 774
365 Ga0207677_11512324 3300026023 Bacteria 620
366 Ga0207677_12148733 3300026023 Bacteria 519
367 Ga0207703_10074179 3300026035 Bacteria 2817
368 Ga0207703_11335244 3300026035 Bacteria 690
369 Ga0207703_11390106 3300026035 Bacteria 675
370 Ga0207639_11789107 3300026041 Bacteria 575
371 Ga0207678_10041267 3300026067 Bacteria 4001
372 Ga0207678_10121893 3300026067 Bacteria 2225
373 Ga0207678_10138392 3300026067 Bacteria 2077
374 Ga0207678_10492288 3300026067 Bacteria 1068
375 Ga0207678_10545436 3300026067 Bacteria 1014
376 Ga0207678_11781966 3300026067 Bacteria 539
377 Ga0207678_11941594 3300026067 Bacteria 513
378 Ga0207708_10214815 3300026075 Bacteria 1539
379 Ga0207708_11205237 3300026075 Bacteria 662
380 Ga0207702_10788973 3300026078 Bacteria 939
381 Ga0207648_10599851 3300026089 Bacteria 1015
382 Ga0207676_11381297 3300026095 Bacteria 700
383 Ga0207674_10668561 3300026116 Bacteria 1003
384 Ga0207675_100021881 3300026118 Bacteria 5952
385 Ga0207675_100141875 3300026118 Bacteria 2282
386 Ga0207675_100177937 3300026118 Bacteria 2036
387 Ga0207675_100437559 3300026118 Bacteria 1294
388 Ga0207675_100809883 3300026118 Bacteria 950
389 Ga0207675_102160102 3300026118 Bacteria 572
390 Ga0207675_102270362 3300026118 Bacteria 557
391 Ga0207683_10066474 3300026121 Bacteria 3179
392 Ga0207683_10099842 3300026121 Bacteria 2591
393 Ga0207683_10148561 3300026121 Bacteria 2114
394 Ga0207683_10274167 3300026121 Bacteria 1541
395 Ga0207683_10537598 3300026121 Bacteria 1080
396 Ga0207683_10570872 3300026121 Bacteria 1046
397 Ga0207698_10412356 3300026142 Bacteria 1294
398 Ga0207698_11577727 3300026142 Bacteria 672
399 Ga0209813_10010608 3300027866 Bacteria 2387
400 Ga0207428_10243913 3300027907 Bacteria 1342
401 Ga0207428_10344747 3300027907 Bacteria 1097
402 Ga0268266_10000797 3300028379 Bacteria 41969
403 Ga0268266_10003389 3300028379 Bacteria 15953
404 Ga0268266_10006591 3300028379 Bacteria 10604
405 Ga0268266_10023443 3300028379 Bacteria 5256
406 Ga0268266_11031128 3300028379 Bacteria 796
407 Ga0268266_11139363 3300028379 Bacteria 754
408 Ga0268265_10469233 3300028380 Bacteria 1179
409 Ga0268265_10679476 3300028380 Bacteria 992
410 Ga0268265_11524015 3300028380 Bacteria 672
411 Ga0268265_11649726 3300028380 Bacteria 646
412 Ga0268264_10248180 3300028381 Bacteria 1652
413 Ga0268264_10441183 3300028381 Bacteria 1259
414 Ga0268264_10752410 3300028381 Bacteria 971
415 Ga0268264_10752854 3300028381 Bacteria 971
416 Ga0268264_12485608 3300028381 Bacteria 523
417 Ga0307517_10146034 3300028786 Bacteria 1641
418 Ga0307517_10176949 3300028786 Bacteria 1387
419 Ga0307517_10440631 3300028786 Bacteria 678
420 Ga0307512_10158114 3300030522 Bacteria 1336
421 Ga0307513_10735531 3300031456 Bacteria 692
422 Ga0307509_10707906 3300031507 Bacteria 673
423 Ga0307408_101258390 3300031548 Bacteria 692
424 Ga0307405_11258489 3300031731 Bacteria 642
425 Ga0307413_10296631 3300031824 Bacteria 1224
426 Ga0307410_10032300 3300031852 Bacteria 3367
427 Ga0307407_11577024 3300031903 Bacteria 521
428 Ga0307412_10783625 3300031911 Bacteria 826
429 Ga0307409_100461171 3300031995 Bacteria 1228
430 Ga0307409_100674962 3300031995 Bacteria 1030
431 Ga0307416_100200501 3300032002 Bacteria 1893
432 Ga0307416_101833074 3300032002 Bacteria 710
433 Ga0307416_102161923 3300032002 Bacteria 658
434 Ga0307414_10657817 3300032004 Bacteria 945
435 Ga0373959_0210728 3300034820 Bacteria 517
436 Ga0373940_0210111 3300035088 Unclassified 643
437 Ga0373940_0375122 3300035088 Bacteria 503
438 Ga0373949_0132657 3300035090 Bacteria 708
439 Ga0373923_0683758 3300035111 Bacteria 509
440 Ga0373936_0179600 3300035113 Bacteria 928
441 Ga0373945_0103096 3300035116 Bacteria 1119
442 Ga0373931_0604860 3300035691 Bacteria 717
443 Ga0373935_0691305 3300035692 Bacteria 750
444 Ga0373927_0247415 3300035695 Bacteria 1172
445 Ga0373947_1147716 3300035725 Bacteria 529
446 Ga0395905_0874228 3300037471 Bacteria 802
447 Ga0436365_1081529 3300039437 Bacteria 965
448 Ga0436363_1567841 3300039450 Bacteria 6042
449 Ga0439465_0057872 3300041413 Bacteria 1280
450 Ga0451787_584524 3300041441 Bacteria 641
451 Ga0451791_0660175 3300041451 Bacteria 1147
452 Ga0451793_0512641 3300041452 Bacteria 902
453 Ga0451797_0587181 3300041453 Bacteria 547
454 Ga0451795_1232905 3300041456 Bacteria 968
455 Ga0451798_0063793 3300041458 Bacteria 705
456 Ga0451833_0341673 3300041491 Bacteria 893
457 Ga0451845_0797547 3300041501 Bacteria 600
458 Ga0451843_1009515 3300041509 Bacteria 624
459 Ga0451853_2117235 3300041512 Bacteria 517
460 Ga0439451_116874 3300042009 Bacteria 542
461 Ga0439434_0239220 3300042435 Bacteria 619
462 Ga0439459_0221675 3300042438 Bacteria 524
463 Ga0495617_019758 3300046452 Bacteria 2277
464 Ga0495617_032285 3300046452 Bacteria 1758
465 Ga0495617_165176 3300046452 Bacteria 700
466 Ga0495617_214523 3300046452 Bacteria 599
467 Ga0495603_0009528 3300046455 Bacteria 5867
468 Ga0495603_0043646 3300046455 Bacteria 2676
469 Ga0495603_0876389 3300046455 Bacteria 510
470 Ga0495629_0117235 3300046459 Bacteria 1855
471 Ga0495638_0056192 3300046460 Bacteria 2442
472 Ga0495638_0449247 3300046460 Bacteria 658
473 Ga0495641_0217825 3300046461 Bacteria 856
474 Ga0495641_0331517 3300046461 Bacteria 687
475 Ga0495650_0048405 3300046471 Bacteria 1772
476 Ga0495650_0234742 3300046471 Bacteria 628
477 Ga0495580_0153749 3300046472 Bacteria 1594
478 Ga0495582_0310970 3300046473 Bacteria 906
479 Ga0495582_0912769 3300046473 Bacteria 508
480 Ga0495605_0117642 3300046474 Bacteria 1207
481 Ga0495605_0223945 3300046474 Bacteria 812
482 Ga0495605_0286049 3300046474 Bacteria 700
483 Ga0495605_0286815 3300046474 Bacteria 699
484 Ga0495639_0612733 3300046475 Bacteria 560
485 Ga0495584_0041262 3300046491 Bacteria 2330
486 Ga0495584_0045138 3300046491 Bacteria 2223
487 Ga0495584_0087151 3300046491 Bacteria 1573
488 Ga0495584_0562947 3300046491 Bacteria 581
489 Ga0495584_0690515 3300046491 Bacteria 520
490 Ga0495585_0044365 3300046492 Bacteria 2484
491 Ga0495585_0063952 3300046492 Bacteria 2018
492 Ga0495585_0199063 3300046492 Bacteria 1021
493 Ga0495594_0130562 3300046499 Bacteria 1423
494 Ga0495596_0015478 3300046500 Bacteria 3193
495 Ga0495596_0122429 3300046500 Bacteria 1010
496 Ga0495596_0198214 3300046500 Bacteria 780
497 Ga0495607_0083048 3300046501 Bacteria 1756
498 Ga0495607_0280996 3300046501 Bacteria 790
499 Ga0495583_0035912 3300046506 Bacteria 2361
500 Ga0495606_0000945 3300046507 Bacteria 42787
501 Ga0495606_0046185 3300046507 Bacteria 2880
502 Ga0495616_0178095 3300046513 Bacteria 946
503 Ga0495620_0095749 3300046515 Bacteria 1187
504 Ga0495631_0039792 3300046518 Bacteria 2084
505 Ga0495631_0050831 3300046518 Bacteria 1812
506 Ga0495631_0191450 3300046518 Bacteria 875
507 Ga0495631_0269528 3300046518 Bacteria 725
508 Ga0495632_0036521 3300046519 Bacteria 2499
509 Ga0495632_0186081 3300046519 Bacteria 950
510 Ga0495632_0350983 3300046519 Bacteria 648
511 Ga0495643_0219536 3300046522 Bacteria 902
512 Ga0495644_0022496 3300046523 Bacteria 2403
513 Ga0495644_0150206 3300046523 Bacteria 891
514 Ga0495648_0188184 3300046524 Bacteria 1043
515 Ga0495648_0197225 3300046524 Bacteria 1011
516 Ga0495663_0099307 3300046525 Bacteria 957
517 Ga0495642_0044396 3300046528 Bacteria 1814
518 Ga0495654_0412283 3300046530 Bacteria 535
519 Ga0495598_0377005 3300046537 Bacteria 550
520 Ga0495609_0234337 3300046538 Bacteria 759
521 Ga0495609_0294389 3300046538 Bacteria 662
522 Ga0495609_0385985 3300046538 Bacteria 562
523 Ga0495609_0443064 3300046538 Bacteria 516
524 Ga0495621_0014659 3300046539 Bacteria 2485
525 Ga0495621_0530087 3300046539 Bacteria 510
526 Ga0495597_0041193 3300046542 Bacteria 2064
527 Ga0495622_0066267 3300046557 Bacteria 1669
528 Ga0495622_0223846 3300046557 Bacteria 833
529 Ga0495633_0039158 3300046558 Bacteria 2262
530 Ga0495633_0277117 3300046558 Bacteria 763
531 Ga0495633_0415239 3300046558 Bacteria 608
532 Ga0495656_0006028 3300046615 Bacteria 4222
533 Ga0495656_0213518 3300046615 Bacteria 962
534 Ga0495656_0475409 3300046615 Bacteria 660
535 Ga0495668_0050330 3300046616 Bacteria 2309
536 Ga0495668_0392328 3300046616 Bacteria 762
537 Ga0495668_0521601 3300046616 Bacteria 655
538 Ga0495668_0554813 3300046616 Bacteria 634
539 Ga0495611_0055025 3300046648 Bacteria 1799
540 Ga0495611_0079034 3300046648 Bacteria 1510
541 Ga0495611_0346550 3300046648 Bacteria 682
542 Ga0495625_0134068 3300046660 Bacteria 1675
543 Ga0495625_0278837 3300046660 Bacteria 1076
544 Ga0495625_0603953 3300046660 Bacteria 658
545 Ga0495625_0684073 3300046660 Bacteria 607
546 Ga0495659_0202554 3300046664 Bacteria 814
547 Ga0495659_0310107 3300046664 Bacteria 668
548 Ga0495659_0341482 3300046664 Bacteria 638
549 Ga0495659_0502186 3300046664 Bacteria 532
550 Ga0495661_0159558 3300046665 Bacteria 1212
551 Ga0495661_0192292 3300046665 Bacteria 1074
552 Ga0495588_0030219 3300046674 Bacteria 2722
553 Ga0495588_0055783 3300046674 Bacteria 2039
554 Ga0495588_0436922 3300046674 Bacteria 687
555 Ga0495647_0096325 3300046681 Bacteria 1220
556 Ga0495658_0168383 3300046683 Bacteria 1355
557 Ga0495669_0056355 3300046684 Bacteria 1771
558 Ga0495669_0100606 3300046684 Bacteria 1342
559 Ga0495669_0120024 3300046684 Bacteria 1231
560 Ga0495669_0251100 3300046684 Bacteria 849
561 Ga0495669_0541377 3300046684 Bacteria 566
562 Ga0495624_0193104 3300046690 Bacteria 1238
563 Ga0495670_0113893 3300046691 Bacteria 1401
564 Ga0495670_0212013 3300046691 Bacteria 1027
565 Ga0495670_0388665 3300046691 Bacteria 753
566 Ga0495670_0395049 3300046691 Bacteria 747
567 Ga0495671_0194431 3300046692 Bacteria 985
568 Ga0495671_0501297 3300046692 Bacteria 579
569 Ga0495671_0552129 3300046692 Bacteria 548
570 Ga0495671_0586170 3300046692 Bacteria 530
571 Ga0495589_0348406 3300046794 Bacteria 682
572 Ga0495589_0352559 3300046794 Bacteria 678
573 Ga0495589_0369952 3300046794 Bacteria 659
574 Ga0495660_0188060 3300046810 Bacteria 994
575 Ga0495581_0433251 3300047315 Bacteria 766
576 Ga0495581_0563729 3300047315 Bacteria 661
577 Ga0495581_0661985 3300047315 Bacteria 603
578 Ga0495636_0552257 3300047318 Bacteria 560
579 Ga0495672_0154360 3300047320 Bacteria 1187
580 Ga0495672_0427931 3300047320 Bacteria 601
581 Ga0495676_0313081 3300047321 Bacteria 1056
582 Ga0495676_0734587 3300047321 Bacteria 638
583 Ga0495676_0792041 3300047321 Bacteria 610
584 Ga0495683_0126328 3300047323 Bacteria 1210
585 Ga0495683_0221698 3300047323 Bacteria 843
586 Ga0495683_0229442 3300047323 Bacteria 824
587 Ga0495683_0229675 3300047323 Bacteria 823
588 Ga0495677_0080062 3300047445 Bacteria 1224
589 Ga0495677_0202764 3300047445 Bacteria 771
590 Ga0495685_038104 3300047447 Bacteria 1647
591 Ga0495685_080251 3300047447 Bacteria 1087
592 Ga0495673_0159936 3300047469 Bacteria 865
593 Ga0495673_0176939 3300047469 Bacteria 810
594 Ga0495673_0185272 3300047469 Bacteria 786
595 Ga0495673_0202997 3300047469 Bacteria 741
596 Ga0495681_0140455 3300047470 Bacteria 1021
597 Ga0495686_0596955 3300047472 Bacteria 572
598 Ga0495615_0027476 3300048090 Bacteria 1336
599 Ga0495615_0114162 3300048090 Bacteria 775
600 Ga0495626_0096953 3300048091 Bacteria 1290
601 Ga0495626_0186181 3300048091 Bacteria 858
602 Ga0496100_0082965 3300048903 Bacteria 2169
603 Ga0496100_0604041 3300048903 Bacteria 852
604 Ga0496100_1342723 3300048903 Bacteria 564
605 Ga0496101_0075512 3300048904 Bacteria 2481
606 Ga0496101_0325422 3300048904 Bacteria 1206
607 Ga0496102_0308603 3300048905 Bacteria 1491
608 Ga0496102_0324510 3300048905 Bacteria 1450
609 Ga0496102_0477104 3300048905 Bacteria 1168
610 Ga0496102_0535437 3300048905 Bacteria 1094
611 Ga0496102_1028062 3300048905 Bacteria 744
612 Ga0496103_0198269 3300048906 Bacteria 1291
613 Ga0496103_0516069 3300048906 Bacteria 764
614 Ga0496103_0553721 3300048906 Bacteria 734
615 Ga0496104_0230754 3300048907 Bacteria 1763
616 Ga0496104_0762743 3300048907 Bacteria 874
617 Ga0496105_0651536 3300048908 Bacteria 813
618 Ga0496105_0846993 3300048908 Bacteria 692
619 Ga0496106_0036736 3300048909 Bacteria 3664
620 Ga0496106_0173255 3300048909 Bacteria 1711
621 Ga0496106_0515677 3300048909 Bacteria 960
622 Ga0496106_0871946 3300048909 Bacteria 712
623 Ga0496107_0296589 3300048910 Bacteria 1203
624 Ga0496109_0129145 3300048912 Bacteria 2358
625 Ga0496109_0294799 3300048912 Bacteria 1529
626 Ga0496109_0897655 3300048912 Bacteria 824
627 Ga0496109_0991978 3300048912 Bacteria 777
628 Ga0496110_0049807 3300048913 Bacteria 3677
629 Ga0496110_0199702 3300048913 Bacteria 1817
630 Ga0496111_0219853 3300048914 Bacteria 1411
631 Ga0496112_1782275 3300048915 Bacteria 528
632 Ga0496113_0545491 3300048916 Bacteria 930
633 Ga0496114_0398242 3300048917 Bacteria 1219
634 Ga0496114_0415599 3300048917 Bacteria 1191
635 Ga0496114_0891320 3300048917 Bacteria 770
636 Ga0496115_0237427 3300048918 Bacteria 1503
637 Ga0496118_0451401 3300048921 Bacteria 653
638 Ga0496120_0152961 3300048923 Bacteria 1158
639 Ga0496121_0023924 3300048924 Bacteria 5858
640 Ga0496121_0130751 3300048924 Unclassified 1879
641 Ga0496121_0178107 3300048924 Bacteria 1537
642 Ga0496121_0414501 3300048924 Bacteria 878
643 Ga0496121_0492178 3300048924 Bacteria 780
644 Ga0496124_0245353 3300048927 Bacteria 1329
645 Ga0496124_0548480 3300048927 Bacteria 764
646 Ga0496125_0436398 3300048928 Bacteria 754
647 Ga0496126_0104108 3300048929 Bacteria 2479
648 Ga0495678_030331 3300049459 Bacteria 2264
649 Ga0495682_0078016 3300049460 Bacteria 1191
650 Ga0501036_0227976 3300049572 Bacteria 1564
651 Ga0501048_0215846 3300049582 Bacteria 1360
652 Ga0501068_0505978 3300049584 Bacteria 784
653 Ga0501071_0884410 3300049587 Bacteria 689
654 Ga0501072_0573679 3300049588 Bacteria 890
655 Ga0501076_0415016 3300049592 Bacteria 1107
656 Ga0501080_0416836 3300049742 Bacteria 1207
657 Ga0501044_1055372 3300049823 Bacteria 683
658 Ga0501045_0300102 3300049824 Bacteria 1196
659 nmdc:mga03683_253774_c1 3300050489 Bacteria 817
660 nmdc:mga03683_64030_c2 3300050489 Bacteria 542
661 nmdc:mga03683_65501_c1 3300050489 Bacteria 1543
662 nmdc:mga03n38_675074_c1 3300050490 Bacteria 594
663 nmdc:mga03n38_939760_c1 3300050490 Bacteria 510
664 nmdc:mga00v17_127587_c1 3300050491 Bacteria 1624
665 nmdc:mga00v17_366434_c1 3300050491 Bacteria 937
666 nmdc:mga00v17_792067_c1 3300050491 Bacteria 604
667 nmdc:mga0yw44_204524_c1 3300050492 Bacteria 1305
668 nmdc:mga0yw44_35497_c1 3300050492 Bacteria 2930
669 nmdc:mga0yw44_477316_c1 3300050492 Bacteria 846
670 nmdc:mga0yw44_540170_c1 3300050492 Bacteria 791
671 nmdc:mga0yw44_770088_c1 3300050492 Bacteria 653
672 nmdc:mga0k408_137248_c1 3300050493 Bacteria 1453
673 nmdc:mga0k408_287745_c1 3300050493 Bacteria 981
674 nmdc:mga0k408_837243_c1 3300050493 Bacteria 535
675 nmdc:mga06z11_226790_c1 3300050494 Bacteria 1093
676 nmdc:mga06z11_30067_c1 3300050494 Bacteria 2625
677 nmdc:mga06z11_99989_c1 3300050494 Bacteria 1589
678 nmdc:mga04h51_12541_c1 3300050495 Bacteria 2381
679 nmdc:mga07m45_225374_c1 3300050496 Bacteria 1091
680 nmdc:mga07m45_413842_c1 3300050496 Bacteria 782
681 nmdc:mga07m45_631_c1 3300050496 Bacteria 14967
682 nmdc:mga07m45_769672_c1 3300050496 Bacteria 552
683 nmdc:mga05p37_278913_c1 3300050507 Bacteria 1994
684 nmdc:mga05p37_876084_c1 3300050507 Bacteria 971
685 nmdc:mga08y16_462403_c1 3300050511 Bacteria 1293
686 nmdc:mga08y16_69423_c1 3300050511 Bacteria 3673
687 nmdc:mga0n895_1271253_c1 3300050512 Bacteria 708
688 nmdc:mga0n895_1649859_c1 3300050512 Bacteria 604
689 nmdc:mga0sz30_191300_c1 3300050516 Bacteria 908
690 nmdc:mga0sz30_206319_c1 3300050516 Bacteria 873
691 Ga0495655_0022419 3300053083 Bacteria 1443
692 Ga0495619_0008949 3300053085 Bacteria 6317
693 Ga0495619_0214323 3300053085 Bacteria 1334
694 Ga0500578_0293005 3300053086 Bacteria 967
695 Ga0500643_214718 3300053087 Bacteria 516
696 Ga0500644_0231331 3300053088 Bacteria 774
697 Ga0500644_0405845 3300053088 Bacteria 594
698 Ga0500646_0315624 3300053090 Bacteria 563
699 Ga0500583_0163529 3300053092 Bacteria 1108
700 Ga0500583_0552289 3300053092 Bacteria 535
701 Ga0500651_0097446 3300053093 Bacteria 1806
702 Ga0500651_0131146 3300053093 Bacteria 1516
703 Ga0500641_0028773 3300053096 Bacteria 2172
704 Ga0500641_0137627 3300053096 Bacteria 1054
705 Ga0500650_0179410 3300053098 Bacteria 971
706 Ga0500562_050923 3300053108 Bacteria 1107
707 Ga0500582_130986 3300053114 Bacteria 873
708 Ga0500594_0031354 3300053118 Bacteria 1401
709 Ga0500594_0048681 3300053118 Bacteria 1186
710 Ga0500595_009618 3300053119 Bacteria 3894
711 Ga0500595_047255 3300053119 Bacteria 1349
712 Ga0500595_116746 3300053119 Bacteria 756
713 Ga0500597_106851 3300053120 Bacteria 1216
714 Ga0500617_140423 3300053124 Bacteria 970
715 Ga0500642_0179570 3300053130 Bacteria 989
716 Ga0500658_0206348 3300053134 Bacteria 899
717 Ga0500658_0456532 3300053134 Bacteria 581
718 Ga0500561_0110268 3300053137 Bacteria 832
719 Ga0500568_0205850 3300053139 Bacteria 720
720 Ga0500568_0311075 3300053139 Bacteria 572
721 Ga0500579_201422 3300053143 Bacteria 735
722 Ga0500588_0089629 3300053146 Bacteria 1043
723 Ga0500588_0162291 3300053146 Bacteria 814
724 Ga0500589_019060 3300053147 Bacteria 3115
725 Ga0500589_117167 3300053147 Bacteria 1133
726 Ga0500604_0036335 3300053151 Bacteria 1469
727 Ga0500604_0344474 3300053151 Bacteria 517
728 Ga0500627_0042034 3300053158 Bacteria 1966
729 Ga0500633_0227109 3300053160 Bacteria 696
730 Ga0500634_0080167 3300053161 Bacteria 1684
731 Ga0500634_0143448 3300053161 Bacteria 1127
732 Ga0500638_134820 3300053162 Bacteria 1115
733 Ga0500637_0198678 3300053178 Bacteria 1143
734 Ga0500611_032763 3300053727 Bacteria 1089
735 Ga0500645_010089 3300053730 Bacteria 3142
736 Ga0500609_058193 3300053731 Bacteria 539
737 Ga0501084_0429493 3300054114 Bacteria 1117
738 Ga0501082_0584852 3300060353 Bacteria 977
739 2513692354 2513237101 Bacteria 7952346
740 2723845251 2721755755 Bacteria 8322773
741 2793083533
742 2874605034 2874604998 Bacteria 7834745
743 2876817529 2876808645 Bacteria 8824342
744 2879111521 2879110137 Bacteria 8907982
745 2889040008 2889033259 Bacteria 9099371
746 2922365186 2922361189 Bacteria 7436256
747 2922390817 2922386360 Bacteria 7017218
748 8006965571 8006964411 Bacteria 8966052
749 8006993504 8006984368 Bacteria 9651211
750 8006998893 8006994254 Bacteria 8309700
751 8056674029 8056673599 Bacteria 7871253
752 JGI24738J21930_10100162
753 JGI25406J46586_10146065
754 JGI25404J52841_10003538
755 Ga0070658_11408277
756 Ga0070676_10134039
757 Ga0070676_11164581
758 Ga0070670_100049694
759 Ga0068869_100032889
760 Ga0068869_100162069
761 Ga0068869_100292653
762 Ga0068869_100530379
763 Ga0068869_101773627
764 Ga0070666_10904716
765 Ga0070666_11387796
766 Ga0070682_101079936
767 Ga0068868_100019362
768 Ga0068868_100143820
769 Ga0068868_100590919
770 Ga0068868_101067523
771 Ga0070660_100601167
772 Ga0070689_100902712
773 Ga0070689_101026545
774 Ga0070691_10542390
775 Ga0070691_10902279
776 Ga0070661_101125110
777 Ga0070692_10555325
778 Ga0070668_100027559
779 Ga0070668_100035347
780 Ga0070668_100043775
781 Ga0070668_100354037
782 Ga0070668_100388201
783 Ga0070668_100548940
784 Ga0070668_100818119
785 Ga0070668_101667225
786 Ga0070669_100054144
787 Ga0070669_100730746
788 Ga0070669_101758810
789 Ga0070675_100383967
790 Ga0070671_101023848
791 Ga0070671_101133820
792 Ga0070674_100324468
793 Ga0070673_100702611
794 Ga0070673_101161350
795 Ga0070688_100438068
796 Ga0070688_100744061
797 Ga0070659_101012606
798 Ga0070659_101338556
799 Ga0070667_100130190
800 Ga0070667_100350423
801 Ga0070667_100713167
802 Ga0070667_102191418
803 Ga0070703_10410343
804 Ga0070709_10002536
805 Ga0070714_100002611
806 Ga0070714_100577552
807 Ga0070713_100034345
808 Ga0070710_10000517
809 Ga0070710_10090598
810 Ga0070701_10564305
811 Ga0070711_100003443
812 Ga0070711_100016032
813 Ga0070700_100037296
814 Ga0070700_101042829
815 Ga0070700_101719837
816 Ga0070694_100360527
817 Ga0070663_100086861
818 Ga0070663_100123349
819 Ga0070663_100534907
820 Ga0070678_100051348
821 Ga0070678_100069574
822 Ga0070678_100211621
823 Ga0070678_100533817
824 Ga0070662_100093206
825 Ga0070662_100208901
826 Ga0070662_101609641
827 Ga0070698_100181894
828 Ga0070698_102128394
829 Ga0068853_101212866
830 Ga0068853_101915952
831 Ga0068853_102224528
832 Ga0070672_100562996
833 Ga0070672_100667395
834 Ga0070686_100136175
835 Ga0070686_100640483
836 Ga0070695_100039170
837 Ga0070693_100224950
838 Ga0070693_100653355
839 Ga0070665_100004521
840 Ga0070665_100017374
841 Ga0070665_100025517
842 Ga0070665_100026171
843 Ga0070665_100282305
844 Ga0070665_100289395
845 Ga0070665_100491279
846 Ga0070665_101654654
847 Ga0070665_101823598
848 Ga0070704_100237636
849 Ga0070704_100546493
850 Ga0068855_100325594
851 Ga0070664_100694112
852 Ga0070664_101557984
853 Ga0070664_102319990
854 Ga0068857_100590730
855 Ga0068857_100661500
856 Ga0068854_100290286
857 Ga0068856_100158739
858 Ga0070702_100175754
859 Ga0070702_100189095
860 Ga0070702_100834969
861 Ga0068852_100377667
862 Ga0068852_101031588
863 Ga0068852_102093551
864 Ga0068852_102437223
865 Ga0068859_100111070
866 Ga0068859_100822815
867 Ga0068859_100833448
868 Ga0068864_100040231
869 Ga0068864_100364405
870 Ga0068864_101173461
871 Ga0068864_102226001
872 Ga0068866_10188186
873 Ga0068861_100023440
874 Ga0068861_100121434
875 Ga0068861_100360868
876 Ga0068861_100495361
877 Ga0068861_100913085
878 Ga0068861_101585856
879 Ga0068863_100035436
880 Ga0068863_101705815
881 Ga0068858_100012050
882 Ga0068858_100108508
883 Ga0068858_100734169
884 Ga0068860_100084228
885 Ga0068860_102069405
886 Ga0068860_102191355
887 Ga0068860_102531823
888 Ga0068862_100006644
889 Ga0068862_100058358
890 Ga0068862_100134805
891 Ga0068862_100297255
892 Ga0068862_100463463
893 Ga0068862_100505767
894 Ga0068862_101219095
895 Ga0081455_10002749
896 Ga0081455_10290977
897 Ga0081538_10106030
898 Ga0081540_1000829
899 Ga0081540_1002310
900 Ga0081540_1003670
901 Ga0081540_1076238
902 Ga0081540_1210468
903 Ga0081539_10036064
904 Ga0070717_10091550
905 Ga0075365_10092384
906 Ga0075365_10151849
907 Ga0075365_10426231
908 Ga0075365_10528621
909 Ga0075368_10142662
910 Ga0075368_10425532
911 Ga0075363_100007278
912 Ga0075363_100399376
913 Ga0075364_10268317
914 Ga0075364_10420077
915 Ga0070715_10233525
916 Ga0070715_10347085
917 Ga0070716_100000529
918 Ga0070712_100013092
919 Ga0075362_10102535
920 Ga0075367_10145895
921 Ga0075367_10180677
922 Ga0075367_10714002
923 Ga0075367_10792350
924 Ga0075369_10150554
925 Ga0075369_10275958
926 Ga0075366_10106539
927 Ga0075366_10163391
928 Ga0075366_10183915
929 Ga0075366_11030833
930 Ga0097621_102049761
931 Ga0075370_10099336
932 Ga0075370_10129926
933 Ga0075370_10253374
934 Ga0075370_10362603
935 Ga0075370_10469825
936 Ga0068871_100343963
937 Ga0068871_100957575
938 Ga0068871_101799299
939 Ga0075428_100211538
940 Ga0075428_100670080
941 Ga0075428_100692632
942 Ga0075433_10162601
943 Ga0075434_101194596
944 Ga0075436_100415983
945 Ga0097620_100111073
946 Ga0097620_100760660
947 Ga0097620_100822833
948 Ga0097620_100833413
949 Ga0075435_101088303
950 Ga0105244_10530387
951 Ga0105250_10507078
952 Ga0105240_11045035
953 Ga0111539_10167715
954 Ga0111539_10299223
955 Ga0111539_11246987
956 Ga0111539_11655733
957 Ga0105245_10052050
958 Ga0105245_10596944
959 Ga0105245_10793278
960 Ga0105247_10125843
961 Ga0105247_10813592
962 Ga0105247_11118519
963 Ga0114129_10360207
964 Ga0105243_10717154
965 Ga0105243_11065580
966 Ga0105241_10183798
967 Ga0105241_10901494
968 Ga0105241_12237969
969 Ga0105242_12968965
970 Ga0105248_10006397
971 Ga0105248_10527007
972 Ga0105237_10365063
973 Ga0105237_11302828
974 Ga0105237_11327003
975 Ga0105238_10570775
976 Ga0105249_10014298
977 Ga0105249_10324254
978 Ga0105249_10449404
979 Ga0105249_10588171
980 Ga0105249_11069501
981 Ga0105249_12580180
982 Ga0105249_13125033
983 Ga0105239_10577940
984 Ga0105239_10852560
985 Ga0105239_12368740
986 Ga0105239_12538777
987 Ga0105239_13415774
988 Ga0105246_10516567
989 Ga0105246_11044138
990 Ga0105246_11391278
991 Ga0157373_10894934
992 Ga0157374_10516941
993 Ga0157374_10794833
994 Ga0157378_10041641
995 Ga0157378_10135002
996 Ga0157378_10149946
997 Ga0157378_10421004
998 Ga0163162_10240708
999 Ga0163162_10421049
1000 Ga0163162_10533817
1001 Ga0163162_11282358
1002 Ga0163162_12045030
1003 Ga0163162_12883755
1004 Ga0163162_12930697
1005 Ga0157372_11456931
1006 Ga0157375_10293610
1007 Ga0157375_11376105
1008 Ga0157375_13106258
1009 Ga0163163_11086018
1010 Ga0163163_11823885
1011 Ga0157380_10214785
1012 Ga0157380_10453914
1013 Ga0157380_10468666
1014 Ga0157380_10656280
1015 Ga0157380_12532381
1016 Ga0157377_10983253
1017 Ga0157377_11218318
1018 Ga0157379_10836747
1019 Ga0157379_11023626
1020 Ga0157376_10013012
1021 Ga0157376_10783835
1022 Ga0163161_10099331
1023 Ga0163161_10295970
1024 Ga0163161_11042024
1025 Ga0163161_11796744
1026 Ga0213874_10033542
1027 Ga0213876_10167014
1028 Ga0209758_1040878
1029 Ga0207697_10147469
1030 Ga0207692_10000352
1031 Ga0207642_10097136
1032 Ga0207688_10161869
1033 Ga0207688_10313358
1034 Ga0207688_10469330
1035 Ga0207688_10886623
1036 Ga0207688_10958820
1037 Ga0207680_10369545
1038 Ga0207647_10226439
1039 Ga0207685_10282959
1040 Ga0207699_10024600
1041 Ga0207699_10261697
1042 Ga0207645_10157141
1043 Ga0207643_10219488
1044 Ga0207705_10294484
1045 Ga0207654_10542822
1046 Ga0207695_10781852
1047 Ga0207671_10124283
1048 Ga0207693_10013548
1049 Ga0207663_10010476
1050 Ga0207663_10054559
1051 Ga0207660_11455295
1052 Ga0207649_10296762
1053 Ga0207681_10439045
1054 Ga0207681_10797580
1055 Ga0207681_10948323
1056 Ga0207650_10313526
1057 Ga0207659_10687152
1058 Ga0207687_10083359
1059 Ga0207687_11618076
1060 Ga0207664_10017973
1061 Ga0207644_10501998
1062 Ga0207644_10817524
1063 Ga0207644_11170219
1064 Ga0207644_11734539
1065 Ga0207690_10099643
1066 Ga0207690_11102187
1067 Ga0207706_10184987
1068 Ga0207706_10204190
1069 Ga0207686_10420319
1070 Ga0207686_10648321
1071 Ga0207709_10102520
1072 Ga0207709_10133079
1073 Ga0207709_10341186
1074 Ga0207709_10443560
1075 Ga0207709_11837665
1076 Ga0207670_10691676
1077 Ga0207670_10847240
1078 Ga0207669_10011911
1079 Ga0207669_10411917
1080 Ga0207669_10987494
1081 Ga0207665_10004086
1082 Ga0207691_10155530
1083 Ga0207691_10655015
1084 Ga0207711_10054869
1085 Ga0207711_10449376
1086 Ga0207689_10021843
1087 Ga0207689_10077155
1088 Ga0207689_10146256
1089 Ga0207689_10283337
1090 Ga0207689_10546337
1091 Ga0207689_11067976
1092 Ga0207679_10364929
1093 Ga0207679_11656009
1094 Ga0207667_10842386
1095 Ga0207712_10021257
1096 Ga0207712_10301079
1097 Ga0207712_11039386
1098 Ga0207712_11477068
1099 Ga0207668_10015340
1100 Ga0207668_10028018
1101 Ga0207668_10595277
1102 Ga0207668_10612502
1103 Ga0207668_10616494
1104 Ga0207668_11264320
1105 Ga0207668_11308847
1106 Ga0207668_11423350
1107 Ga0207668_11983229
1108 Ga0207640_10696603
1109 Ga0207658_10093301
1110 Ga0207658_10952934
1111 Ga0207658_11221443
1112 Ga0207658_11648549
1113 Ga0207677_10144544
1114 Ga0207677_10338938
1115 Ga0207677_10958448
1116 Ga0207677_11512324
1117 Ga0207677_12148733
1118 Ga0207703_10074179
1119 Ga0207703_11335244
1120 Ga0207703_11390106
1121 Ga0207639_11789107
1122 Ga0207678_10041267
1123 Ga0207678_10121893
1124 Ga0207678_10138392
1125 Ga0207678_10492288
1126 Ga0207678_10545436
1127 Ga0207678_11781966
1128 Ga0207678_11941594
1129 Ga0207708_10214815
1130 Ga0207708_11205237
1131 Ga0207702_10788973
1132 Ga0207648_10599851
1133 Ga0207676_11381297
1134 Ga0207674_10668561
1135 Ga0207675_100021881
1136 Ga0207675_100141875
1137 Ga0207675_100177937
1138 Ga0207675_100437559
1139 Ga0207675_100809883
1140 Ga0207675_102160102
1141 Ga0207675_102270362
1142 Ga0207683_10066474
1143 Ga0207683_10099842
1144 Ga0207683_10148561
1145 Ga0207683_10274167
1146 Ga0207683_10537598
1147 Ga0207683_10570872
1148 Ga0207698_10412356
1149 Ga0207698_11577727
1150 Ga0209813_10010608
1151 Ga0207428_10243913
1152 Ga0207428_10344747
1153 Ga0268266_10000797
1154 Ga0268266_10003389
1155 Ga0268266_10006591
1156 Ga0268266_10023443
1157 Ga0268266_11031128
1158 Ga0268266_11139363
1159 Ga0268265_10469233
1160 Ga0268265_10679476
1161 Ga0268265_11524015
1162 Ga0268265_11649726
1163 Ga0268264_10248180
1164 Ga0268264_10441183
1165 Ga0268264_10752410
1166 Ga0268264_10752854
1167 Ga0268264_12485608
1168 Ga0307517_10146034
1169 Ga0307517_10176949
1170 Ga0307517_10440631
1171 Ga0307512_10158114
1172 Ga0307513_10735531
1173 Ga0307509_10707906
1174 Ga0307408_101258390
1175 Ga0307405_11258489
1176 Ga0307413_10296631
1177 Ga0307410_10032300
1178 Ga0307407_11577024
1179 Ga0307412_10783625
1180 Ga0307409_100461171
1181 Ga0307409_100674962
1182 Ga0307416_100200501
1183 Ga0307416_101833074
1184 Ga0307416_102161923
1185 Ga0307414_10657817
1186 Ga0373959_0210728
1187 Ga0373940_0210111
1188 Ga0373940_0375122
1189 Ga0373949_0132657
1190 Ga0373923_0683758
1191 Ga0373936_0179600
1192 Ga0373945_0103096
1193 Ga0373931_0604860
1194 Ga0373935_0691305
1195 Ga0373927_0247415
1196 Ga0373947_1147716
1197 Ga0395905_0874228
1198 Ga0436365_1081529
1199 Ga0436363_1567841
1200 Ga0439465_0057872
1201 Ga0451787_584524
1202 Ga0451791_0660175
1203 Ga0451793_0512641
1204 Ga0451797_0587181
1205 Ga0451795_1232905
1206 Ga0451798_0063793
1207 Ga0451833_0341673
1208 Ga0451845_0797547
1209 Ga0451843_1009515
1210 Ga0451853_2117235
1211 Ga0439451_116874
1212 Ga0439434_0239220
1213 Ga0439459_0221675
1214 Ga0495617_019758
1215 Ga0495617_032285
1216 Ga0495617_165176
1217 Ga0495617_214523
1218 Ga0495603_0009528
1219 Ga0495603_0043646
1220 Ga0495603_0876389
1221 Ga0495629_0117235
1222 Ga0495638_0056192
1223 Ga0495638_0449247
1224 Ga0495641_0217825
1225 Ga0495641_0331517
1226 Ga0495650_0048405
1227 Ga0495650_0234742
1228 Ga0495580_0153749
1229 Ga0495582_0310970
1230 Ga0495582_0912769
1231 Ga0495605_0117642
1232 Ga0495605_0223945
1233 Ga0495605_0286049
1234 Ga0495605_0286815
1235 Ga0495639_0612733
1236 Ga0495584_0041262
1237 Ga0495584_0045138
1238 Ga0495584_0087151
1239 Ga0495584_0562947
1240 Ga0495584_0690515
1241 Ga0495585_0044365
1242 Ga0495585_0063952
1243 Ga0495585_0199063
1244 Ga0495594_0130562
1245 Ga0495596_0015478
1246 Ga0495596_0122429
1247 Ga0495596_0198214
1248 Ga0495607_0083048
1249 Ga0495607_0280996
1250 Ga0495583_0035912
1251 Ga0495606_0000945
1252 Ga0495606_0046185
1253 Ga0495616_0178095
1254 Ga0495620_0095749
1255 Ga0495631_0039792
1256 Ga0495631_0050831
1257 Ga0495631_0191450
1258 Ga0495631_0269528
1259 Ga0495632_0036521
1260 Ga0495632_0186081
1261 Ga0495632_0350983
1262 Ga0495643_0219536
1263 Ga0495644_0022496
1264 Ga0495644_0150206
1265 Ga0495648_0188184
1266 Ga0495648_0197225
1267 Ga0495663_0099307
1268 Ga0495642_0044396
1269 Ga0495654_0412283
1270 Ga0495598_0377005
1271 Ga0495609_0234337
1272 Ga0495609_0294389
1273 Ga0495609_0385985
1274 Ga0495609_0443064
1275 Ga0495621_0014659
1276 Ga0495621_0530087
1277 Ga0495597_0041193
1278 Ga0495622_0066267
1279 Ga0495622_0223846
1280 Ga0495633_0039158
1281 Ga0495633_0277117
1282 Ga0495633_0415239
1283 Ga0495656_0006028
1284 Ga0495656_0213518
1285 Ga0495656_0475409
1286 Ga0495668_0050330
1287 Ga0495668_0392328
1288 Ga0495668_0521601
1289 Ga0495668_0554813
1290 Ga0495611_0055025
1291 Ga0495611_0079034
1292 Ga0495611_0346550
1293 Ga0495625_0134068
1294 Ga0495625_0278837
1295 Ga0495625_0603953
1296 Ga0495625_0684073
1297 Ga0495659_0202554
1298 Ga0495659_0310107
1299 Ga0495659_0341482
1300 Ga0495659_0502186
1301 Ga0495661_0159558
1302 Ga0495661_0192292
1303 Ga0495588_0030219
1304 Ga0495588_0055783
1305 Ga0495588_0436922
1306 Ga0495647_0096325
1307 Ga0495658_0168383
1308 Ga0495669_0056355
1309 Ga0495669_0100606
1310 Ga0495669_0120024
1311 Ga0495669_0251100
1312 Ga0495669_0541377
1313 Ga0495624_0193104
1314 Ga0495670_0113893
1315 Ga0495670_0212013
1316 Ga0495670_0388665
1317 Ga0495670_0395049
1318 Ga0495671_0194431
1319 Ga0495671_0501297
1320 Ga0495671_0552129
1321 Ga0495671_0586170
1322 Ga0495589_0348406
1323 Ga0495589_0352559
1324 Ga0495589_0369952
1325 Ga0495660_0188060
1326 Ga0495581_0433251
1327 Ga0495581_0563729
1328 Ga0495581_0661985
1329 Ga0495636_0552257
1330 Ga0495672_0154360
1331 Ga0495672_0427931
1332 Ga0495676_0313081
1333 Ga0495676_0734587
1334 Ga0495676_0792041
1335 Ga0495683_0126328
1336 Ga0495683_0221698
1337 Ga0495683_0229442
1338 Ga0495683_0229675
1339 Ga0495677_0080062
1340 Ga0495677_0202764
1341 Ga0495685_038104
1342 Ga0495685_080251
1343 Ga0495673_0159936
1344 Ga0495673_0176939
1345 Ga0495673_0185272
1346 Ga0495673_0202997
1347 Ga0495681_0140455
1348 Ga0495686_0596955
1349 Ga0495615_0027476
1350 Ga0495615_0114162
1351 Ga0495626_0096953
1352 Ga0495626_0186181
1353 Ga0496100_0082965
1354 Ga0496100_0604041
1355 Ga0496100_1342723
1356 Ga0496101_0075512
1357 Ga0496101_0325422
1358 Ga0496102_0308603
1359 Ga0496102_0324510
1360 Ga0496102_0477104
1361 Ga0496102_0535437
1362 Ga0496102_1028062
1363 Ga0496103_0198269
1364 Ga0496103_0516069
1365 Ga0496103_0553721
1366 Ga0496104_0230754
1367 Ga0496104_0762743
1368 Ga0496105_0651536
1369 Ga0496105_0846993
1370 Ga0496106_0036736
1371 Ga0496106_0173255
1372 Ga0496106_0515677
1373 Ga0496106_0871946
1374 Ga0496107_0296589
1375 Ga0496109_0129145
1376 Ga0496109_0294799
1377 Ga0496109_0897655
1378 Ga0496109_0991978
1379 Ga0496110_0049807
1380 Ga0496110_0199702
1381 Ga0496111_0219853
1382 Ga0496112_1782275
1383 Ga0496113_0545491
1384 Ga0496114_0398242
1385 Ga0496114_0415599
1386 Ga0496114_0891320
1387 Ga0496115_0237427
1388 Ga0496118_0451401
1389 Ga0496120_0152961
1390 Ga0496121_0023924
1391 Ga0496121_0130751
1392 Ga0496121_0178107
1393 Ga0496121_0414501
1394 Ga0496121_0492178
1395 Ga0496124_0245353
1396 Ga0496124_0548480
1397 Ga0496125_0436398
1398 Ga0496126_0104108
1399 Ga0495678_030331
1400 Ga0495682_0078016
1401 Ga0501036_0227976
1402 Ga0501048_0215846
1403 Ga0501068_0505978
1404 Ga0501071_0884410
1405 Ga0501072_0573679
1406 Ga0501076_0415016
1407 Ga0501080_0416836
1408 Ga0501044_1055372
1409 Ga0501045_0300102
1410 nmdc:mga03683_253774_c1
1411 nmdc:mga03683_64030_c2
1412 nmdc:mga03683_65501_c1
1413 nmdc:mga03n38_675074_c1
1414 nmdc:mga03n38_939760_c1
1415 nmdc:mga00v17_127587_c1
1416 nmdc:mga00v17_366434_c1
1417 nmdc:mga00v17_792067_c1
1418 nmdc:mga0yw44_204524_c1
1419 nmdc:mga0yw44_35497_c1
1420 nmdc:mga0yw44_477316_c1
1421 nmdc:mga0yw44_540170_c1
1422 nmdc:mga0yw44_770088_c1
1423 nmdc:mga0k408_137248_c1
1424 nmdc:mga0k408_287745_c1
1425 nmdc:mga0k408_837243_c1
1426 nmdc:mga06z11_226790_c1
1427 nmdc:mga06z11_30067_c1
1428 nmdc:mga06z11_99989_c1
1429 nmdc:mga04h51_12541_c1
1430 nmdc:mga07m45_225374_c1
1431 nmdc:mga07m45_413842_c1
1432 nmdc:mga07m45_631_c1
1433 nmdc:mga07m45_769672_c1
1434 nmdc:mga05p37_278913_c1
1435 nmdc:mga05p37_876084_c1
1436 nmdc:mga08y16_462403_c1
1437 nmdc:mga08y16_69423_c1
1438 nmdc:mga0n895_1271253_c1
1439 nmdc:mga0n895_1649859_c1
1440 nmdc:mga0sz30_191300_c1
1441 nmdc:mga0sz30_206319_c1
1442 Ga0495655_0022419
1443 Ga0495619_0008949
1444 Ga0495619_0214323
1445 Ga0500578_0293005
1446 Ga0500643_214718
1447 Ga0500644_0231331
1448 Ga0500644_0405845
1449 Ga0500646_0315624
1450 Ga0500583_0163529
1451 Ga0500583_0552289
1452 Ga0500651_0097446
1453 Ga0500651_0131146
1454 Ga0500641_0028773
1455 Ga0500641_0137627
1456 Ga0500650_0179410
1457 Ga0500562_050923
1458 Ga0500582_130986
1459 Ga0500594_0031354
1460 Ga0500594_0048681
1461 Ga0500595_009618
1462 Ga0500595_047255
1463 Ga0500595_116746
1464 Ga0500597_106851
1465 Ga0500617_140423
1466 Ga0500642_0179570
1467 Ga0500658_0206348
1468 Ga0500658_0456532
1469 Ga0500561_0110268
1470 Ga0500568_0205850
1471 Ga0500568_0311075
1472 Ga0500579_201422
1473 Ga0500588_0089629
1474 Ga0500588_0162291
1475 Ga0500589_019060
1476 Ga0500589_117167
1477 Ga0500604_0036335
1478 Ga0500604_0344474
1479 Ga0500627_0042034
1480 Ga0500633_0227109
1481 Ga0500634_0080167
1482 Ga0500634_0143448
1483 Ga0500638_134820
1484 Ga0500637_0198678
1485 Ga0500611_032763
1486 Ga0500645_010089
1487 Ga0500609_058193
1488 Ga0501084_0429493
1489 Ga0501082_0584852
1490 2513692354
1491 2723845251
1492 2793083533
1493 2874605034
1494 2876817529
1495 2879111521
1496 2889040008
1497 2922365186
1498 2922390817
1499 8006965571
1500 8006993504
1501 8006998893
1502 8056674029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02530

Porin_2

Porin subfamily

44

82

0.88

Map